data_1LPH # _entry.id 1LPH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 1LPH pdb_00001lph 10.2210/pdb1lph/pdb WWPDB D_1000174790 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1996-06-20 2 'Structure model' 1 1 2008-03-24 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-11-03 5 'Structure model' 1 4 2024-11-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_conn_angle 4 4 'Structure model' struct_conn 5 4 'Structure model' struct_ref_seq_dif 6 4 'Structure model' struct_site 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond 9 5 'Structure model' pdbx_entry_details 10 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 17 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry' 18 4 'Structure model' '_pdbx_struct_conn_angle.value' 19 4 'Structure model' '_struct_conn.pdbx_dist_value' 20 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 21 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 22 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 23 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 24 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 25 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 26 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 27 4 'Structure model' '_struct_conn.ptnr1_symmetry' 28 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 29 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 30 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 31 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 32 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 33 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 34 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 35 4 'Structure model' '_struct_conn.ptnr2_symmetry' 36 4 'Structure model' '_struct_ref_seq_dif.details' 37 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 38 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 39 4 'Structure model' '_struct_site.pdbx_auth_seq_id' 40 5 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 1LPH _pdbx_database_status.recvd_initial_deposition_date 1995-04-19 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ciszak, E.' 1 'Beals, J.M.' 2 'Frank, B.H.' 3 'Baker, J.C.' 4 'Carter, N.D.' 5 'Smith, G.D.' 6 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Role of C-terminal B-chain residues in insulin assembly: the structure of hexameric LysB28ProB29-human insulin.' Structure 3 615 622 1995 STRUE6 UK 0969-2126 2005 ? 8590022 '10.1016/S0969-2126(01)00195-2' 1 ;The Structure of a Complex of Hexameric Insulin and 4'-Hydroxyacetanilide ; Proc.Natl.Acad.Sci.USA 91 8851 ? 1994 PNASA6 US 0027-8424 0040 ? ? ? 2 'Crystallographic Evidence for Dual Coordination Around Zinc in the T3R3 Human Insulin Hexamer' Biochemistry 33 1512 ? 1994 BICHAW US 0006-2960 0033 ? ? ? 3 'Structural Stability in the 4-Zinc Human Insulin Hexamer' Proc.Natl.Acad.Sci.USA 81 7093 ? 1984 PNASA6 US 0027-8424 0040 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ciszak, E.' 1 ? primary 'Beals, J.M.' 2 ? primary 'Frank, B.H.' 3 ? primary 'Baker, J.C.' 4 ? primary 'Carter, N.D.' 5 ? primary 'Smith, G.D.' 6 ? 1 'Smith, G.D.' 7 ? 1 'Ciszak, E.' 8 ? 2 'Ciszak, E.' 9 ? 2 'Smith, G.D.' 10 ? 3 'Smith, G.D.' 11 ? 3 'Swenson, D.C.' 12 ? 3 'Dodson, E.J.' 13 ? 3 'Dodson, G.G.' 14 ? 3 'Reynolds, C.D.' 15 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man INSULIN 2383.698 2 ? 'CHAIN B, D, P28K, K29P' ? ? 2 polymer man INSULIN 3433.953 2 ? 'CHAIN B, D, P28K, K29P' ? ? 3 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? 4 non-polymer syn PHENOL 94.111 1 ? ? ? ? 5 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 6 water nat water 18.015 59 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'LYS(B28)PRO(B29)-HUMAN INSULIN' 2 'LYS(B28)PRO(B29)-HUMAN INSULIN' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN A,C ? 2 'polypeptide(L)' no no FVNQHLCGSHLVEALYLVCGERGFFYTKPT FVNQHLCGSHLVEALYLVCGERGFFYTKPT B,D ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'ZINC ION' ZN 4 PHENOL IPH 5 'CHLORIDE ION' CL 6 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ILE n 1 3 VAL n 1 4 GLU n 1 5 GLN n 1 6 CYS n 1 7 CYS n 1 8 THR n 1 9 SER n 1 10 ILE n 1 11 CYS n 1 12 SER n 1 13 LEU n 1 14 TYR n 1 15 GLN n 1 16 LEU n 1 17 GLU n 1 18 ASN n 1 19 TYR n 1 20 CYS n 1 21 ASN n 2 1 PHE n 2 2 VAL n 2 3 ASN n 2 4 GLN n 2 5 HIS n 2 6 LEU n 2 7 CYS n 2 8 GLY n 2 9 SER n 2 10 HIS n 2 11 LEU n 2 12 VAL n 2 13 GLU n 2 14 ALA n 2 15 LEU n 2 16 TYR n 2 17 LEU n 2 18 VAL n 2 19 CYS n 2 20 GLY n 2 21 GLU n 2 22 ARG n 2 23 GLY n 2 24 PHE n 2 25 PHE n 2 26 TYR n 2 27 THR n 2 28 LYS n 2 29 PRO n 2 30 THR n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 IPH non-polymer . PHENOL ? 'C6 H6 O' 94.111 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 ASN 21 21 21 ASN ASN A . n B 2 1 PHE 1 1 1 PHE PHE B . n B 2 2 VAL 2 2 2 VAL VAL B . n B 2 3 ASN 3 3 3 ASN ASN B . n B 2 4 GLN 4 4 4 GLN GLN B . n B 2 5 HIS 5 5 5 HIS HIS B . n B 2 6 LEU 6 6 6 LEU LEU B . n B 2 7 CYS 7 7 7 CYS CYS B . n B 2 8 GLY 8 8 8 GLY GLY B . n B 2 9 SER 9 9 9 SER SER B . n B 2 10 HIS 10 10 10 HIS HIS B . n B 2 11 LEU 11 11 11 LEU LEU B . n B 2 12 VAL 12 12 12 VAL VAL B . n B 2 13 GLU 13 13 13 GLU GLU B . n B 2 14 ALA 14 14 14 ALA ALA B . n B 2 15 LEU 15 15 15 LEU LEU B . n B 2 16 TYR 16 16 16 TYR TYR B . n B 2 17 LEU 17 17 17 LEU LEU B . n B 2 18 VAL 18 18 18 VAL VAL B . n B 2 19 CYS 19 19 19 CYS CYS B . n B 2 20 GLY 20 20 20 GLY GLY B . n B 2 21 GLU 21 21 21 GLU GLU B . n B 2 22 ARG 22 22 22 ARG ARG B . n B 2 23 GLY 23 23 23 GLY GLY B . n B 2 24 PHE 24 24 24 PHE PHE B . n B 2 25 PHE 25 25 25 PHE PHE B . n B 2 26 TYR 26 26 26 TYR TYR B . n B 2 27 THR 27 27 27 THR THR B . n B 2 28 LYS 28 28 28 LYS LYS B . n B 2 29 PRO 29 29 29 PRO PRO B . n B 2 30 THR 30 30 30 THR THR B . n C 1 1 GLY 1 1 1 GLY GLY C . n C 1 2 ILE 2 2 2 ILE ILE C . n C 1 3 VAL 3 3 3 VAL VAL C . n C 1 4 GLU 4 4 4 GLU GLU C . n C 1 5 GLN 5 5 5 GLN GLN C . n C 1 6 CYS 6 6 6 CYS CYS C . n C 1 7 CYS 7 7 7 CYS CYS C . n C 1 8 THR 8 8 8 THR THR C . n C 1 9 SER 9 9 9 SER SER C . n C 1 10 ILE 10 10 10 ILE ILE C . n C 1 11 CYS 11 11 11 CYS CYS C . n C 1 12 SER 12 12 12 SER SER C . n C 1 13 LEU 13 13 13 LEU LEU C . n C 1 14 TYR 14 14 14 TYR TYR C . n C 1 15 GLN 15 15 15 GLN GLN C . n C 1 16 LEU 16 16 16 LEU LEU C . n C 1 17 GLU 17 17 17 GLU GLU C . n C 1 18 ASN 18 18 18 ASN ASN C . n C 1 19 TYR 19 19 19 TYR TYR C . n C 1 20 CYS 20 20 20 CYS CYS C . n C 1 21 ASN 21 21 21 ASN ASN C . n D 2 1 PHE 1 1 1 PHE PHE D . n D 2 2 VAL 2 2 2 VAL VAL D . n D 2 3 ASN 3 3 3 ASN ASN D . n D 2 4 GLN 4 4 4 GLN GLN D . n D 2 5 HIS 5 5 5 HIS HIS D . n D 2 6 LEU 6 6 6 LEU LEU D . n D 2 7 CYS 7 7 7 CYS CYS D . n D 2 8 GLY 8 8 8 GLY GLY D . n D 2 9 SER 9 9 9 SER SER D . n D 2 10 HIS 10 10 10 HIS HIS D . n D 2 11 LEU 11 11 11 LEU LEU D . n D 2 12 VAL 12 12 12 VAL VAL D . n D 2 13 GLU 13 13 13 GLU GLU D . n D 2 14 ALA 14 14 14 ALA ALA D . n D 2 15 LEU 15 15 15 LEU LEU D . n D 2 16 TYR 16 16 16 TYR TYR D . n D 2 17 LEU 17 17 17 LEU LEU D . n D 2 18 VAL 18 18 18 VAL VAL D . n D 2 19 CYS 19 19 19 CYS CYS D . n D 2 20 GLY 20 20 20 GLY GLY D . n D 2 21 GLU 21 21 21 GLU GLU D . n D 2 22 ARG 22 22 22 ARG ARG D . n D 2 23 GLY 23 23 23 GLY GLY D . n D 2 24 PHE 24 24 24 PHE PHE D . n D 2 25 PHE 25 25 25 PHE PHE D . n D 2 26 TYR 26 26 26 TYR TYR D . n D 2 27 THR 27 27 27 THR THR D . n D 2 28 LYS 28 28 28 LYS LYS D . n D 2 29 PRO 29 29 29 PRO PRO D . n D 2 30 THR 30 30 30 THR THR D . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code E 3 ZN 1 31 31 ZN ZN B . F 4 IPH 1 100 100 IPH IPH C . G 3 ZN 1 31 31 ZN ZN D . H 5 CL 1 32 32 CL CL D . I 6 HOH 1 22 5 HOH HOH A . I 6 HOH 2 23 6 HOH HOH A . I 6 HOH 3 24 20 HOH HOH A . I 6 HOH 4 25 29 HOH HOH A . I 6 HOH 5 26 32 HOH HOH A . I 6 HOH 6 27 36 HOH HOH A . I 6 HOH 7 28 41 HOH HOH A . I 6 HOH 8 29 42 HOH HOH A . I 6 HOH 9 30 56 HOH HOH A . I 6 HOH 10 31 57 HOH HOH A . J 6 HOH 1 32 1 HOH HOH B . J 6 HOH 2 33 4 HOH HOH B . J 6 HOH 3 34 7 HOH HOH B . J 6 HOH 4 35 8 HOH HOH B . J 6 HOH 5 36 9 HOH HOH B . J 6 HOH 6 37 10 HOH HOH B . J 6 HOH 7 38 11 HOH HOH B . J 6 HOH 8 39 15 HOH HOH B . J 6 HOH 9 40 17 HOH HOH B . J 6 HOH 10 41 19 HOH HOH B . J 6 HOH 11 42 22 HOH HOH B . J 6 HOH 12 43 23 HOH HOH B . J 6 HOH 13 44 31 HOH HOH B . J 6 HOH 14 45 35 HOH HOH B . J 6 HOH 15 46 38 HOH HOH B . J 6 HOH 16 47 43 HOH HOH B . J 6 HOH 17 48 49 HOH HOH B . J 6 HOH 18 49 54 HOH HOH B . J 6 HOH 19 50 59 HOH HOH B . K 6 HOH 1 101 2 HOH HOH C . K 6 HOH 2 102 14 HOH HOH C . K 6 HOH 3 103 18 HOH HOH C . K 6 HOH 4 104 24 HOH HOH C . K 6 HOH 5 105 25 HOH HOH C . K 6 HOH 6 106 26 HOH HOH C . K 6 HOH 7 107 34 HOH HOH C . K 6 HOH 8 108 39 HOH HOH C . K 6 HOH 9 109 40 HOH HOH C . K 6 HOH 10 110 45 HOH HOH C . K 6 HOH 11 111 46 HOH HOH C . K 6 HOH 12 112 47 HOH HOH C . K 6 HOH 13 113 48 HOH HOH C . K 6 HOH 14 114 51 HOH HOH C . L 6 HOH 1 33 3 HOH HOH D . L 6 HOH 2 34 12 HOH HOH D . L 6 HOH 3 35 13 HOH HOH D . L 6 HOH 4 36 16 HOH HOH D . L 6 HOH 5 37 21 HOH HOH D . L 6 HOH 6 38 27 HOH HOH D . L 6 HOH 7 39 28 HOH HOH D . L 6 HOH 8 40 30 HOH HOH D . L 6 HOH 9 41 33 HOH HOH D . L 6 HOH 10 42 37 HOH HOH D . L 6 HOH 11 43 44 HOH HOH D . L 6 HOH 12 44 50 HOH HOH D . L 6 HOH 13 45 52 HOH HOH D . L 6 HOH 14 46 53 HOH HOH D . L 6 HOH 15 47 55 HOH HOH D . L 6 HOH 16 48 58 HOH HOH D . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A TYR 14 ? CD1 ? A TYR 14 CD1 2 1 Y 1 A TYR 14 ? CD2 ? A TYR 14 CD2 3 1 Y 1 A TYR 14 ? CE1 ? A TYR 14 CE1 4 1 Y 1 A TYR 14 ? CE2 ? A TYR 14 CE2 5 1 Y 1 A TYR 14 ? CZ ? A TYR 14 CZ 6 1 Y 1 A TYR 14 ? OH ? A TYR 14 OH 7 1 Y 1 B THR 30 ? OG1 ? B THR 30 OG1 8 1 Y 1 B THR 30 ? CG2 ? B THR 30 CG2 9 1 Y 1 D GLU 21 ? CD ? D GLU 21 CD 10 1 Y 1 D GLU 21 ? OE1 ? D GLU 21 OE1 11 1 Y 1 D GLU 21 ? OE2 ? D GLU 21 OE2 12 1 Y 1 D THR 27 ? OG1 ? D THR 27 OG1 13 1 Y 1 D THR 27 ? CG2 ? D THR 27 CG2 14 1 Y 1 D THR 30 ? OG1 ? D THR 30 OG1 15 1 Y 1 D THR 30 ? CG2 ? D THR 30 CG2 # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal RIGAKU 'data collection' . ? 1 X-PLOR 'model building' 3.1 ? 2 X-PLOR refinement 3.1 ? 3 PROLSQ refinement . ? 4 RIGAKU 'data reduction' . ? 5 X-PLOR phasing 3.1 ? 6 # _cell.entry_id 1LPH _cell.length_a 79.620 _cell.length_b 79.620 _cell.length_c 37.780 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 18 _cell.pdbx_unique_axis ? # _symmetry.entry_id 1LPH _symmetry.space_group_name_H-M 'H 3' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 146 # _exptl.entry_id 1LPH _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.21 _exptl_crystal.density_percent_sol 33. _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS IIC' _diffrn_detector.pdbx_collection_date 1994-06-09 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source ? _diffrn_source.type ? _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 1LPH _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 38.5 _reflns.d_resolution_high 2.3 _reflns.number_obs 3910 _reflns.number_all ? _reflns.percent_possible_obs 83.4 _reflns.pdbx_Rmerge_I_obs 0.06 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 5. _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _refine.entry_id 1LPH _refine.ls_number_reflns_obs 3548 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2. _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 8.0 _refine.ls_d_res_high 2.3 _refine.ls_percent_reflns_obs 75.7 _refine.ls_R_factor_obs 0.161 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.161 _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean 37.3 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 795 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.number_atoms_solvent 59 _refine_hist.number_atoms_total 864 _refine_hist.d_res_high 2.3 _refine_hist.d_res_low 8.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function x_bond_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? x_mcbond_it 2.156 2.500 ? ? 'X-RAY DIFFRACTION' ? x_mcangle_it 3.387 2.500 ? ? 'X-RAY DIFFRACTION' ? x_scbond_it 1.555 1.500 ? ? 'X-RAY DIFFRACTION' ? x_scangle_it 2.547 2.500 ? ? 'X-RAY DIFFRACTION' ? # _database_PDB_matrix.entry_id 1LPH _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 1LPH _struct.title 'LYS(B28)PRO(B29)-HUMAN INSULIN' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 1LPH _struct_keywords.pdbx_keywords HORMONE _struct_keywords.text 'INSULIN ANALOGUE, HORMONE, GLUCOSE METABOLISM' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 1 ? D N N 2 ? E N N 3 ? F N N 4 ? G N N 3 ? H N N 5 ? I N N 6 ? J N N 6 ? K N N 6 ? L N N 6 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform _struct_ref.pdbx_seq_one_letter_code 1 UNP INS_HUMAN P01308 1 90 ? ? 2 UNP INS_HUMAN P01308 2 25 ? ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 1LPH A 1 ? 21 ? P01308 90 ? 110 ? 1 21 2 2 1LPH B 1 ? 30 ? P01308 25 ? 54 ? 1 30 3 1 1LPH C 1 ? 21 ? P01308 90 ? 110 ? 1 21 4 2 1LPH D 1 ? 30 ? P01308 25 ? 54 ? 1 30 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 2 1LPH LYS B 28 ? UNP P01308 PRO 52 'engineered mutation' 28 1 2 1LPH PRO B 29 ? UNP P01308 LYS 53 'engineered mutation' 29 2 4 1LPH LYS D 28 ? UNP P01308 PRO 52 'engineered mutation' 28 3 4 1LPH PRO D 29 ? UNP P01308 LYS 53 'engineered mutation' 29 4 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA dimeric 2 2 author_and_software_defined_assembly PISA dimeric 2 3 software_defined_assembly PISA dodecameric 12 4 software_defined_assembly PISA dodecameric 12 5 software_defined_assembly PISA dodecameric 12 6 software_defined_assembly PISA tetrameric 4 7 software_defined_assembly PISA tetrameric 4 8 software_defined_assembly PISA hexameric 6 9 software_defined_assembly PISA hexameric 6 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1600 ? 1 MORE -13 ? 1 'SSA (A^2)' 3710 ? 2 'ABSA (A^2)' 1110 ? 2 MORE -12 ? 2 'SSA (A^2)' 4060 ? 3 'ABSA (A^2)' 18830 ? 3 MORE -269 ? 3 'SSA (A^2)' 12910 ? 4 'ABSA (A^2)' 12550 ? 4 MORE -250 ? 4 'SSA (A^2)' 19190 ? 5 'ABSA (A^2)' 9310 ? 5 MORE -214 ? 5 'SSA (A^2)' 22430 ? 6 'ABSA (A^2)' 3870 ? 6 MORE -30 ? 6 'SSA (A^2)' 6600 ? 7 'ABSA (A^2)' 4150 ? 7 MORE -32 ? 7 'SSA (A^2)' 6320 ? 8 'ABSA (A^2)' 5530 ? 8 MORE -147 ? 8 'SSA (A^2)' 10180 ? 9 'ABSA (A^2)' 5480 ? 9 MORE -90 ? 9 'SSA (A^2)' 10550 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,E,I,J 2 1 C,D,F,G,H,K,L 3 1,2,3 A,B,C,D,E,F,G,H,I,J,K,L 4 1,2,3 A,B,E,I,J 4 4,5,6 C,D,F,G,H,K,L 5 4,5,6 D,G,H,L 5 1,2,3 A,B,C,E,F,I,J,K 6 1 C,D,F,G,H,K,L 6 2 A,B,E,I,J 7 1 A,B,C,D,E,F,G,H,I,J,K,L 8 1,2,3 C,D,F,G,H,K,L 9 1,2,3 A,B,E,I,J # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -y,x-y,z -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -x+y,-x,z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 1_554 x,y,z-1 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 -37.7800000000 5 'crystal symmetry operation' 2_554 -y,x-y,z-1 -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 -37.7800000000 6 'crystal symmetry operation' 3_554 -x+y,-x,z-1 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 -37.7800000000 # loop_ _struct_biol.id 1 2 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ILE A 2 ? CYS A 6 ? ILE A 2 CYS A 6 1 ? 5 HELX_P HELX_P2 2 LEU A 13 ? TYR A 19 ? LEU A 13 TYR A 19 1 ? 7 HELX_P HELX_P3 3 GLY B 8 ? ARG B 22 ? GLY B 8 ARG B 22 1 ? 15 HELX_P HELX_P4 4 ILE C 2 ? CYS C 6 ? ILE C 2 CYS C 6 1 ? 5 HELX_P HELX_P5 5 LEU C 13 ? ASN C 18 ? LEU C 13 ASN C 18 1 ? 6 HELX_P HELX_P6 6 GLN D 4 ? VAL D 18 ? GLN D 4 VAL D 18 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 11 SG ? ? A CYS 6 A CYS 11 1_555 ? ? ? ? ? ? ? 2.010 ? ? disulf2 disulf ? ? A CYS 7 SG ? ? ? 1_555 B CYS 7 SG ? ? A CYS 7 B CYS 7 1_555 ? ? ? ? ? ? ? 2.007 ? ? disulf3 disulf ? ? A CYS 20 SG ? ? ? 1_555 B CYS 19 SG ? ? A CYS 20 B CYS 19 1_555 ? ? ? ? ? ? ? 2.000 ? ? disulf4 disulf ? ? C CYS 6 SG ? ? ? 1_555 C CYS 11 SG ? ? C CYS 6 C CYS 11 1_555 ? ? ? ? ? ? ? 2.046 ? ? disulf5 disulf ? ? C CYS 7 SG ? ? ? 1_555 D CYS 7 SG ? ? C CYS 7 D CYS 7 1_555 ? ? ? ? ? ? ? 2.036 ? ? disulf6 disulf ? ? C CYS 20 SG ? ? ? 1_555 D CYS 19 SG ? ? C CYS 20 D CYS 19 1_555 ? ? ? ? ? ? ? 1.978 ? ? metalc1 metalc ? ? B HIS 10 NE2 ? ? ? 1_555 E ZN . ZN ? ? B HIS 10 B ZN 31 1_555 ? ? ? ? ? ? ? 2.157 ? ? metalc2 metalc ? ? B HIS 10 NE2 ? ? ? 2_555 E ZN . ZN ? ? B HIS 10 B ZN 31 1_555 ? ? ? ? ? ? ? 2.157 ? ? metalc3 metalc ? ? B HIS 10 NE2 ? ? ? 3_555 E ZN . ZN ? ? B HIS 10 B ZN 31 1_555 ? ? ? ? ? ? ? 2.157 ? ? metalc4 metalc ? ? D HIS 10 NE2 ? ? ? 1_555 G ZN . ZN ? ? D HIS 10 D ZN 31 1_555 ? ? ? ? ? ? ? 2.046 ? ? metalc5 metalc ? ? D HIS 10 NE2 ? ? ? 2_555 G ZN . ZN ? ? D HIS 10 D ZN 31 1_555 ? ? ? ? ? ? ? 2.046 ? ? metalc6 metalc ? ? D HIS 10 NE2 ? ? ? 3_555 G ZN . ZN ? ? D HIS 10 D ZN 31 1_555 ? ? ? ? ? ? ? 2.046 ? ? metalc7 metalc ? ? G ZN . ZN ? ? ? 1_555 H CL . CL ? ? D ZN 31 D CL 32 1_555 ? ? ? ? ? ? ? 2.308 ? ? metalc8 metalc ? ? G ZN . ZN ? ? ? 1_555 H CL . CL ? ? D ZN 31 D CL 32 2_555 ? ? ? ? ? ? ? 2.308 ? ? metalc9 metalc ? ? G ZN . ZN ? ? ? 1_555 H CL . CL ? ? D ZN 31 D CL 32 3_555 ? ? ? ? ? ? ? 2.308 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? B HIS 10 ? B HIS 10 ? 1_555 ZN ? E ZN . ? B ZN 31 ? 1_555 NE2 ? B HIS 10 ? B HIS 10 ? 2_555 95.9 ? 2 NE2 ? B HIS 10 ? B HIS 10 ? 1_555 ZN ? E ZN . ? B ZN 31 ? 1_555 NE2 ? B HIS 10 ? B HIS 10 ? 3_555 95.9 ? 3 NE2 ? B HIS 10 ? B HIS 10 ? 2_555 ZN ? E ZN . ? B ZN 31 ? 1_555 NE2 ? B HIS 10 ? B HIS 10 ? 3_555 95.9 ? 4 NE2 ? D HIS 10 ? D HIS 10 ? 1_555 ZN ? G ZN . ? D ZN 31 ? 1_555 NE2 ? D HIS 10 ? D HIS 10 ? 2_555 107.8 ? 5 NE2 ? D HIS 10 ? D HIS 10 ? 1_555 ZN ? G ZN . ? D ZN 31 ? 1_555 NE2 ? D HIS 10 ? D HIS 10 ? 3_555 107.8 ? 6 NE2 ? D HIS 10 ? D HIS 10 ? 2_555 ZN ? G ZN . ? D ZN 31 ? 1_555 NE2 ? D HIS 10 ? D HIS 10 ? 3_555 107.8 ? 7 NE2 ? D HIS 10 ? D HIS 10 ? 1_555 ZN ? G ZN . ? D ZN 31 ? 1_555 CL ? H CL . ? D CL 32 ? 1_555 111.1 ? 8 NE2 ? D HIS 10 ? D HIS 10 ? 2_555 ZN ? G ZN . ? D ZN 31 ? 1_555 CL ? H CL . ? D CL 32 ? 1_555 111.1 ? 9 NE2 ? D HIS 10 ? D HIS 10 ? 3_555 ZN ? G ZN . ? D ZN 31 ? 1_555 CL ? H CL . ? D CL 32 ? 1_555 111.1 ? 10 NE2 ? D HIS 10 ? D HIS 10 ? 1_555 ZN ? G ZN . ? D ZN 31 ? 1_555 CL ? H CL . ? D CL 32 ? 2_555 111.1 ? 11 NE2 ? D HIS 10 ? D HIS 10 ? 2_555 ZN ? G ZN . ? D ZN 31 ? 1_555 CL ? H CL . ? D CL 32 ? 2_555 111.1 ? 12 NE2 ? D HIS 10 ? D HIS 10 ? 3_555 ZN ? G ZN . ? D ZN 31 ? 1_555 CL ? H CL . ? D CL 32 ? 2_555 111.1 ? 13 CL ? H CL . ? D CL 32 ? 1_555 ZN ? G ZN . ? D ZN 31 ? 1_555 CL ? H CL . ? D CL 32 ? 2_555 0.0 ? 14 NE2 ? D HIS 10 ? D HIS 10 ? 1_555 ZN ? G ZN . ? D ZN 31 ? 1_555 CL ? H CL . ? D CL 32 ? 3_555 111.1 ? 15 NE2 ? D HIS 10 ? D HIS 10 ? 2_555 ZN ? G ZN . ? D ZN 31 ? 1_555 CL ? H CL . ? D CL 32 ? 3_555 111.1 ? 16 NE2 ? D HIS 10 ? D HIS 10 ? 3_555 ZN ? G ZN . ? D ZN 31 ? 1_555 CL ? H CL . ? D CL 32 ? 3_555 111.1 ? 17 CL ? H CL . ? D CL 32 ? 1_555 ZN ? G ZN . ? D ZN 31 ? 1_555 CL ? H CL . ? D CL 32 ? 3_555 0.0 ? 18 CL ? H CL . ? D CL 32 ? 2_555 ZN ? G ZN . ? D ZN 31 ? 1_555 CL ? H CL . ? D CL 32 ? 3_555 0.0 ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 6 ? CYS A 11 ? CYS A 6 ? 1_555 CYS A 11 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 7 ? CYS B 7 ? CYS A 7 ? 1_555 CYS B 7 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 20 ? CYS B 19 ? CYS A 20 ? 1_555 CYS B 19 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS C 6 ? CYS C 11 ? CYS C 6 ? 1_555 CYS C 11 ? 1_555 SG SG . . . None 'Disulfide bridge' 5 CYS C 7 ? CYS D 7 ? CYS C 7 ? 1_555 CYS D 7 ? 1_555 SG SG . . . None 'Disulfide bridge' 6 CYS C 20 ? CYS D 19 ? CYS C 20 ? 1_555 CYS D 19 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE B 24 ? TYR B 26 ? PHE B 24 TYR B 26 A 2 PHE D 24 ? TYR D 26 ? PHE D 24 TYR D 26 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id O _pdbx_struct_sheet_hbond.range_1_label_comp_id PHE _pdbx_struct_sheet_hbond.range_1_label_asym_id B _pdbx_struct_sheet_hbond.range_1_label_seq_id 24 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id O _pdbx_struct_sheet_hbond.range_1_auth_comp_id PHE _pdbx_struct_sheet_hbond.range_1_auth_asym_id B _pdbx_struct_sheet_hbond.range_1_auth_seq_id 24 _pdbx_struct_sheet_hbond.range_2_label_atom_id N _pdbx_struct_sheet_hbond.range_2_label_comp_id TYR _pdbx_struct_sheet_hbond.range_2_label_asym_id D _pdbx_struct_sheet_hbond.range_2_label_seq_id 26 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id N _pdbx_struct_sheet_hbond.range_2_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_2_auth_asym_id D _pdbx_struct_sheet_hbond.range_2_auth_seq_id 26 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details 1 Unknown ? ? ? ? 13 PHENOL. AC1 Software B ZN 31 ? 3 'BINDING SITE FOR RESIDUE ZN B 31' AC2 Software D ZN 31 ? 6 'BINDING SITE FOR RESIDUE ZN D 31' AC3 Software D CL 32 ? 6 'BINDING SITE FOR RESIDUE CL D 32' AC4 Software C IPH 100 ? 5 'BINDING SITE FOR RESIDUE IPH C 100' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 1 13 LEU B 17 ? LEU B 17 . ? 1_555 ? 2 1 13 GLN C 5 ? GLN C 5 . ? 1_555 ? 3 1 13 CYS C 7 ? CYS C 7 . ? 1_555 ? 4 1 13 SER C 9 ? SER C 9 . ? 1_555 ? 5 1 13 CYS C 11 ? CYS C 11 . ? 1_555 ? 6 1 13 SER C 12 ? SER C 12 . ? 1_555 ? 7 1 13 LEU C 16 ? LEU C 16 . ? 1_555 ? 8 1 13 HIS D 5 ? HIS D 5 . ? 1_555 ? 9 1 13 LEU D 6 ? LEU D 6 . ? 1_555 ? 10 1 13 CYS D 7 ? CYS D 7 . ? 1_555 ? 11 1 13 HIS D 10 ? HIS D 10 . ? 1_555 ? 12 1 13 LEU D 11 ? LEU D 11 . ? 1_555 ? 13 1 13 ALA D 14 ? ALA D 14 . ? 1_555 ? 14 AC1 3 HIS B 10 ? HIS B 10 . ? 2_555 ? 15 AC1 3 HIS B 10 ? HIS B 10 . ? 1_555 ? 16 AC1 3 HIS B 10 ? HIS B 10 . ? 3_555 ? 17 AC2 6 HIS D 10 ? HIS D 10 . ? 1_555 ? 18 AC2 6 HIS D 10 ? HIS D 10 . ? 2_555 ? 19 AC2 6 HIS D 10 ? HIS D 10 . ? 3_555 ? 20 AC2 6 CL H . ? CL D 32 . ? 2_555 ? 21 AC2 6 CL H . ? CL D 32 . ? 3_555 ? 22 AC2 6 CL H . ? CL D 32 . ? 1_555 ? 23 AC3 6 HIS D 10 ? HIS D 10 . ? 1_555 ? 24 AC3 6 HIS D 10 ? HIS D 10 . ? 2_555 ? 25 AC3 6 HIS D 10 ? HIS D 10 . ? 3_555 ? 26 AC3 6 ZN G . ? ZN D 31 . ? 2_555 ? 27 AC3 6 ZN G . ? ZN D 31 . ? 3_555 ? 28 AC3 6 ZN G . ? ZN D 31 . ? 1_555 ? 29 AC4 5 CYS C 6 ? CYS C 6 . ? 1_555 ? 30 AC4 5 ILE C 10 ? ILE C 10 . ? 1_555 ? 31 AC4 5 CYS C 11 ? CYS C 11 . ? 1_555 ? 32 AC4 5 HIS D 5 ? HIS D 5 . ? 2_555 ? 33 AC4 5 HIS D 10 ? HIS D 10 . ? 1_555 ? # _pdbx_entry_details.entry_id 1LPH _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ;EACH OF TWO ZINC IONS IS COORDINATED BY THE THREE SYMMETRY RELATED HIS B 10 SIDE CHAINS. THE COORDINATION SPHERE OF ZN B 31 IS OCTAHEDRAL WITH THE REMAINING THREE SITES FILLED BY WATER, HOH 1. THE COORDINATION OF ZN D 31 IS TETRAHEDRAL COMPLETED BY CL D 32. ; _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE1 C GLU 17 ? ? O C HOH 104 ? ? 1.81 2 1 NE2 B GLN 4 ? ? O B HOH 48 ? ? 2.05 3 1 O B VAL 2 ? ? O B HOH 41 ? ? 2.14 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA A GLN 5 ? ? CB A GLN 5 ? ? CG A GLN 5 ? ? 126.84 113.40 13.44 2.20 N 2 1 CB A GLN 5 ? ? CG A GLN 5 ? ? CD A GLN 5 ? ? 129.42 111.60 17.82 2.60 N 3 1 CA A CYS 6 ? ? CB A CYS 6 ? ? SG A CYS 6 ? ? 123.71 114.20 9.51 1.10 N 4 1 N A CYS 7 ? ? CA A CYS 7 ? ? CB A CYS 7 ? ? 120.82 110.80 10.02 1.50 N 5 1 OE1 A GLU 17 ? ? CD A GLU 17 ? ? OE2 A GLU 17 ? ? 115.53 123.30 -7.77 1.20 N 6 1 CA A ASN 21 ? ? CB A ASN 21 ? ? CG A ASN 21 ? ? 133.33 113.40 19.93 2.20 N 7 1 N B ASN 3 ? ? CA B ASN 3 ? ? C B ASN 3 ? ? 93.70 111.00 -17.30 2.70 N 8 1 CA B GLN 4 ? ? CB B GLN 4 ? ? CG B GLN 4 ? ? 128.63 113.40 15.23 2.20 N 9 1 CA B SER 9 ? ? CB B SER 9 ? ? OG B SER 9 ? ? 127.41 111.20 16.21 2.70 N 10 1 CB B TYR 16 ? ? CG B TYR 16 ? ? CD2 B TYR 16 ? ? 127.44 121.00 6.44 0.60 N 11 1 CG B TYR 16 ? ? CD2 B TYR 16 ? ? CE2 B TYR 16 ? ? 126.15 121.30 4.85 0.80 N 12 1 CB B GLU 21 ? ? CG B GLU 21 ? ? CD B GLU 21 ? ? 134.08 114.20 19.88 2.70 N 13 1 CG B GLU 21 ? ? CD B GLU 21 ? ? OE1 B GLU 21 ? ? 131.35 118.30 13.05 2.00 N 14 1 NE B ARG 22 ? ? CZ B ARG 22 ? ? NH1 B ARG 22 ? ? 124.14 120.30 3.84 0.50 N 15 1 CB B PHE 24 ? ? CG B PHE 24 ? ? CD2 B PHE 24 ? ? 116.59 120.80 -4.21 0.70 N 16 1 CB B TYR 26 ? ? CG B TYR 26 ? ? CD1 B TYR 26 ? ? 116.09 121.00 -4.91 0.60 N 17 1 CB C LEU 13 ? ? CA C LEU 13 ? ? C C LEU 13 ? ? 122.76 110.20 12.56 1.90 N 18 1 CA C ASN 18 ? ? CB C ASN 18 ? ? CG C ASN 18 ? ? 128.76 113.40 15.36 2.20 N 19 1 CB D LEU 11 ? ? CA D LEU 11 ? ? C D LEU 11 ? ? 122.89 110.20 12.69 1.90 N 20 1 CG D GLU 13 ? ? CD D GLU 13 ? ? OE2 D GLU 13 ? ? 105.87 118.30 -12.43 2.00 N 21 1 CB D TYR 16 ? ? CG D TYR 16 ? ? CD2 D TYR 16 ? ? 127.85 121.00 6.85 0.60 N 22 1 CB D TYR 16 ? ? CG D TYR 16 ? ? CD1 D TYR 16 ? ? 114.15 121.00 -6.85 0.60 N 23 1 CB D CYS 19 ? ? CA D CYS 19 ? ? C D CYS 19 ? ? 120.12 111.50 8.62 1.20 N 24 1 CD D ARG 22 ? ? NE D ARG 22 ? ? CZ D ARG 22 ? ? 136.32 123.60 12.72 1.40 N 25 1 NE D ARG 22 ? ? CZ D ARG 22 ? ? NH1 D ARG 22 ? ? 126.30 120.30 6.00 0.50 N 26 1 NE D ARG 22 ? ? CZ D ARG 22 ? ? NH2 D ARG 22 ? ? 116.27 120.30 -4.03 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 9 ? ? -105.25 -132.96 2 1 GLU B 21 ? ? -28.31 -36.44 3 1 CYS D 19 ? ? -70.99 -99.83 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id B _pdbx_validate_planes.auth_seq_id 22 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.082 _pdbx_validate_planes.type 'SIDE CHAIN' # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 B ZN 31 ? E ZN . 2 1 D ZN 31 ? G ZN . 3 1 D CL 32 ? H CL . 4 1 B HOH 39 ? J HOH . 5 1 D HOH 42 ? L HOH . # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 CL CL CL N N 58 CYS N N N N 59 CYS CA C N R 60 CYS C C N N 61 CYS O O N N 62 CYS CB C N N 63 CYS SG S N N 64 CYS OXT O N N 65 CYS H H N N 66 CYS H2 H N N 67 CYS HA H N N 68 CYS HB2 H N N 69 CYS HB3 H N N 70 CYS HG H N N 71 CYS HXT H N N 72 GLN N N N N 73 GLN CA C N S 74 GLN C C N N 75 GLN O O N N 76 GLN CB C N N 77 GLN CG C N N 78 GLN CD C N N 79 GLN OE1 O N N 80 GLN NE2 N N N 81 GLN OXT O N N 82 GLN H H N N 83 GLN H2 H N N 84 GLN HA H N N 85 GLN HB2 H N N 86 GLN HB3 H N N 87 GLN HG2 H N N 88 GLN HG3 H N N 89 GLN HE21 H N N 90 GLN HE22 H N N 91 GLN HXT H N N 92 GLU N N N N 93 GLU CA C N S 94 GLU C C N N 95 GLU O O N N 96 GLU CB C N N 97 GLU CG C N N 98 GLU CD C N N 99 GLU OE1 O N N 100 GLU OE2 O N N 101 GLU OXT O N N 102 GLU H H N N 103 GLU H2 H N N 104 GLU HA H N N 105 GLU HB2 H N N 106 GLU HB3 H N N 107 GLU HG2 H N N 108 GLU HG3 H N N 109 GLU HE2 H N N 110 GLU HXT H N N 111 GLY N N N N 112 GLY CA C N N 113 GLY C C N N 114 GLY O O N N 115 GLY OXT O N N 116 GLY H H N N 117 GLY H2 H N N 118 GLY HA2 H N N 119 GLY HA3 H N N 120 GLY HXT H N N 121 HIS N N N N 122 HIS CA C N S 123 HIS C C N N 124 HIS O O N N 125 HIS CB C N N 126 HIS CG C Y N 127 HIS ND1 N Y N 128 HIS CD2 C Y N 129 HIS CE1 C Y N 130 HIS NE2 N Y N 131 HIS OXT O N N 132 HIS H H N N 133 HIS H2 H N N 134 HIS HA H N N 135 HIS HB2 H N N 136 HIS HB3 H N N 137 HIS HD1 H N N 138 HIS HD2 H N N 139 HIS HE1 H N N 140 HIS HE2 H N N 141 HIS HXT H N N 142 HOH O O N N 143 HOH H1 H N N 144 HOH H2 H N N 145 ILE N N N N 146 ILE CA C N S 147 ILE C C N N 148 ILE O O N N 149 ILE CB C N S 150 ILE CG1 C N N 151 ILE CG2 C N N 152 ILE CD1 C N N 153 ILE OXT O N N 154 ILE H H N N 155 ILE H2 H N N 156 ILE HA H N N 157 ILE HB H N N 158 ILE HG12 H N N 159 ILE HG13 H N N 160 ILE HG21 H N N 161 ILE HG22 H N N 162 ILE HG23 H N N 163 ILE HD11 H N N 164 ILE HD12 H N N 165 ILE HD13 H N N 166 ILE HXT H N N 167 IPH C1 C Y N 168 IPH C2 C Y N 169 IPH C3 C Y N 170 IPH C4 C Y N 171 IPH C5 C Y N 172 IPH C6 C Y N 173 IPH O1 O N N 174 IPH H2 H N N 175 IPH H3 H N N 176 IPH H4 H N N 177 IPH H5 H N N 178 IPH H6 H N N 179 IPH HO1 H N N 180 LEU N N N N 181 LEU CA C N S 182 LEU C C N N 183 LEU O O N N 184 LEU CB C N N 185 LEU CG C N N 186 LEU CD1 C N N 187 LEU CD2 C N N 188 LEU OXT O N N 189 LEU H H N N 190 LEU H2 H N N 191 LEU HA H N N 192 LEU HB2 H N N 193 LEU HB3 H N N 194 LEU HG H N N 195 LEU HD11 H N N 196 LEU HD12 H N N 197 LEU HD13 H N N 198 LEU HD21 H N N 199 LEU HD22 H N N 200 LEU HD23 H N N 201 LEU HXT H N N 202 LYS N N N N 203 LYS CA C N S 204 LYS C C N N 205 LYS O O N N 206 LYS CB C N N 207 LYS CG C N N 208 LYS CD C N N 209 LYS CE C N N 210 LYS NZ N N N 211 LYS OXT O N N 212 LYS H H N N 213 LYS H2 H N N 214 LYS HA H N N 215 LYS HB2 H N N 216 LYS HB3 H N N 217 LYS HG2 H N N 218 LYS HG3 H N N 219 LYS HD2 H N N 220 LYS HD3 H N N 221 LYS HE2 H N N 222 LYS HE3 H N N 223 LYS HZ1 H N N 224 LYS HZ2 H N N 225 LYS HZ3 H N N 226 LYS HXT H N N 227 PHE N N N N 228 PHE CA C N S 229 PHE C C N N 230 PHE O O N N 231 PHE CB C N N 232 PHE CG C Y N 233 PHE CD1 C Y N 234 PHE CD2 C Y N 235 PHE CE1 C Y N 236 PHE CE2 C Y N 237 PHE CZ C Y N 238 PHE OXT O N N 239 PHE H H N N 240 PHE H2 H N N 241 PHE HA H N N 242 PHE HB2 H N N 243 PHE HB3 H N N 244 PHE HD1 H N N 245 PHE HD2 H N N 246 PHE HE1 H N N 247 PHE HE2 H N N 248 PHE HZ H N N 249 PHE HXT H N N 250 PRO N N N N 251 PRO CA C N S 252 PRO C C N N 253 PRO O O N N 254 PRO CB C N N 255 PRO CG C N N 256 PRO CD C N N 257 PRO OXT O N N 258 PRO H H N N 259 PRO HA H N N 260 PRO HB2 H N N 261 PRO HB3 H N N 262 PRO HG2 H N N 263 PRO HG3 H N N 264 PRO HD2 H N N 265 PRO HD3 H N N 266 PRO HXT H N N 267 SER N N N N 268 SER CA C N S 269 SER C C N N 270 SER O O N N 271 SER CB C N N 272 SER OG O N N 273 SER OXT O N N 274 SER H H N N 275 SER H2 H N N 276 SER HA H N N 277 SER HB2 H N N 278 SER HB3 H N N 279 SER HG H N N 280 SER HXT H N N 281 THR N N N N 282 THR CA C N S 283 THR C C N N 284 THR O O N N 285 THR CB C N R 286 THR OG1 O N N 287 THR CG2 C N N 288 THR OXT O N N 289 THR H H N N 290 THR H2 H N N 291 THR HA H N N 292 THR HB H N N 293 THR HG1 H N N 294 THR HG21 H N N 295 THR HG22 H N N 296 THR HG23 H N N 297 THR HXT H N N 298 TYR N N N N 299 TYR CA C N S 300 TYR C C N N 301 TYR O O N N 302 TYR CB C N N 303 TYR CG C Y N 304 TYR CD1 C Y N 305 TYR CD2 C Y N 306 TYR CE1 C Y N 307 TYR CE2 C Y N 308 TYR CZ C Y N 309 TYR OH O N N 310 TYR OXT O N N 311 TYR H H N N 312 TYR H2 H N N 313 TYR HA H N N 314 TYR HB2 H N N 315 TYR HB3 H N N 316 TYR HD1 H N N 317 TYR HD2 H N N 318 TYR HE1 H N N 319 TYR HE2 H N N 320 TYR HH H N N 321 TYR HXT H N N 322 VAL N N N N 323 VAL CA C N S 324 VAL C C N N 325 VAL O O N N 326 VAL CB C N N 327 VAL CG1 C N N 328 VAL CG2 C N N 329 VAL OXT O N N 330 VAL H H N N 331 VAL H2 H N N 332 VAL HA H N N 333 VAL HB H N N 334 VAL HG11 H N N 335 VAL HG12 H N N 336 VAL HG13 H N N 337 VAL HG21 H N N 338 VAL HG22 H N N 339 VAL HG23 H N N 340 VAL HXT H N N 341 ZN ZN ZN N N 342 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 CYS N CA sing N N 55 CYS N H sing N N 56 CYS N H2 sing N N 57 CYS CA C sing N N 58 CYS CA CB sing N N 59 CYS CA HA sing N N 60 CYS C O doub N N 61 CYS C OXT sing N N 62 CYS CB SG sing N N 63 CYS CB HB2 sing N N 64 CYS CB HB3 sing N N 65 CYS SG HG sing N N 66 CYS OXT HXT sing N N 67 GLN N CA sing N N 68 GLN N H sing N N 69 GLN N H2 sing N N 70 GLN CA C sing N N 71 GLN CA CB sing N N 72 GLN CA HA sing N N 73 GLN C O doub N N 74 GLN C OXT sing N N 75 GLN CB CG sing N N 76 GLN CB HB2 sing N N 77 GLN CB HB3 sing N N 78 GLN CG CD sing N N 79 GLN CG HG2 sing N N 80 GLN CG HG3 sing N N 81 GLN CD OE1 doub N N 82 GLN CD NE2 sing N N 83 GLN NE2 HE21 sing N N 84 GLN NE2 HE22 sing N N 85 GLN OXT HXT sing N N 86 GLU N CA sing N N 87 GLU N H sing N N 88 GLU N H2 sing N N 89 GLU CA C sing N N 90 GLU CA CB sing N N 91 GLU CA HA sing N N 92 GLU C O doub N N 93 GLU C OXT sing N N 94 GLU CB CG sing N N 95 GLU CB HB2 sing N N 96 GLU CB HB3 sing N N 97 GLU CG CD sing N N 98 GLU CG HG2 sing N N 99 GLU CG HG3 sing N N 100 GLU CD OE1 doub N N 101 GLU CD OE2 sing N N 102 GLU OE2 HE2 sing N N 103 GLU OXT HXT sing N N 104 GLY N CA sing N N 105 GLY N H sing N N 106 GLY N H2 sing N N 107 GLY CA C sing N N 108 GLY CA HA2 sing N N 109 GLY CA HA3 sing N N 110 GLY C O doub N N 111 GLY C OXT sing N N 112 GLY OXT HXT sing N N 113 HIS N CA sing N N 114 HIS N H sing N N 115 HIS N H2 sing N N 116 HIS CA C sing N N 117 HIS CA CB sing N N 118 HIS CA HA sing N N 119 HIS C O doub N N 120 HIS C OXT sing N N 121 HIS CB CG sing N N 122 HIS CB HB2 sing N N 123 HIS CB HB3 sing N N 124 HIS CG ND1 sing Y N 125 HIS CG CD2 doub Y N 126 HIS ND1 CE1 doub Y N 127 HIS ND1 HD1 sing N N 128 HIS CD2 NE2 sing Y N 129 HIS CD2 HD2 sing N N 130 HIS CE1 NE2 sing Y N 131 HIS CE1 HE1 sing N N 132 HIS NE2 HE2 sing N N 133 HIS OXT HXT sing N N 134 HOH O H1 sing N N 135 HOH O H2 sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 IPH C1 C2 doub Y N 158 IPH C1 C6 sing Y N 159 IPH C1 O1 sing N N 160 IPH C2 C3 sing Y N 161 IPH C2 H2 sing N N 162 IPH C3 C4 doub Y N 163 IPH C3 H3 sing N N 164 IPH C4 C5 sing Y N 165 IPH C4 H4 sing N N 166 IPH C5 C6 doub Y N 167 IPH C5 H5 sing N N 168 IPH C6 H6 sing N N 169 IPH O1 HO1 sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 PHE N CA sing N N 216 PHE N H sing N N 217 PHE N H2 sing N N 218 PHE CA C sing N N 219 PHE CA CB sing N N 220 PHE CA HA sing N N 221 PHE C O doub N N 222 PHE C OXT sing N N 223 PHE CB CG sing N N 224 PHE CB HB2 sing N N 225 PHE CB HB3 sing N N 226 PHE CG CD1 doub Y N 227 PHE CG CD2 sing Y N 228 PHE CD1 CE1 sing Y N 229 PHE CD1 HD1 sing N N 230 PHE CD2 CE2 doub Y N 231 PHE CD2 HD2 sing N N 232 PHE CE1 CZ doub Y N 233 PHE CE1 HE1 sing N N 234 PHE CE2 CZ sing Y N 235 PHE CE2 HE2 sing N N 236 PHE CZ HZ sing N N 237 PHE OXT HXT sing N N 238 PRO N CA sing N N 239 PRO N CD sing N N 240 PRO N H sing N N 241 PRO CA C sing N N 242 PRO CA CB sing N N 243 PRO CA HA sing N N 244 PRO C O doub N N 245 PRO C OXT sing N N 246 PRO CB CG sing N N 247 PRO CB HB2 sing N N 248 PRO CB HB3 sing N N 249 PRO CG CD sing N N 250 PRO CG HG2 sing N N 251 PRO CG HG3 sing N N 252 PRO CD HD2 sing N N 253 PRO CD HD3 sing N N 254 PRO OXT HXT sing N N 255 SER N CA sing N N 256 SER N H sing N N 257 SER N H2 sing N N 258 SER CA C sing N N 259 SER CA CB sing N N 260 SER CA HA sing N N 261 SER C O doub N N 262 SER C OXT sing N N 263 SER CB OG sing N N 264 SER CB HB2 sing N N 265 SER CB HB3 sing N N 266 SER OG HG sing N N 267 SER OXT HXT sing N N 268 THR N CA sing N N 269 THR N H sing N N 270 THR N H2 sing N N 271 THR CA C sing N N 272 THR CA CB sing N N 273 THR CA HA sing N N 274 THR C O doub N N 275 THR C OXT sing N N 276 THR CB OG1 sing N N 277 THR CB CG2 sing N N 278 THR CB HB sing N N 279 THR OG1 HG1 sing N N 280 THR CG2 HG21 sing N N 281 THR CG2 HG22 sing N N 282 THR CG2 HG23 sing N N 283 THR OXT HXT sing N N 284 TYR N CA sing N N 285 TYR N H sing N N 286 TYR N H2 sing N N 287 TYR CA C sing N N 288 TYR CA CB sing N N 289 TYR CA HA sing N N 290 TYR C O doub N N 291 TYR C OXT sing N N 292 TYR CB CG sing N N 293 TYR CB HB2 sing N N 294 TYR CB HB3 sing N N 295 TYR CG CD1 doub Y N 296 TYR CG CD2 sing Y N 297 TYR CD1 CE1 sing Y N 298 TYR CD1 HD1 sing N N 299 TYR CD2 CE2 doub Y N 300 TYR CD2 HD2 sing N N 301 TYR CE1 CZ doub Y N 302 TYR CE1 HE1 sing N N 303 TYR CE2 CZ sing Y N 304 TYR CE2 HE2 sing N N 305 TYR CZ OH sing N N 306 TYR OH HH sing N N 307 TYR OXT HXT sing N N 308 VAL N CA sing N N 309 VAL N H sing N N 310 VAL N H2 sing N N 311 VAL CA C sing N N 312 VAL CA CB sing N N 313 VAL CA HA sing N N 314 VAL C O doub N N 315 VAL C OXT sing N N 316 VAL CB CG1 sing N N 317 VAL CB CG2 sing N N 318 VAL CB HB sing N N 319 VAL CG1 HG11 sing N N 320 VAL CG1 HG12 sing N N 321 VAL CG1 HG13 sing N N 322 VAL CG2 HG21 sing N N 323 VAL CG2 HG22 sing N N 324 VAL CG2 HG23 sing N N 325 VAL OXT HXT sing N N 326 # _atom_sites.entry_id 1LPH _atom_sites.fract_transf_matrix[1][1] 0.012560 _atom_sites.fract_transf_matrix[1][2] 0.007251 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014503 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.026469 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL N O S ZN # loop_