SUPER POWER GAYATRI-THE ICON DEITY OF

DEMIGODS, AVATARAS AND RISHIS

ORIGINALLY WRITTEN IN HINDI

BY

LATE YUGA RISHI PANDIT SHRIRAM SHARMA ACHARYA

(FOUNDER OF THE ALL WORLD GAYATRI FAMILY, WEBSITE:
WWW.AWGP.ORG )

PUBLISHED ON THE INTERNET BY

MR ASHOK N. RAWAL

TRANSLATED INTO ENGLISH BY

MS/ HEENA A. KAPADIA (M.Sc., M Phil)

CONTENTS

INTRODUCTION
CHAPTER 1
MOTHER OF VEDAS-MOTHER OF DEITIES IS
GODDESS GAYATRI

CHAPTER 2
THE 3 LEGS OF GAYATRI BASED SPIRITUAL
PRACTICES

CHAPTER 3
GAYATRI SUPER POWER IS THE SUPREME ICON
DEITY OF THE 3 DEMIGODS

INTRODUCTION

In the science of worship and meditation with reference to science of

spirituality and religion Super Power Gayatri reigns supreme. There are
many reasons for this. One of the reasons is that in this Super Mantra in seed
form resides principles of human culture and sacred ideals. It can be called
the smallest text of 24 letters in the entire world. In it in a gist dwells wisdom
of religion and spirituality. While describing these 24 letters what is most
required for human progress and good management that itself is the Mantra
of divine intelligence and farsightedness. All problems in human life appear
because of a vile brain. Daily in this world clouds of danger that manifest are
but a creation of salty ocean of vile thinking. Viveka or farsighted thinking
reigns supreme. In this world there is nothing more important than a sacred
brain. This fact makes the Goddess of divine intellect called Super Power
Gayatri supreme.

Gayatri is a sacred intellect. In this Super Mantra a prayer is made to

Almighty God for a sacred intellect. In its 24 letters 24 priceless messages
reside and they are symbols of a sacred intellect. In this teaching such
foundations dwell that by imbibing them one's viewpoint gets positively
transformed. Further that spiritual ignorance manifesting due to illusion gets
destroyed which is the root cause of strife and problems appearing in our life
day in and day out. Creation of Super Mantra Gayatri has been done via
such a scientific foundation that by imbibing it secret energy centers dwelling
in it opens fully and in our psyche starts flowing the waterfall of piousness. In
Gayatri dwells extraordinary divine energy that can gather in the psyche
Prana Energy spread out in the cosmos via its intense magnetic power. Due
to all these reasons Gayatri is a sure shot method to destroy a vile intellect.
Definitely along with it other types of sorrow too get overcome. Goddess
Gayatri is an imperishable eternal light. Due to it the darkness of a vile
intellect gets warded off and the soul attains its natural state. It is for
attaining bliss in the sacred peaceful lap of purity personified mother earth
that it has arrived.
Man is the inheritor and prince of Almighty God. The soul is a part of the
divine cosmic soul or God. All qualities and grandeur of his divine father
dwell in man. The energy present in a flame torch is present in a spark of fire
too. Despite this we find that mankind is leading a very lowly stature of life.
Despite being potentially divine he lacks divine wealth.
God is truth manifest but we all his children are immersed in delusion. God
is divine consciousness whereas we humans are immersed in spiritual
darkness. God is divine bliss incarnate whereas we are immersed in sorrow
and face harassment. What is the reason for this state? It is a question worth
pondering over.
When God's indestructible prince has come in this world akin to his divine
father's beautiful garden for merriment and sport then why is it that his life's
journey instead of being divinely blissful is filled with sorrow and poverty? It
is worth cogitating over this.
Fire is hot and illumined but when a burning coal starts cooling down ash
starts covering it. In this coal covered with ash the above 2 qualities cannot
be seen. Coal that has cooled down and is covered by ash is neither hot nor
illumined. It remains dark, ugly and a pile of ash. This lowly state of a
burning coal is that ash that has covered it from all sides. If this ash covering
it is removed fire dwelling within it starts blazing again and it now possesses
the qualities of heat and light.
Almighty God is Sat-Chit-Anand (existence-consciousness-bliss) in nature.
He oozes with divine bliss. His son (soul) hence too must be bliss personified.

While enjoying bliss of life in this divine garden he must experience bliss
only. It is the ash of a vile intellect that creates poverty and sorrow bang
opposite to the other by hiding this reality. Just as ash by covering coal fully
rests far away from its natural state in the same manner this vile intellect
hides the soul's state of purity, piousness and supreme bliss. As a result man
lives a life that is demeaning and poverty stricken.
It is this vile intellect that is none other than Maya, demonic nature and
spiritual ignorance. The more this covering covers man's mental arena to
that extent he remains sorrowful. The more dirt sticks to our body the more
we feel itchy and smell foul odor from it. The lesser this covering lesser is the
itchy feeling and foul odor. If in our body tainted foreign poison does not
gather no disease attacks it. But the more these distortions the more the body
becomes diseased. This vile intellect is like dirt gathering on the body or like
poisonous alien elements in the blood. And as a result of this itchy feeling,
foul odor, diseases and other type of discomforts like pain, worry, tension,
restlessness and harassment get created.
World humanity is sorrowful because of many hardships faced by them.
Some of them are pained by diseases, some are sad because of poverty and
the married life of many is stressful. Some are worried regarding their
children, their business accrues losses, advancement fails, suspicion lurks
regarding failure and there is fear with reference to court cases and enemy
attacks. Friends break each others' trust and hence are worried. Events of
breaking away from friends and relatives manifest. Such sorrow crops up
day in and day out. Just like ones personal life there is no dearth of strife in
the arenas of religion, spirituality, economic, social, political and
international. Even if a person is very cautious then too taints spread out in
society and mismanagement breaks apart their peace. Thus the goal of living
a life of bliss and peace is not achieved.
Sorrow could be personal or collective yet its cause is singular i.e. a vile
tainted intellect. In this world material means exist in such a big measure
that by playing with these 'toys' one's entire life can be lived joyously.
Humans possess priceless bodies, brains and sense organs. So much bliss can
be attained in more commonplace things and circumstances that in
comparison to it heaven seems lowly. But despite possessing all this people
are very sad and stressed out. There is no attraction of life, people pass time
waiting for death to engulf them. The mind and psyche daily are burning
with worry and tension, fear, demeaned state and restlessness. As a result
one has to endure strife similar to what is described in Indian Mythology
called Puranas.
This world is as beautiful as a painting. In it not even an iota of ugliness
exists. This world is a place for divine blissful sports. In it there is no place

for worries and fear of any sort. This life is a ceaseless stream of divine bliss.
In it there is no cause for undergoing sorrow. In this mother earth that is
more nectarine than even heaven dwell all principles that helps the bud
called the mind to bloom forth. The designing of this human body rare even
for demigods to attain has been created so beautifully that via its mere touch
it renders commonplace objects very beautiful. Almighty God's prince i.e.
the living soul has arrived in this world to enjoy bliss. God has sent all
mankind here by giving them a chariot that is the body, servants in the form
of sense organs and a minister that represents the brain. Almighty God has
sent mankind in this world akin to heaven so that he can see its beauty and
taste nectar that pours from every pore of it. But it is this vile human brain
that has created obstacles in this great goal of God and rendering heaven into
hell.
Healthiness is our natural state. Illness is unnatural and this error gets
created. Birds and animals follow nature in a natural way. They do not fall
sick. They are always healthy and joyful. But man invites illness by eating,
sleeping etc in an unnatural way. If man too follows nature's laws he shall
never fall ill. Similarly our sacred intellect too is natural. It has been given by
God, it is divine, it is there right from birth and a companion of our life. At
the time of sending us in this world God gives us Kamadhenu or wish
fulfilling cow or a sacred intellect so that man can attain all facilities and
joyous comforts. But we err, because we dwell in illusion due to spiritual
darkness by getting enmeshed in Maya or spiritual ignorance and
renouncing a pious intellect imbibe a vile tainted brain and by acting
unnaturally we invite illnesses. Similarly we invite a vile tainted brain. The
moment this witch comes all of life's situations become lopsided. Wherever a
vile tainted brain dwells there the human state reeks with chaos, worries,
desires, lowliness, cowardice etc
If we don colored spectacles all objects appear colored. Of course! The
objects actually are not of that particular color. Despite this all objects and
our surroundings appear like the colored spectacles. By donning the
spectacles of a tainted intellect our brain gets deluded. It is hence that the
otherwise straightforward situations and incidences give us pain. The main
course of action of Super Mantra Gayatri is to awaken Ritambhara Prajna
or divine intellect after warding off a vile intellect. Added to this Super
Mantra Gayatri possesses one more specialty wherein in it there dwells the
confluence of word science and musical note based wisdom. No other Mantra
possesses it. Great Yogis interested in spiritual practices and men of
austerities have tested, applied and experienced it. On its basis they have
noted its comparative supremacy. By getting impressed with it they have
given a prime spot to Super Mantra Gayatri and its Super Energy.
Regarding this many descriptions can be found in holy scriptures:
Gayatrya na param mantra na bijam pranavadhikam.

Gayatrya na param japyam gayatrya na param tapaha.

Gayatrya na param dhyanam gayatrya na param hutam.
Havishyam ghritam sanyuktam gayatri mantra purvakam.
............................Vishwamitra Kalpa
Apart from Super Manta Gayatri there is no better Mantra. There is nothing
greater than it like Japa or Mantra chanting, austerities and meditation.
Apart from Gayatri Yajna there no superior Yajna.
Gaytri paradevateti gahita brahmaiva chidrupini.
............................Devyupanishad
Gayatri is called Paradevata or supreme than demigods. That consciousness
manifest Gayatri is noe other than Almighty God.
In the epic Mahabharat Bhishma Pitamaha says:
Param sidhimavapnoti gayatri mutamam pathet.
That person who chants the greatest Gayatri Mantra attains supreme Sidhi
or material and spiritual success.
Ashtadashasu vidyasu mimansati gariyasi.
Tatopi tarkashastrani puranastebhya ai vach.
Tatopi dharmashastrani tebhyo gurvi shrutirdwij.
Tatopyupanishacchreshtha cha tatodhika.
Durlabha sarva mantreshu gayatri prnavanvita.
.........................Brihat Sandhyabhashya
Amongst the 18 types of sciences Mimansa or Karmakand (rites and rituals)
is great. Logic and Viveka or farsighted discrimination are greater than
Karmakand (rites and rituals). The glory of Puranas or Indian Mythology is

greater than Nyaya scriptures. Vedas are superior than Puranas or Indian
Mythology and religious scriptures. The utility value of Upanishads that
describe the Vedas is greater than that of Vedas. Super Energy Gayatri is
greater than Upanishads. Amongst all Mantras Pranav or Om and Gayatri
together reign supreme.
Gayatrim yaha parityajya chanyamantramupasatey.
Na safalyamavapnoti kalpa koti shatairapi.
.........................Brihat Sandhyabhashya
Those who worship Mantras other than Gayatri Mantra they do not atain
desired success even after 100 million Kalpas.
Japatam juhyatam chaiva nityam cha prayatatmanam.
Rishinam paramam japyam guhya metannaradhipa.
........................Mahabharat
For ceaseless Japa or Mantra chanting and for doing fire rituals called
Havan great Rishis' supremely sacred Mantra is Gayatri.
Gayatri sarvamantranam shiromani taya sthita.
Vidhanamapi tenaitam sadhayetsarva sidhaye.
Trivyahriti yutam devimonkara yuga samputam.
Upasya chaturo vargana sadhayedyo na sondhakaha.
Devya dwijatwamasadhya hitwa chintamanim karat.
......................Brahmavartik

Amongst all Mantras and sciences Gayatri is a crest jewel. Via it all spiritual
practices can be done pertaining to our sense organs. That person who does
not attain Dharma, Artha, Kama and Moksha via this worship/meditation is
one who has a blind intellect. If a person does worship/meditation of other

Mantras even though Gayatri is accessible certainly is foolish. It is like

throwing away a touch stone that fulfills our desires and searches for other
less valuable jewels. Such a one is stupid.
Gayatri vedajanani gayatri lokapawani.
Na gayatryaha param japyametadvijnaya muchyatey.
......................Karma Purana
Gayatri the mother of Vedas is one that purifies the most in the entire world.
Great scholars opine that that there is no other greater Japa than Super
Mantra Gayatri.
Savitryastu param nasti shodhanam sarvakarma.
.......................Agni vridha chastambi
Nothing is better than Gayatri for sanctifying all actions.
Ashtadashasu vidyasu mimansati gariyasi.
Tatopi tarkashastrani puranastebhya ai vach.
Tatopi dharmashastrani tebhyo gurvi shrutirdwij.
Tatopyupanishacchreshtha cha tatodhika.
Durlabha sarva mantreshu gayatri prnavanvita.
...................Skandpurana Kashikhand (9/49/50)
In comparison to Mimansa scriptures, Tarka scripture is more important, in
comparison to Tarka scripture Purana scripture is more important, in
comparison to Purana scripture Tarka Dharma scripture is more important,
in comparison to Dharma scripture Tarka Veda scripture is more important,
in comparison to Veda scripture Tarka Upanishad scripture is more
important and in comparison to Upanishad scripture Gayatri is more
important.
Kuryadanyannava kuryadanushthanadikam tatha.

Gayatri matra nishthastu krityakrityo bhavedwijaha.

........................Gayatri Mantra
Whether a Dwij carries out other Anushthans (rites) or not, whether he
worships and meditates or not, yet he becomes glorified if he worships and
meditates on Super Mantra Gayatri.
Saptakoti mahamantra gayatri prayakaha smritaha.
Adidevamupasantey gayatri vedamataram.
.......................Gayatri Kalpa
Amongst millions of Mantras the chief Mantra is Gayatri. It is worshiped
and meditated on by demigods like Brahma etc. it is Gayatri that is the root
of all Vedas.
Ityukta cha mahadevi mulaprakritirishwari.
Antardhanam gata sadyo bhaktya devairabhishtuta.
Tataha sarvey swargavan tu vihaya padapankajam.
Samyagaradhayamasurbhagvatyaha paratparam.
Trisandhyam sarvada sarvey gayatrijapatatparaha.
Yajnabhagadibhihi sarvey devim nityam sishevirey.
Na vishnupasana nitya vedenokta tu kutrachit.
Na vishnudiksha nityasti shivasyapi tathaiva cha.
Gayatryupasana nitya sarvavedaiha samirita.
Yaya vina twadhahapato brahmanasyasti sarvatha.
Tavata kritakrityatvam nanyapeksha dwijasya hee.
Gayatrimatranishnato dwijo mokshamvapnuyat.

Kuryadanyam na va kuryaditi praha manuhu swayam.

....................Devi Bhagwat (12/8/84 to 91)
Vyasji said:
At first Goddess gave directions and then disappeared from sight. After this
all demigods gave up their ego and spiritual ignorance and started
worshiping and meditation on that Supreme Divine Energy.
All of them got immersed in doing Gayatri Mantra chanting along with
Trikal Sandhya. They started giving Yajna portion. Worship and meditation
on Vishnu and Shiva is not permanent. Vedas say that Gayatri worship and
meditation is permanent. A Brahmin devoid of Gayatri is said to be a sinner
and he undergoes a downfall. No other worship and meditation method gives
good results like Gayatri. Only by doing Gayatri worship and meditation
does one get Moksha or salvation. Such a one need not do any other type of
worship and meditation. Lord Manu has spoken similarly:
Ashtadashasu vidyasu mimansatigariyasi.
Tatopitarkashastrani puranastebhya eva cha.
Tatopidharmashastrani tebhyo gurvishrutirdwij.
Tatopyupanishachhreshtha gayatri cha tatodhika.
Durlabhasarvamantreshu gayatri pranavanvita.
Na gayatryadhikam kinchittrayishu parigiyatey.
Na gayatrisamo mantro na kashisadrishi puri.
......................Skandpurana
Amongst 18 sciences Mimansa is quite a huge science. Bigger than it is Tarka
science. Bigger than it is Puranas and bigger than it is Dharma science and
bigger than it is Shruti. O Dwij! Bigger than it is Upanishad and superior to
it is Gayatri. Nothing is more superior than it. Gayatri along with Pranav or
Om is rare amongst all Mantras. In Vedatrayi nothing is more supreme than
Gayatri. There is no Mantra greater than Gayatri. There is no Mantra
comparable to Gayatri and there is no city like Kashi.

Gayatri vedajanani gayatri brahmanaprasuha.

Gataram trayateyasmad gayatri tena giyate.
Vachyavachak sambandhogayatrayaha saviturdwayoha.
Vachyoso savita sakshad gayatri vachika para.
Prabhavenaivagayatryaha kshatriyaha kaushikovashi.
Rajarshitwaparityajay brahmarshipadamiyivan.
Samarthyam prap chatyucchairanyadbhuvanasarjaney.
Kim kim na dadyadgayatri samyagevamupasita.
Gayatri is the mother of Vedas. Gayatri gives birth to Brahmins because they
chant it and protect it. Hence it is called Gayatri. Gayatri and Savita
complement each other. God Savita is Vachya and Gayatri Para is its
Vachika. Due to the influence of Gayatri Kaushik (Vishwamitra) of
Kshatriya or soldier class became Brahmarshi from Rajarshi. Also he had
learnt the science of making buildings. Man can attain just about anything
by doing Gayatri meditation and worship.
In comparison to other Mantras Gayatri reigns supreme and it is also said
that by worshiping only one Beej or seed one gets benefit of studying Vedas.
In comparison to other Mantras one cannot negate Gayatri's supremacy.
Following is the proof of this:
Sarvesham japasooktanamruchancha yajusham tatha.
Samnam chaikaksharadinam gayatri paramo japaha.
..................Vridha Parasher Smriti (4/4)
In Vedas there are so many types of worship-meditation, Mantras, Japa,
Sookta, Omkar etc and in comparison to them Gayatri reigns supreme.
Ashtadashasu vidyasu mimansatigariyasi.
Tatopitarkashastrani puranastebhya eva cha.

Tatopidharmashastrani tebhyo gurvishrutirdwij.

Tatopyupanishachhreshtha gayatri cha tatodhika.
.....................Skandpurana, Kashi Khanda (1/49-50)

Amongst 18 sciences Mimansa is quite a huge science. Bigger than it is Tarka

science. Bigger than it is Puranas and bigger than it is Dharma science and
bigger than it are Vedas. O Dwij! Bigger than it is Upanishad and superior to
it is Gayatri.
Sarvesham japasooktanamrichanch yajusham tatha.
Samnam chikaksharadinam gayatri paramo japaha.
Tasyashchaiva tu omkaro brahmana ya upasitaha.
Abhyastu paramam japyam trailokyepi na vidyatey.
.................Brihat Parasher Samhita
Amongst all Sooktas Rigveda, Yajurveda and Samaveda and everything else
like Pranav etc Gayatri is said to be supreme. Brahmaji had meditated on
that Omkar which is a part of it. There is nothing in the 3 worlds that is
worth chanting than these 2.
Puranam samhitashastram smritishastram tathaiva cha.
Gayatryaha parmeshani sadaartham brahmasammitam.
The true meaning of Puranas, Samhita science and Smriti scriptures is
offered by Brahman.
Sangashcha chaturovedanadhityapi savangayat.
Savitrim yo na janati vrutha tasya parishramaha.
...................Yogi Yajnavalkya

Even if one studies all Vedas along with Ang and Upang yet if he does not
know Gayatri his efforts go in vain that must be undestood by us.
Gayatrim chaiva vedanshcha tulayam samatolayat.
Veda ekatra sangastu gayatri chaikataha smruta.
................Brihad Yogi Yajnavalkya (4/80)
When Brahma the creator placed the 4 Vedas in one pan of a weighing scale
and Gayatri in the other pan, he noted that Gayatri was much heavier than
the Vedas.
Over here the essence is that while comparing the mother and her children
the glory of the mother is much more. Keeping in mind all these specialties
Gayatri is said to bestow the 4 fruits viz. Dharma, Artha, Kama and Moksha
and that it wards off our sins, sorrow, harassment etc. Spiritual practices
pertaining to it is said to be supremely great.
Maharshi Vyas says:
Gayatrayeva tao yogaha sadhanam dhyanamuchyate.
Sidhinam sa mata maata nataha kinchid brihataram.
.............................Skand Purana
It is Gayatri that is penance, Gayatri is Yoga and Gayatri is the biggest
meditation and spritual practices. There is no other spiritual practice that
gives such type of success.
Lord Manu too has concluded thus:
Saivitryastu parannasti
...................Manu (2/3)
Gayatri is supremely great. There is nothing greater than it.
In Manu Smriti text that great spiritual philosophy and worship-meditation's
deep import has been written about at every step of it.

Japyenaiva tu sansidhyed brhmano natrasanshayaha.

Kuryadanyannam va kuryanmaitro brahman uchyate.
...................Manu (2/87)
Gayatri worship-meditation is said to be the substratum of all Sidhis.
Whether a Gayatri devotee executes other Anushthans or not yet by
behaving in a friendly manner with all he attains Brahman. This is because
due to his Mantra chanting his psyche becomes sacredly pure like Brahman
or divine cosmic consciousness.
Purvam sandhyam japanstishthetsavitriyamarkadarshanat.
Paschimam tu samaseenaha samyagrihakshavibhavanat.
...................Manu (2/10)
O beloved son! In the morning before the sun rises a devotee that stands and
does Mantra chanting and in the evening till the stars are seen in the sky he
sits to do Japa or Mantra chanting attains both material and spiritual
grandeur.
Apam samipey niyato naityakamvidhimasthitaha.
Savitrimpyadhiyati gatwaranyamsamahitaha.
...................Manu (2/104)
By doing meditation-worship on Gayatri seated on the shore of a lake in a
jungle far away from noisy cities one attains mental concentration and
benefit of untold peace.
Gayatri matra saropi varamvipra suryantrataha.
Nayantritastrivedopi sarvanshi sarvavikriya.
...................Manu (2/118)
A self controlled person doing Gayatri worship is greater than a Veda
chanting Brahmin eating everything and selling off all.

Etadaksharmetam cha japan vyahriti purvikama.

Sandhyorvedavidvipro veda punyena yujyate.
...................Manu (2/78)
A self controlled person doing Gayatri worship at dawn and dusk along with
Omkar and Vyahriti attains Vedic wisdom automatically.
Yodhitehanyahanyetam trini varshanyatandritaha.
Sa brahma parambhyeti vayubhutaha khamamurtimana.
...................Manu (2/82)
That devotee who without lethargy continuously and regularly for 3 years
does Gayatri Mantra chanting understands very well consciousness that
resides in air and cosmic space and attains the credentials to attain Almighty
God (Self or God Realization).
In the Bhagwad Geeta (10/35) it is said:
Gayatri chhandasamaham
Amongst Chhandas (poetic meter) I (God) am Gayatri Chhanda.
Gayatri paradevateti gadita brahmaiva chidrupini.
........................Gayatri Purashcharan
Gayatri is the supremely great deity and it is also said that it is divine
consciousness manifest Brahman.
Gayatri va idam sarva bhutam yadidamkincha.
.....................Chandogya Upanishad
This entire cosmos is Gayatri manifest.
Gayatri pratyagbrahmaikyabodhika.

....................Shankar Bhashya
Gayatri connotes direct wisdom of non dual Brahman (God).
In scriptures and Puranas or Indian Mythology there are many examples of
such proofs given above wherein Gayatri is called the mother of Indian
Culture and supreme icon deity worth worshiping. Not only this but that
those not worshiping Gayatri are rebuked. The above mentioned proof is
very important. As long as it was imbibed our country India was a crest
jewel from both the material standpoint. When Super Power Gayatri was
ignored later our country's foundation experienced a downfall. In order to
strengthen it, it is mandatory that Gayatri devotion spreads out in the entire
world.

CHAPTER 1
MOTHER OF VEDAS-MOTHER OF DEITIES IS
GODDESS GAYATRI

Gayatri is called the mother of Indian Culture and Yajna is called Indian
Religion's divine father. It is called mother of Vedas, mother of deities and
mother of the entire cosmos. Right from the Vedas to religious scriptures all
divine knowledge is said to be the amplification of Gayatri's seed letters.
Yoga practices and energy streams of austerities have emerged from
Himalaya Mountains in the form of Gayatri. The great results of its spiritual
practice bestows on us Amrit or immortal nectar, Kalpavriksha or the wish
fulfilling tree, Kamadhenu or the wish fulfilling cow and divine bliss. These

are 5 boons given by 5 chief deities. Because of this mystery its one form is
created with 5 faces. In Super Energy Gayatri reside hidden, material
powers and infinite storehouse of soul based glories. The theory of attaining
Sidhis via spiritual practices can be directly perceived by doing Gayatri
worship systematically. Even in material world dire situations it proves to be
a great boon. This primordial energy Mother Gayatri if taken recourse to
never does one experience hopelessness.
Gayatri Mantra has 24 alphabets or letters. Spiritual seers had identified
that divine energy residing in seed form in these letters that are known as 24
Avataras, 24 Rishis, 24 energy streams and 24 Sidhis or Divine Powers. With
the help of worship-meditation on it Devarshi, Brahmarshi and Rajarshi
attained a high status.
Anoraniyan mahato mahiyan
This itself is a Super Power. Gayatri Mantra is a small body made from 24
alphabets or letters. In it a full storehouse of knowledge and wisdom. There
is nothing in this cosmos which does not dwell in Gayatri. Its high stature
spiritual practices are quite difficult and special in nature but alongside it is
straightforward too that in any situation it can be successfully with ease. It is
hence that everyone without exception can use it and is universal in nature.
Women, men, children or senior citizens and without communal differences
can worship it and based on their faith in it they can accrue benefits.
The 4 Vedas have been created in the form of description of the 4 legs of
Gayatri. Hence it is called Mother of Vedas. For description of Jnana or
divine wisdom other scriptures and Puranas have been created. Indian
Spiritual Philosophy and knowledge-wisdom are manifestations of the seed in
the form of Gayatri. With the help of its worship-meditation and devotion
great citizens of ancient India had become akin to deities and hence Gayatri
is called Mother of Demigods too.

CHAPTER 2
THE 3 LEGS OF GAYATRI BASED SPIRITUAL
PRACTICES

THE METHOD OF RENDERING THE BODY, MIND AND SOUL VERY

STRONG:
Gayatri is called Tripada or 3 legged. It is believed that this Tripada energy
has spread everywhere and is described in the form of 3 bodies, 3 worlds, 3
Gunas, Traitbrahma, 3 deities, 3 energies and 3 Kalas (time). Its 3 fruits or
results are immortal nectar, touch stone and the wish fulfilling tree. Spiritual

seers have told us about the 3 boons and 3 blessings of Tripada. In these 3
reside material wealth and spiritual grandeur. In the Atharvaveda 7 fruits
have been described viz. life span, life force, children, animals, fame, wealth
and Brahmavarchas or divine aura and these are found in the periphery of
immortal nectar, touch stone and the wish fulfilling tree.
Everyone wishes that grandeur in the realms of Adhibhautik, Adhidaivik
and Adhyatmik increases and that lack of any type and obstacles are warded
off. All facilities and comforts dwell in this periphery. Difficulties maybe
many but in reality they come in the realms of Adhibhautik, Adhidaivik and
Adhyatmik. These are symbolically called immortal nectar, touch stone and
the wish fulfilling tree. Scriptural seers say that these 3 divine glories are
attained due to the divine grace of Goddess Mother Gayatri. Those people
that possess ethically earned prosperity and ooze with sacred qualities are
called deities. Divinity is conjoined to habits and inner nature and not to
external appearance. It is tested via inner qualities, activities and nature.
Demigods dwell in heaven. It can also be said that wherever demigods dwell
there the atmosphere becomes heavenly.
Gayatri is called the presiding deity of heaven. One more name of her is
Kamadhenu or the wish fulfilling cow. By drinking its milk demigods attain
divinity. There are 3 streams of joyous comforts of demigods. They are:
Immortal nectar, touchstone and wish fulfilling tree. With the help of
immortal nectar demigods get Adhyatmik grandeur, with the help of the
touchstone they get Adhibhautik grandeur and with the help of the wish
fulfilling tree they get Adhidaivik grandeur. It has been said that via
devotion to Tripada Gayatri it is possible to attain all 3 grandeurs.
Immortal nectar is that matter that on drinking it a person becomes
immortal. Old age and death leave such a person forever. They remain young
all the time and their psyche drips with bliss and zest. It is believed that
immortal nectar rests in heaven. Demigods are known to drink it. Those
benefits accrued by demigods in heaven are attained by a Gaytri devotees.
The existence of matter like immortal nectar is not found in earth where
living beings dwell. On earth everything takes birth, they grow and change
too. It is due to growth that youth and old age arrive. Transformation and
death are nothing but that which has become old is created again. This
natural creation's cycle goes on and on.
It is the physical body that becomes old and then dies. Lest we accept that
our existence is not the body but is the soul then definitely one experiences
that he is deathless and immortal. Even children are overjoyed to remove old
clothes and wear new clothes instead. Hence how can a God or Self Realized
person undergo fear of death? Right since time immemorial to the end it
remains youthful. It never undergoes childhood or old age. Sorrow and lack

too give pain to the body but via Gayatri meditation-worship one gets
inspiration, direction and facility to attains immortality. It is hence that it is
called Kamadhenu or wish fulfilling cow. It is said that Kamadhenu is
immortal in nature. Demigods on drinking it become glorified. By drinking it
bad sentiments stay far away. No qualities like envy, anger and revenge are
seen. As a result one is saved from selfish desires and lack of peace. A
Gayatri devotee always oozes with bliss, zest and enthusiasm.
This immortality or Amaratva and divinity are synonymous. In comparison
to human beings demigods are said to be more powerful, prosperous and
contented. It is the principle of deities to desire to give beneficial things and
continue doing so. People drinking the nectar of God or Self Realization are
never greedy to use things for themselves. Whatever they get they prefer to
give it away to those in need. Hence even if things are less the soul is
completely self fulfilled. It has no desire or wish to attain anything. If we get
true experience of it the face always exhibits contentment and peace. Such
people all called Jivanmuktas or liberated while alive. They are termed
deities of earth and in the areas they contact they create an environment of
heavenly bliss. These are the signs of people attaining immortality.
Paras or touchstone is that if touched a black, ugly and cheap metal like iron
turns into gold or we can say that it becomes a metal that is beautiful,
expensive and ever shining. The so called existence of Paras is suspicious. Till
date none have attained it yet the Paras of spirituality in the form of honest
effort dwells in this world for a great length of time. Those touching it
overcomes life full of poverty, rushes ahead with speed and reaches the peak
of development.
The first step regarding efforts is mental in nature. They are identified as
creative inner potentials like power of resolve, daring, hope, zest etc. Its
second step can be seen by our eyes in the form of alertness and zeal.
Lethargy and indolence are wicked demons that curse us with backwardness.
When a person gets attacked by them he leads a demeaned regressive life of
poverty and lowliness of the soul. Over and above lethargy and indolence is
the third demon in the form of lack of self control.
When the touchstone of effort is imbibed by the inner self they after kicking
the taint make a resolve to shoo them away. The state of inertness and semi
consciousness is shaken up in order to ward it off. It creates a new way of
living life. Sacred ideals are neo created. This inner transformation that is
ushered in by efforts is called the touchstone of supremacy, advancing
enterprise and a strong will power. Wherever it manifests there diseased
state, weakness, poverty, sadness etc run far away.

Gayatri means one that protects our Prana or vital force. 'Gaya' means
Prana or vital force and 'Tri' means one that protects us. Prana or vital force
connotes effort. When inner enterprise and practical hard work combine so
as to use it for high stature great goals then in every realm its miraculous
results can be noted. The touchstone is given due importance because by
overcoming the lowliness of iron into greatness of gold. Efforts of the
spiritual touchstone plays a similar role. Via Gayatri devotion one gets divine
light and daring gets awakened. Keeping this in mind one can say that this
inner transformation has found a touchstone called Paras. No doubt
symbolism rests in it but there is no place for overstatement here.
A pure sacred inner personality is believed to be like a Kalpavriksha or a
wish fulfilling tree. Kalpavriksha is found in heaven. It is said that those who
sit beneath it and makes a wish, it gets fulfilled. From the symbolic
standpoint it is but a description of a pure sacred inner personality. Gayatri
is called the Goddess of a sacred radiant intellect. If she is worshiped
properly God gives that devotee the boon of a sacred radiant intellect. The
first influence of this boon is seen in the form of a pure sacred inner
personality. Those who reap such success they must understand that they
have attained the good fate of sitting under the Kalpavriksha or a wish
fulfilling tree and attaining what he wishes for. Demigods are desire free. All
their desires get fulfilled o their own. They never have to endure the burden
of hardships. Such a glorious inner state is called Sidhi (success) of
Kalpavriksha or a wish fulfilling tree.
Man's requirements are very less. His stomach is small and the combined
production of this hands and brain is so much more that in a short time and
efforts his physical bodily needs get fulfilled easily. If the lifestyle of Indians
is adhered to and one remains content in accruing apt nutrition for his family
then the burden on his head full of unnecessary desires shall not increase any
longer. In order to fulfill then correct or wrong means shall not be taken
recourse to. No longer need one get worried every day. Requirements get
fulfilled by ones efforts. The net of mental desires is nothing but increasing
wrong desires and remaining restless to immediately fulfill them. That for
which unruly people each moment remained stressed and fall at the feet of
gods and goddesses for such selfish desires, people with divine intellect stay
far away from them. By taking recourse to a pious intellect, by limiting their
desires, by making efforts for that which is apt they march ahead in life with
fair ease. It is easy for such people to remain desire free and get joy while
sitting under the Kalpavriksha or a wish fulfilling tree. In a nutshell we must
accept that a pious intellect itself is a Kalpavriksha or a wish fulfilling tree.
The root aim of Gayatri devotion exactly is this. The more one gets its
blessings the more one gets benefits of the touchstone-Paras, immortal nectar
or Amrit and wish fulfilling cow or Kamadhenu. Thus by leading a life of
demigods despite dwelling in the human body they attain bliss of heaven and
Moksha or salvation.

Gayatri is called soul power and Divine Wisdom. It is comparable to a pot of

immortal nectar. Super Mantra Gayatri oozes with soul welfare and the
substratum and guidance for attaining God vision. Those devotees that
imbibe it drink immortal nectar and in the true sense of the term become
deathless and immortal like deities. It is hence that it is called a pot of
immortal nectar.
The fourth name of Gayatri is wish fulfilling cow or Kamadhenu and the
fifth is Brahmastra or divine weapon. Wish fulfilling cow or Kamadhenu
means giving nourishment like a loving mother, development and the boon of
both material and spiritual prosperity. Brahmastra or divine weapon means
by throwing it downfall, dire situation and obstacles get powdered to pulp
and thus get warded off. Anyone that truly takes recourse to Gayatri has to
the last letter experienced those Richas or verses of Atharvaveda wherein
Super Energy Gayatri is said to bestow the boon of a long life, vital or life
force, performing feats, children, cooperative family, sacred fame, means,
grandeur and Brahmavarchas or soul energy.
In the 24 alphabets of Super Mantra Gayatri that is sacred wisdom's
presiding deity and concrete Ritambhara Prajna or Divine Wisdom rests the
gist of rendering high in stature mankind's thinking process and character.
In the spiritual practice of this Super Energy all foundations, directives and
methods of Yoga practices and austerities are known to reside. With its help
those undergoing its spiritual practices attain apt benefits of Ridhi-Sidhis or
material and divine powers. In order to attain heaven and salvation that is
the high stature of soul progress taking help of the root basis of Gayatri's
philosophy is incomparable.
Every human being adhering to spirituality must definitely take help of
Gayatri. As per Indian religion and spirituality Sandhyavandan is included
in daily worship and devotion. In Sandhya method the spot enjoyed by
Gayatri is like the spinal cord of our body. Indian religion has 2 symbols
wherein one is Shikha or pigtail and other is Sutra (Yajnopaveeta) or sacred
thread. Both are images of Gayatri. There is a tradition of hoisting the flag of
Gayatri's divine wisdom on the highest peak of the head and wearing on the
shoulder Gayatri Mantra's 9 words i.e. 9 threads and 3 Vyahvrittis
represented by 3 knots called Yajnopaveeta or the sacred thread. The brain
is the basis of knowledge and body that of actions. Both in the form of Shikha
or pigtail and other is Sutra (Yajnopaveeta) or sacred thread Gayatri has
been reinstated. Rishi texts direct that the management and usage of both
must be executed as per inspirations residing in the 24 alphabets of Gayatri.
The name of Gurumantra has been given as Gayatri. When studies and
Vedic studies, Sutra (Yajnopaveeta) or sacred thread etc Sanskaras
commence Gayatri initiation is given. Other Mantras are called Deva,
Sadhana, Sampradaya etc Mantras but the beginning less Gurumantra is
Gayatri only. This very Gurumantra was given to Lord Rama by Guru

Vasishtha and Lord Krishna was given the same by Rishi Sandipan. Via
Maharishi Vishwamitra Lord Rama attained Bala Atibala energies by doing
spiritual practices of it. Maharishi Vishwamitra too became a Brahmarishi
from a Rajarshi via the above effect.
LORD MANU says that there is no other Mantra apart from Gayatri that
can make us purer. One can attain Almighty God if one regularly does
Gayatri Japa or chanting for 3 years continuously. Those Dwijas that do
Gayatri Japa or chanting in 3 or Trikal Sandhya attains the fruit of studying
the Vedas. Whether one does any other spiritual practice or not but if one
chants Gayatri only one attains Sidhi or material and spiritual success. A
devotee that chants Gayatri 1000 times daily gets liberated from sins akin to
a snake shedding its old skin. That Brahmin failing to do Gayatri Japa or
chanting is rebuked.
SHANKH RISHI opines that Gayatri saves those who have fallen in the
ocean of hell by catching hold of their hands. Nothing is more supreme than
it in heaven and earth. One that knows Gayatri definitely attains heaven.
MAHARISHI VYAS says that just as honey is the essence of flowers, Ghee or
clarified butter is the essence of milk so too Gayatri is the essence of all
Vedas. If one succeeds (Sidhi) in Gayatri practices it becomes akin to the
wish fulfilling cow or Kamadhenu. River Ganga purifies our body and
Gayatri manifest Divine Ganga purifies our soul. One who ignores Gayatri
and takes up other spiritual practices is like one giving up a delicious cake
and becoming a foolish poor beggar. Nothing is more supreme than Gayatri
if we wish to attain success and reap rich dividend by doing penance.
BHARADWAJ RISHI says that Brahma and other deities too performed
Gayatri worship-meditation. It bestows God or Self Realization. Because of
Gayatri the vile qualities of those who act unethically get destroyed. A person
devoid of Gayatri is more impure than a lowest caste Shudra.
NARADJI says that Gayatri is Bhakti or devotion manifest. It is beyond
doubt that wherever Gayatri or Bhakti manifest dwells there Lord Narayana
too resides.
VASHISHTHAJI opines that if a person whose IQ is very low, who walks on
a tainted path and one without sharp brain skills does Gayatri Mantra
chanting he attains a high status due to its positive influence. Later post
death he attains higher divine worlds. Those with sacred qualities and in a
balanced manner does Gayatri worship attains soul benefits.

GAUTAM RISHI says that the fount of Yoga is Gayatri. It is via Gayatri
that other Yoga practices are executed.
MAHARISHI UDDALAK says that Almighty God's terrific divine aura
dwells in Gayatri. Those who imbibe this aura his prosperity becomes
unlimited.
DEVAGURU BRIHASPATI opines that the primordial creator of divinity
and immortality is Gayatri. After attaining it nothing else remains to be
attained.
SHRINGI RISHI says that the primordial source of knowledge and science is
Gayatri. Nothing is greater than it in this cosmos.
CHARAK RISHI opines that those who while observing celibacy do Gayatri
worship and devour fresh Amla fruit lead a very long life.
YOGIRAJ YAJNAVALKYA tells us that Gayatri and Vedas with 6 parts
were placed in the 2 pans of a weighing scale. Know that Gayatri was
heavier. The gist of Vedas are Upanishads and the gist of Upanishads is
Gayatri along with Vyahritis. Gayatri is the Mother of Vedas and destroys
our sins. There is no other Mantra in heaven and earth apart from Gayatri
that renders us more sanctified. There is no other pilgrim spot like River
Ganga, there is no other demigod than Keshav and similarly there is no other
Mantra more supreme than Gayatri and in future too it will remain thus.
One who understands Gayatri becomes the knower of all knowledge,
spiritual and highly learned. If a Brahmin does not daily worship Gayatri
but is a knower of Vedas know he is like a low caste Shudra. All his hard
effort goes down the drain. A person ignorant of Gayatri strays far away
from true Brahmin hood and becomes sinful instead.
PARASHER says that amongst all Japa or Mantra, Suktas and Vedic
Mantras Gayatri is supreme. When Vedas are compared to Gayatri the
latter's weight age is infinitely more. By doing Gayatri Japa devotedly one
attains Moksha or salvation and one gets purified both within and without. If
a person studies Vedas, scriptures, Puranas and Itihas but is without Gayatri
one must not call him a Brahmin.
ATRI MUNI says that Gayatri purifies and sanctifies the soul. Due to its
divine influence very intense taints and vileness get destroyed. That person
who understands the principle of Gayatri very well does not require any
other joy in this world.

The opinion of all Rishis is one as described above. This proves that any
Rishi may harbor difference of opinion regarding other topics but for
Gayatri they all had equal faith. All of them in their spiritual practices gave
1st spot to Gayatri. There are thousands of verses in scriptures, texts,
Smritis, Puranas etc that throw light on Gayatri's greatness and spiritual
practices. If all these are collected a huge Gayatri Purana can be made.
Spiritual great men of the 20th century too have accepted the importance of
Gayatri just like Rishi-Munis of ancient eras. Today's era is that of high
intellect, logic and proof.
MAHATMA GANDHI used to say that Super Mantra Gayatri is useful for
curing diseases and soul advancement too. If with a cool calm psyche Gayatri
is chanted all dire situations get warded off.
LOKMANYA TILAK says that Indian citizens have been enmeshed in many
types of bondages. It shall not go away simply via political struggle. For it the
soul shall have to be illumined and as a result what is right and wrong shall
become clear. Thus people shall give up the tainted path so as to walk the
path of true greatness.
MADANMOHAN MALVIYAJI the great man had said that amongst the
priceless jewels given to us by great Rishis of yore the jewel of Gayatri
Mantra is much more beautiful. Due to it the intellect gets purified and God's
divine light illumines our soul. With the help of this light so many souls have
been liberated from material bondage. Gayatri possesses the power to elicit
faith in Almighty God. Along with this it wards off material lack too. That
Brahmin who does not daily chant the Gayatri Mantra is at fault because he
has given up his religious duties.
RABINDRANATH TAGORE says that there is a Mantra that awakens
entire India and it is so easy that in one breath it can be chanted. And that
Mantra is called Gayatri. In practicing this Mantra there is no place for dry
arguments and difference of opinion.
YOGI AUROBINDO GHOSH at many places has directed regarding
Gayatri. He has shown that Gayatri possesses such divine energy that can
execute important tasks. With reference to spiritual practices he ordained
many to chant Gayatri Mantra.
SWAMI RAMKRISHNA teaches us thus:

I tell people that there is no need to do long term spiritual practices. Instead
do this small spiritual practice of Gayatri. By chanting Gayatri Mantra one
attains huge Sidhis (success). This Mantra is small but its power is limitless.
SWAMI VIVEKANANDA says that one must ask for something from a king
that is equivalent to his glory. It is most apt to ask for a pious intellect from
Almighty God. When God is pleased with us he bestows on us a pious
intellect. A pious intellect shows us the true path of life and via sacred
activities all types of happiness are attained. Those that advance on the path
of great activities never lacks any type of joy. Gayatri is a Mantra of a pious
intellect and hence it is the crest jewel amongst all Mantras.
ADI GURU SHANKARACHARYA informs us that it is beyond the capacity
of humans to describe the greatness of Gaytri. To possess a pious intellect is
such a great thing that it cannot be compared to any other task of this world.
That divine intellect which gives divine sight to attain God or Self Realization
gets inspiration from Gayatri. The latter is the primordial Mantra. It has
incarnated as an Avatar to destroy our sins and augment gentlemanliness.
SWAMI RAMTIRTHA has said that the biggest task is to attain Lord Rama.
The aim of Gayatri is to overcome desires and attain Rama. Only those
whose intellect is sacred attains God. Gayatri all the time says that the
intellect should be so sacred that it feels Lord Rama to be greater than
worldly desires.
MAHARISHI RAMAN teaches that in Yoga Sciences Mantra Science is very
powerful. Due to Mantra energy extraordinary success is attained. Gayatri is
such a Mantra that with its help one can attain both material and spiritual
prosperity.
SWAMI SHIVANANDA opines that if one does Gayatri chanting at
Brahmamuhurat (4 am to 6 am) the psyche and heart become sacred, the
body becomes very healthy and the character becomes humble. Since the
brain becomes subtle it attains farsightedness. Ones memory power evolves
very well. In trying times via Gayatri one gets divine help. Via this one can
attain God or Self Realization.
T SUBARAO the renowned Self Realized person from Southern India says
that Gayatri is the divine nature of Lord Savita Narayana. Since it is
Primordial Energy it is called Gayatri. In the Bhagwad Geeta scripture it is
described as 'Adityavarna'. The very 1st part of Yoga practices is to do
Gayatri devotion.

SWAMI KARPATRI says that those who have the credentials for Gayatri
must daily and regularly chant it. For Dwijas Gayatri Japa or chanting is
very important.
SWAMI VIDYANANDJI who used to give discourses on the Bhagwad Geeta
scripture says that Gayatri sanctifies our intellect. In life there is no greater
benefit than a sanctified intellect. Hence it is the mother of a real big benefit.
DR RADHAKRISHNAN says that if we cogitate over the universal prayer of
Gayatri we shall get proof of how it truly gives great benefits. Gayatri is a
prayer that starts a stream of a new life in us.
MAHATMA SARVADANANDJI a member of Arya Samaj says that right
since world creation the Lord has been worshiped via Gayatri. SWAMI
DAYANANDA too as per this tradition has said that we must do
Sandhyavandan and study the Vedas. By doing this our psyche gets
sanctified and because the intellect becomes pure human life becomes
beneficial for both oneself and others too. The more one harbors faith and
trust in such sacred activities to that extent spiritual ignorance and other
such harassments get destroyed. That devotee who does Gayatri Mantra
chanting with devotional love and with regularity for him it is a boat that
helps him cross over the sea of material bondage and a road to attain Soul
Divine Wisdom.
SWAMI DAYANANDA the founder of Arya Samaj was a devoted follower
of Gayatri with total faith. Swamiji told the King of Gwalior that Gayatri
Purashcharan is indeed much greater than a Shrimad Bhagwat Saptah
discourse. He had shown the correct method of Gayatri chanting in Jaipur to
Sachidananda, Hiralal Rawal, Ghodal Singh etc. Before commencing a
discourse in Multan he chanted the Gayatri Mantra and he also said that this
Mantra is supreme amongst all other Mantras. The root of all 4 Vedas is
Gurumantra Gayatri and right since creation of this world Rishis-Munis
have continuously chanted it. Swamiji had conducted its Anushthan at many
places. In it around 40 Brahmins were called. This Japa or Mantra chanting
continued for 40 days.
Prof R Srinivas a high stature member of Theosophical Society said that in
the thinking trend of Hindu Religion Gayatri Mantra is most powerful than
others. Its connotation is very farsighted and is full of mysterious import.
This Mantra has many meanings. Its effect on people with varied mindsets to
is different. In it one can notice a power to gather together all visible and
invisible, high and low, humans and demigods etc with a mysterious cord.
When a devotee having credentials to execute Gayatri Mantra chanting does
it by understanding its mysterious import, concentrating the mind and heart
and chants it with pristine purity it establishes a bond with the great

conscious energy dwelling in the sun. Wherever such a person chants this
Mantra there on himself and in the nearby surroundings a cosmic spiritual
effect manifests itself. It is this divine effect is a great spiritual blessing. It is
therefore that our ancestors prayed for this incomparable power to Gayatri
Mantra.
In the above quotes right from Vedas-Upanishads to great saintly people
have in unison accepted that in Gayatri resides all principles that by
sanctifying a person's inner foundation he is made happy and well advanced
both materially and spiritually. One sided progress never lasts long. This
Super Mantra Gayatri possesses extraordinary specialties. Only that Yoga
can said to be complete if it ushers in well being from the standpoint of
individual needs to social needs, this world and the next etc. All such
teachings dwell in Gayatri worship-meditation. Almighty God divinely
wishes that along with an individual's advancement both entire society and
the world reach peaks of glory. This process is fulfilled by Gayatri worshipmeditation.
In this world 2 energies are at work. One is conscious and the other is inert.
Inert objects appear steady but within it too movement exists. If we see
superficially sand, mountains, lake etc are steady but in it creation, growth
and changes take place. If it is seriously taken note of one can clearly see all
creatures think and do something or the other daily for their activities.
Similarly matter's visible and invisible mobility can shake up the world. The
cosmic macrocosm like earth, innumerable planets and stars with great
speed move on their axis and elliptical path. Due to their magnetic pull they
all are bound to each other. Not only this but that in their inner area strange
movements occur swiftly. To matter is conjoined mobility in an inseparable
manner. It is hence that their existence remains untarnished. Matter has
been created due to terrific activity and hence objects get created and
changed too. This mobility of matter/objects is called Apara Prakriti.
The atom is the smallest unit of objects. Its combined and gigantic
humungous form is the cosmos. This inert energy has so far been studied a
bit but it is not possible to describe consciousness in the same way. But
because of this energy so many creatures are seen alive. By itself the body of
creatures is created from so many chemicals but its inner consciousness is
very original. It is not created from material energy but due to its own
influence it influences the body and surroundings too. This itself is called
consciousness. Consciousness has 2 qualities wherein one is will and the other
is faith. Will is called sentiment and thinking is called intellect. One is the
inner soul and the other is called brain. At the root of thoughts created by the
brain dwells its home, faith, description and the combined inspiration that is
at work. A living creatures consciousness is called Para Prakriti.

That science which describes and analyzes inert matter is called Material
Science. That science which describes and analyzes consciousness is called
Spiritual Science. Gayatri overflows with both subtle energies that are
material and spiritual in nature. The atom is the smallest unit of matter. Its
combined form is the cosmos. In the name of microcosm and macrocosm that
smallness and gigantic nature can be understood. The conscious nature of
living beings is called the soul and its cosmic form is called divine cosmic soul
or Almighty God. Due to activity that dwells in the cosmos atoms get
affected. This can also be explained in another way that the combined
consciousness of atoms create upheavals and movements in the cosmos. It
also can be said that in the arena of consciousness the soul gets boons from
Almighty God or else the combined consciousness of all souls Almighty God
gets created.
Gayatri is said to be the source of Para and Apara Prakriti. In the spiritual
realms it is mainly seen as Divine Aura. It is the manifest form of Almighty
God. It comfortably carries a devotee to Brahmanirvana or salvation. In the
Devi Bhagwat scripture this has been further clarified:
Parabrahma swarupa cha nirvanpadadayini.
Brahma tejomayi shakti saadhishthatra.
Gayatri is God incarnate and giver of Nirvana or salvation. It is the presiding
deity of Divine Aura and Divine Energy.
What exactly is Gayatri? Consciousness' Manasarovar (lake) spread out in
the entire cosmos is called Gayatri. It works as divine knowledge and divine
sentiments in creatures and in material objects it works as creation and
activity of change. Its fount is divine consciousness.
This cosmos' evolution and propagation has taken place from one focal point
only. This has been accepted both by western scholars and Indian
philosophers. As per the opinion of leading astronomers too that initially
when world creation took place there was only one great element. In it an
explosion occurred wherein objects started flowing like a river. As a result
this cosmos became full of planets and galaxies. In this materialism based
belief matter does have place but since consciousness does not have it, it
appears as incomplete.
The research of Indian scholars is much more important. We too have a
belief that during world creation only divine consciousness with Satatattva
(existence) was there. In its navel area gushed forth 'Ekoham bahusyama' i.e.
may I become many from one. That itself became its will power and world

manager became well known as Super Divine Power. It is called Gayatri. In

spiritual terminology this divine energy gets classified as Sata, Rajas and
Tamas. In Gayatri Super Science this itself is called Hreem or power of
wisdom or Goddess Saraswati, Shri or means or Goddess Lakshmi and
Kleem or predominating with energy or Goddess Kali. Due to the union of
Almighty God and Prakriti a mixed Rajas existence got created and it is
called Jiva or living being. Just as a son has chromosomes of both parents
similarly a living being has existence of both his father and mother. In a
major way a child lives with the help of its mother. It is more conducive for
the child's nature. This fact has been experienced seriously by Indian
spiritual seers. It is hence that Gayatri worship and meditation has been
given so much importance. Since it includes devotion, action, wisdom,
detachment etc Gayatri's spiritual philosophy helps both in this world and
the next.
Subtle Prakriti is that which got created that after emerging from Primordial
Energy Gayatri got classified a Saraswati, Lakshmi and Kali. The rivulet of
all pervasive energy is much subtler than the 5 elements. Just as in the flow
of a river when water bangs with wind a gurgling sound is produced
similarly from the energies of subtle Prakriti (nature) 3 types of sound
emerges. In the Sata flow Hreem, from the Rajas flow Shree and from Tamas
flow Kleem sound emerges. Subtler than this is Brahman's Om sound flow.
Devotees undergoing Naadyoga spiritual practices in deep meditation hear
these sounds. With its aid they attain Brahman or Almighty God.
In ancient times our revered ancestors viz. Rishi-Munis via their sharp divine
eye had unfolded this subtle principle of science. They used up their entire
life to search and succeed in it. As a result in comparison to present day
material science they succeeded in attaining n fold more benefits. They
placed their own rights on the subtle flow of Adishakti or Primordial Energy.
It is quite clear that from within the human body varied energies manifest.
Via Yoga our Rishi-Munis awakened energy centers, Chakras (subtle
plexus), glands, 7 goddesses of Tantriks, lights and magnetic eddy fields
hidden in various parts of the body. Due to this awakening an energy flow
manifested and these were conjoined to various streams of Adishakti or
Primordial Energy as and when required. Since the electricity of both is
similar they would mix with each other. They would give and take the
conversation etc between these centers. Similarly by awakening secret
centers dwelling in Tandra (drowsiness) of the body we create a bond with
energy centers of subtle nature at that time a relationship is created between
Adishakti or Primordial Energy and man. Due to this relationship man starts
understanding the mysteries dwelling in Adishakti or Primordial Energy. As
a result man as per his will uses it to attain benefits because whatever exists
in this world is present in Adishakti or Primordial Energy. Hence this
bonded energy too can create a relationship with all objects of the world and
various means.

Today's scientists in order to create a bond with gross nature by remaining

within limits of the 5 elements use up expensive machines, electricity, steam,
gas, petrol etc and thus do some scientific research. The benefit attained from
this is quite miniscule. This solution is full of hard work and takes up a lot of
time. In it is the uselessness of taints, breaking things and changes. Work has
to go on continuously in order to set up technology, protect it and produce
things. To change its place of work is very difficult. All this trouble was not
faced by Indian scientists of Yoga Science. Without taking help of any
machinery, without using fuel like petrol/gas they by establishing a bond
with centers of their subtle body and subtle nature executed such wondrous
tasks that its great potential is beyond the ken of today's modern material
scientists.
The basis of these Sidhis or divine powers is spiritual practices. A person via
spiritual practices by advancing his inner nature credentials (Paatrata)
attains benefits of that super power. This super power by proving the 3
Prakritis or nature viz. Sata, Rajas and Tamas manifests as wisdom, activity
and worship of God in human life. Thus such a devotee becomes wise, active
and truly wealthy.
That person who via Gayatri spiritual practices makes efforts to advance
spiritually, mentally and soul wise they by awakening potentials dwelling
within them and by placing authority on them renders them so useful just
like today's scientists who after placing their authority on electricity, atoms
and other energies have rendered them useful for service to mankind. Those
energies and material wealth noted in this material world they in the inner
world manifest as spiritual wealth. The spiritual energy of Gayatri manifests
such good destiny for its devotee.
Anyone can benefit at least a wee bit via Gayatri spiritual practices. Special
benefits accrue from worship with desires, influence of Beej Mantras,
Anushthan and Purashcharanas. Due to it so many hardships of the devotee
get warded off and the sequence of attained desired results goes on. Such
benefits and miracles are seen often but they take place at a lower level. It is
certainly nothing big that certain hardships get overcome and certain success
was attained. Such benefits are accrued even by material efforts. The true
benefit of worship-meditation is to render the inner soul infinitely powerful.
Along with this akin to the sandalwood tree not only oneself becomes
fragrant but that renders other trees and plants around it quite fragrant. In
order to get such a high stature benefit man akin to a real Brahmin has to
imbibe those qualities, actions and inner nature. Only then that infinite
storehouse is attained for which Divine Wisdom exhorting Brahmins inspires
them to attain that storehouse.

In Super Mantra Gayatri divine powers overflow but it manifests only in

pious character devotees. When River Ganga descended on earth from
heaven in order to hold it Lord Shiva by spreading out his matted locks
created a foundation for the 1st manifestation. Pleased with Bhagiratha's
austerities River Ganga gave him the boon of it incarnating on earth. But
River Ganga also said that lest no foundation was in place while it descended
on earth it shall pass by earth and enter hell. Thus earth denizens would not
benefit at all. When this requirement was fulfilled by Lord Shiva River
Ganga successfully descended on earth. The same condition holds true for
Super Power Gayatri. In order to imbibe it a powerful foundation is
compulsory. And this requirement is fulfilled only by those devotees that
ooze with true great Brahmin qualities, actions and sacred inner nature.
Such Brahmins can imbibe the Super Energy of Mantras within themselves
and via it uplifts both individuals and society too.
Devadhinam jagatsarvam mantradhinashcha devataha.
Te mantra brahmanadhinastasyad viprohi devata.
....................Matsya Purana
This entire world is under the reign of demigods. All demigods are reigned
by Mantras. Mantras are used by Brahmins and hence true Bramins too are
demigods.
Maharishi Vashishtha was a deity of such an earth. He possessed
Kamadhenu (wish fulfilling cow) or the Super Power of Gayatri. When he
had to wage a war against King Vishwamitra the king's huge army had lost
this war. At that time the king uttered thus:
Dhig balam kshatriya balam, brahmatejo balambalam.
It means fie upon material might and it is lowly and useless. True strength
dwells in the divine aura of Brhmins. That itself is the power of Mantras, it is
true might etc and after saying thus King Vishwamitra gave up his kingdom
so as to do penance in order to attain a true Brahmin's strength.
In scriptures of yore there are many examples of the nature, action and usage
of Gayatri Divine Energy. Many times this energy has exhibited its own true
nature and deities and Rishis in the form of prayers by eulogizing its inner
nature have described it. Based on this description one can know that in this
world where and in what manner Gayatri Energy Principle is being used.
Gayatri paradevateti kathita brahmaiva chidrupini

This Gaytri is much bigger than other deities as is being said by all. This
Gayatri with divine consciousness is Almighty God only.
Gayatri tu param tattvam gayatri parama gatihi.
.................Brihad Parashar (5/4)
Gayatri is the supreme Divine Principle and it is the ultimate goal.
Gayatri sa maheshani parabrahmatmika mata.
..................Rudra Tantra
This Gayatri itself is Almighty God and Maheshwari (consort of Lord Shiva).
Gayatri paradevateti kathita brahmaiva chidrupini.
...................Gayatri Purashcharan Padhati
It is Gayatri that is supreme deity, consciousness in nature and Almighty
God himself.
Tadaksharam tatsaviturvarenyam prajna cha tasyaha prasrita para sa.
..................Guhyopanishad
It is imperishable God, it is tatsaviturvarenyam divine intellect and an all
pervasive Para or Divine Energy.
Ya devi sarvabhuteshu shakti rupena sansthita
Namastastyay namastastyay namo namaha
Indriyanamadhishthatri bhutanam chakhileshu ya
Bhuteshu satatam tasyay vyaptai devyay namo namaha.
..................Markandeya Purana
I bow down to that Super Power which dwells as energy in all creatures, is
the presiding deity of the 5 sense organs and manages the 5 elements.

Gayatri va idam sarvabhutam yadidam kim cha vagvai gayatri vagva idam
sarva bhutam gayatim cha trayate cha.
Ya vai sa Gayatriya vav sa yeyam prithivyasya heed sarvam bhutam
pratishthitametameva natisheeyatey.
..................Chandogya Upanishad (3/12/1/2)
Gayatri dwells in all 5 elements. Whatever dwells here is Gayatri manifest.
Speech is Gayatri. It describes and protects via speech. This earth too is
Gayatri in which all creatures reside.
Sesha chatushpada shadvidya gayatri tadetadrachabhyanutanam.
Etavanasya mahima tato jyaya shwa purushaha.
Padosya vishwabhutani tripadsyamritam diveeti.
..................Chandogya Upanishad (3/12/5)
This Gayatri has 4 legs and 6 categories. Its greatness is limitless. That 3
legged Param Purusha dwells in the soul oozing with immortal nectar and
divine light. One of its leg is a contented world.
Gayatri's consciousness based flow works in the form of a sacred and divine
intellect. Wherever it resides there true Brahminhood and divine qualities
rain down. Along with this divine glories conjoined to soul power too
increase in the devotee.
Gayatri is said to be the Mantra of true Brahmins. But this does not mean
that apart from Brahmins people of other castes cannot do Gayatri spiritual
practices. In fact its true meaning is that those who yearn to fully benefit
from this Super Power they must not merely do Mantra chanting and
austerities but that in their social transactions in this world too must
manifest true sacred Brahmin qualities. To the extent one's character is pure
and sacred to that extent radiant benefits of Super Mantra Gayatri can be
availed. Even little amount of worship executed by a person with a glorious
character gives extraordinary benefits. As against this a person with a lowly
character may execute sacred tasks for his entire life yet he shall fail to
accrue any benefit. Lest we augment true Brahmin qualities within us then
all those benefits mentioned in scriptures regarding Gayatri worship can be
really attained by us.

Gayatri Japa or Mantra chanting gives important benefits. In order to give a

glimpse of this we are giving many proofs of it thus:
Sarvesham vedanam guhyopanishatsarbhutam tato gayatrim japet.
....................Chandogya Parishishtam
Gayatri is the gist of all Vedas and mystery based Upanishads and hence we
must do Gayatri chanting every day.
Sarvavedasarabhuta gayatraystu samarchana.
Brahmadayopi sandhyayam tam dhyayanti japanti cha.
.................Devi Bhagwat Skand 16; Chapter 16/15
The worship-meditation of Gayatri is the essence of all Vedas. Even deities
like Brahma etc do Gayatri meditation and Japa or chanting at dawn, noon
and dusk.
Gayatri matra nihnato dwijo mokshamapnuyat.
.................Devi Bhagwat Skand 16; Chapter 8/10
Those Brahmins who meditate and worship Gayatri attain salvation.
Ehikamushkikam sarvam gaytri japato bhavet.
.....................Agni Purana
Those that chant Gayatri attain all joys that are both material and spiritual
in nature.
Yodheetehanyahanyetam trini varshanyatandritaha.
Sa brahma parambhuyeti vayubhutaha ivamurtiman.
........................Manu Smriti
That person who daily chants Super Mantra Gayatri for 3 years he definitely
attains Almighty God and as per his wish he travels like wind does.

Kuryandanyanna va kuryat iti praha manuhu swayam.

Akshaymokshamvapnoti gayatrimantrajapanat.
...................Shaunak
In this manner Manu himself has said that whether you worship other deities
or not but via Gayatri Mantra chanting a Dwij attains salvation.
Omkar sahita japan tam cha vyahritipurvakam.
Sandhyayorvedavidvipro veda-punyena muchyatey.
.....................Manu Smriti (2/78)
That true Brahmin who does Japa of Om and Gayatri Mantra with Vyahriti
attains the fruits of studying Vedas.
Gayatri japate yastu dwikalam brahmanaha sada.
Asatprarihitopi sa yati param gatim.
...............Agni Purana
That Brahmin who always does Gayatri Mantra chanting both at dawn and
dusk but takes donations in an inapt manner, even so he attains salvation.
Sakridapi japedvidwan gayatrim paramaksharim.
Tatkshanat sambhavetsidhirbrahmasayujyamapnuyat.
.................Gayatri Purashcharan 28
Even if a scholar chants Gayatri with supreme alphabets even once he
immediately attains success and also attains Sayujya salvation with Brahma.
Japyenaiva tu sansidhayet brahmano natra sanshayaha.
Kuryadanyatra va kuryanmaitro brahman uchyatey.
.....................Manu 97

Whether a Brahmin does anything or not even so he can attain Sidhi or

success via Gayatri only.
Nasti ganga samam tirtha na devaha keshavatparaha.
Gayatryastu param japam na bhutam na bhavishyati.
.................Vra.Yo.Yajnavalkya 102-7/8
There is no pilgrim spot akin to River Ganga, there is no greater deity than
Keshava and till today no greater Japa than chanting of Gayatri Mantra
exists and shall not manifest in future too.
Sarveshamjapasuktanamruchashcha yajusham tatha.
Samnam chaukaksharadinam gayatri paramo japaha.
.................Vru.Parashar Smriti Chapter 4/4
Amongst all Japa Suktas Rig, Yaju and Sama Vedas and one alphabet
Mantras Gayatri Mantra reigns supreme.
Yatha madhu cha pushpebhyo ghritam dugdhadrasatpayaha.
Evam hi sarvavedanam gayatri saar uchyatey.
....................Vyas
Just as the essence of flowers is honey, of milk is Ghee or clarified butter, of
juices is Paya similarly Gayatri Mantra is the essence of all Vedas.
Tadityarichaha samo nasti mantro vedachatushtaye.
Sarvey vedashcha yajnashcha danani cha tapas cha.
Samani kalaya prahurmunayo na tadityarichaha.
....................Vishwamitra

In all 4 Vedas there is no Mantra comparable to Gayatri Mantra. Great

Munis opine that all Vedas, Yajnas, charity and austerities are not even 1
Kala measure of Gayatri Mantra.
Somadityanvayaha sarvey raghavaha kurvastatha.
Pathanti shuchayo nityam savitrim paramam gatim.
....................Mahabharat Anu.Parva Chapter 15/78
O Yudhishthira! All Suryavanshi, Chandravanshi, Raghuvanshi and
Kuruvanshi clans daily after their ablutions chant the Gayatri Mantra.
Ekaksharam param brahma pranayamaha parantapaha.
Savitrayastu parannasti pavanam paramam smritam.
...................Manu Smriti 2/83
Om is Almighty God. Pranayam is supreme austerities and there is no other
Mantra like Gayatri that sanctifies everyone.
Gayatrayaha paramam nasti divi cheha na pavanam.
Hastatranapradandevi patatam narakarnavey.
...................Shankh Smriti 2/83
There is no Mantra or anything either on earth or heaven like Gayatri that
can save a person diving in the sea of hell by catching hold of his hands. It
sanctifies us too.
In the Gayatri Samhita too it is said:
Yatha purvasthitamchaiva na dravyam karya-sadhakam.
Mahasadhantopyasmannajno labham tathapnutey............80
Just as one cannot carry out activities merely by possessing wealth only
similarly a foolish person cannot attain benefits of this great spiritual
practice.

Sadhakaha kurute yastu tantrashakterapavyayaha.

Tam vinashayati saiva saaiva samoolam natra sanshayaha............81
That devotee who misuses Mantra Energy the latter totally destroys him.
Satatam sadhanabhiryo yati sadhaktam naraha.
Swapnavasthasu jayantey tasya divyanubhutayaha............82
That person who regularly is engaged in spiritual practices so as to attain
discipleship such a person gets divine experiences in dream.
Safalaha sadhako lokey prapnuteynubhavan navan.
Vichitran vividhashchaiva sadhunasidhyanantaram............83
In this world a successful devotee after attaining success due to spiritual
practices attains newer and strange types of experiences.
Bhinnabhirvidhibhi budhaya bhinnasu karyapanktisu.
Gayatrayaha sidhimantrasya prayogaha kriyate budhaiha..........84
A wise person for varied tasks succeeds first in Gayatri Mantra chanting so
as to use it with Viveka or farsighted discrimination using varied methods.
In this manner in scriptures at many places one finds a description of great
benefits of Gayatri Mantra chanting. It has nothing to do with singing
praises just like that. Attaining success via Mantras and attaining both
material and spiritual benefits is quite scientific in nature. In pages after this
we shall see that via Mantras and via the energy of cosmic divine
consciousness what type of benefits accrue.

CHAPTER 3
GAYATRI SUPER POWER IS THE SUPREME ICON
DEITY OF THE 3 DEMIGODS

Gayatri is a root and inseparable energy of Almighty God. It is not any

independent god or goddess but is an active portion of Almighty God.
Brahman or cosmic divine consciousness is without any shape or form, it is
beyond thoughts, it is beyond the ken of the human brain and is a witness but
because its mobility is consciousness in nature it is worth worshiping.
Further one gets desired results of worshiping and meditating on it.

In Indian spiritual scriptures there is a description of many gods and

goddesses. Mention has been made there of their varied forms and varied
names and shapes. All these gods and goddesses are but different forms of
the divine energy of Almighty God. Just as speech lies in the tongue, vision in
eyes, brain in the intellect, strength in hands and mobility in legs similarly
innumerable divine energies of God are given different names as different
deities. In order to render them divinely energized varied types of exercises
of varied organs are executed. But a person understanding the true reality
focuses his mind on the root life force of the human body, digestion,
purification of blood etc because by watering its root all leaves and branches
by themselves remain lush green. Different worship rites of deities too is
quite useful. There accrues no loss yet a farsighted person just like watering
the root focuses his vision on the root divine energy and after rendering
strong and nourished the seemingly different parts so as to attain all benefits
which they shower on a true devotee.
The basis of all divine energies is Almighty God's energy. It is this Almighty
God's energy that is called Gayatri. In the divine principle it is divine energy
Gayatri that manifests mobility. Due to this all parts and demigods attain
nourishment. Hence spiritual seers take recourse to the chief shelter and that
which is attained only after roaming here and there aimlessly is got from one
place itself. By doing worship/Arti of so many deities little benefit is accrued
but n fold benefits are attained when we worship the root divine energy.
Gayatri is the root and divine energies are its branches and sub branches.
That energy too gets its energy from the root center and thus becomes
capable. By this energy it gives a devotee desired boons. This fact has been
described in Indian Mythology/Puranas and scriptures in such a way that all
deities worship Gayatri and pray to it and whatever it attains from this
humungous storehouse is shared in its region.
Sarvavedasarbhuta gayatrayastu samarchana.
Brahmadayopi sandhyayam tam dhyayanti japanti cha.
.....................Devi Bhagwat 16/16/15
Gayatri worship-meditation is the gist of Vedas. Brahma, Vishnu, Mahesh
etc along with Sandhya worship Gayatri.
Previously we have said that varied sparks of Almighty God are known as
divine energies. The number of demigods is unlimited. It is said that there
are 3.2 million deities but amongst all deities only 3 are said to be major ones
viz. Brahma, Vishnu and Mahesh. Via their power of creation, propagation
and destruction this world's life, growth and transformation take place.

Brahma, Vishnu and Mahesh do not have their own energy. It is but a loan
taken from Primordial Energy called Adishakti Goddess. The moon does not
have its own shine. It shines because of the sun's aura. The reflection of this
aura appears as the shining of moon. This fact has been described in Skand
Purana as a discourse and examples thus:
Sarvashaktihi paravishno rigyajuhu sam sanjnita.
Saipa trayitapatyanho jagatashcha hinasti ya.
Saishayvishnuhu sthitim sthityam jagataha palanodyataha.
Rigyajuhu samabhutantaha savitwijaha! Tishthati.
Goddess Primordial Energy called Adishakti that manifests this world in the
form of creation, propagation and destruction is an independent energy and
has names called Rig, Yaju and Sama. By itself in 3 fold form manifests in
this world carries out creation, propagation and destruction.
Masi-masi kheryam yastatra tatrahi sa para.
Trayi mayi vishnu shaktirnasthanam karotivai.
Richaha stuvanti purvahaney madhyahaney cha yajunshi vai.
Brihadrathantaradini samanyangakshayey ravau.
Anga saisha trayi vishno rigyajuhu samasanjnita.
Vishnu shakti swasthanam sadaditye karoti sa.
Gayatri is 3 fold image since Brahma imbibes Rajoguna for creation, Vishnu
imbibes Sattvaguna for propagation and Mahesh imbibes Tamoguna for
merging this world in Gayatri. Also by becoming Rig, Yaju and Sama in
Savita Gayatri dwells there. In the morning Rig eulogizes the sun, at noon it
is Yaju and at dusk Brihadrathantar etc Sama Shrutis. It resides in the sun
and is Vedatrayi.
Na kevalam raveha shaktivaishnavi sa trayimayi.
Brahmatha purusho rudrastrayamettrayimayam.

Evam sa sattviki shaktivaishnavi ya trayimayi.

Adya saptaganastham tam bhaswantamadhitishthati.
This is not merely energy of sun's Vishnu form but that it is 3 fold in nature
viz. Brahma, Vishnu and Rudra. In this manner this 3 fold Adishakti or
Primordial Energy dwells in the sun with its 7 Gunas.
In the Devi Bhagwat Purana a detailed description of the deep import of
Goddess Super Power Gayatri. It is the icon deity of all gods and goddesses
and the crest jewel amongst all Mantras. Right since time immemorial it has
been highly praised and its worship-meditation is said to be a major one. In
scriptures this very description is found and via demigods unveiling the
mystery of its worship-meditation that very Super Power Gayatri is believed
to be their icon deity. Truly the center of all energies is this Super Mantra
Gayatri. Via its worship-meditation right from humans to deities it is proved
that all attain wellness.
Tasmannaham swatantrosmi shaktyadhinosmi sarvatha.
Tameva shaktim satatam dhyayami cha nirantaram.
Nataha parataram kinchijjanami kamalodbhava.
Lord Vishnu while eulogizing the energy manifest Goddess once told
Brahma, born from a lotus flower that I am not independent. I am at the
service of energy of this Goddess. Due to the might of her energy I have the
capacity to do many things. Hence I ceaselessly meditate on her because O
Brahmaji-seated on a lotus flower! Apart from her I do not know anyone.
Tena chapyahamuktosmi tathaiva munipungava.
Tasmattwamapi kalyanapurusharthaptihetavey.
Asanshayam hridambhoje bhaja devipadambujam.
Sarvam dasyati sa deviyadyadishtam bhavettava.
Devarshi Naradji told Vyas Muni that O supreme Muni! Brahmaji alsji also
had informed me about the powerful energy of that Goddess. Hence you too
in order to make full efforts without harboring any doubt devote yourself to
this Goddess in the lotus-heart. By devoting yourself at her hallowed feet she
will fulfill all your desires.

Chintayantu mahamamayam vidam devim sanatanim.

Sa vidhasyati naha karyam nirguna prakritihi para.
Brahmaviyam jagaddhatrim sarvesham jananim tatha.
Maya sarvamiha vyaptam trailokyam sacharacharam.
One day Brahma told the deities who were facing sorrow that they must
meditate on Mahamaya Sanatani Goddess. She that is divine Nirguna
(beyond all qualities) in nature shall fulfill all your tasks. She is Divine
Wisdom, one that nourishes us Divine Mother of all. She pervades all the
worlds whether animate or inanimate.
The other name of Gayatri is Savitri. In scriptures at some places it is called
Savitri and at others it is called Gayatri. When it is applied in the spiritual
realm it is called Gayatri and if it is applied in order to increase material
comforts and grandeur it is called Savitri. Due to differences in types of
applications the names given to it too are different. At the root basis it is the
description of only one great element. Since she oozes with divinity she is
called Goddess and since she is the fount of all types of grandeur she is called
Goddess. To utter one word again and again it appears strange. Hence from
the standpoint of facility of literature and beauty names like Gayatri, Savitri,
Goddess etc have been given. Taking the aid of that Super Power demigods
become capable of doing their tasks.
Mantranam chaiva savitri papanashey harismritihi.
Ashtadash puraneshu devi bhagawatam yatha.
Amongst all Mantras Savitri is supreme. Just as by remembering Almighty
God one's sins get destroyed and amongst 18 Puranas Bhagwat reigns
supreme similarly Savitri is supreme.
Na gayatrayaha parodharmo na gayatrayaha parantapaha.
Na gayatrayaha samo devo na mantrogayatrayaha paraha.
Gataram trayate yasmad gayatri tenasochyatey.
Nothing is more supreme than Gayatri. There no greater penance than
Gayatri. There are no deities greater than Gayatri and Gayatri is supreme

amongst among all Mantras. Those who sing or chant Gayatri he is protected
by Savitri. Hence it was named Gayatri. nshanka
Yasyaha prabhavamakhilam nahin vedadhata no va harirnagirisho nahin
chapyanantaha. Anshanshanka apichatey kimutanyadevastasyai namostu
satatam jagadambikayaiyha.
That Goddess whose total influence is not known to Brahma, Hari, Shiva and
anyone else, they do not know even one portion of it, then what to say of
other deities? We eternally bow down to this world mother.
Many times Brahma, Vishnu and Shiva after eulogizing Divine Mother
Gayatri have accepted that the basic foundation of their potential is this
Super Power. Such writings are found at many places.
Devi
twamasya
jagataha
kil
karanam
hi
jnatam
maya
sakalavedavachobhiramva. Sankhya vadanti purusham prakritim cha mam
tam, chaitanya bhavarahitam jagatashcha kartrim. Kim tadrashasi
kathamatra jagannivasashchaitanyatavirahita vihitasvayadya. Natyam
tanoshi saguna vividhaprakaram no vettikopi tanukrutyavidhanyogam.
Dhyayanti yam muniganaha niyatam trikalam sandhyeti nam parikalpya
guna sureshi. Budhirhibodhakarana jagatam sada twam shrishchasi devi
satatam sukhada suranam. Kirtistatha matidhritihi kil kantireva, shradha
ratishcha sakaleshu janeshu mataha.
Brahmaji while eulogizing Goddess Savitri says:
O Goddess! You are the cause of the entire world and I got this wisdom from
all Vedas. Sankhya sect talks of Prakriti Purusha and shows that she is the
creator without consciousness leanings. Is this true? If yes how did you reside
in this world devoid of consciousness? Despite you having name and form
you execute varied divine actions. None can know the laws of your Yoga.
Munis meditate on you all the time i.e. in past, present and future. Hence
your name is imagined as Sandhya. You are the blissful divine grandeur of
wise deities since in this world you bestow wisdom. O Mother! You are fame,
intellect, steadfastness, faith and zeal.
Nataha param kil vitarkshataiha pramanam praptam maya yadiha
dukhagatim gatena. Twam chaitra jagatam jananiti satyam nidralutam
vitarta harinatra drishtam. Twam devi sarvam vidushamapi durvibhavya
vedopi
nunamkhilarthataya
na
veda.
Yasmatvadudbhavmasau
shrutirapnuvana pratyakshmevasakalam tava karyametat. Kastai
charitramakhilambhuvi veda dhiman naham harirnach bhavo na
surastathanye. Jnatum kshamashcha munayo na mamatmajashcha

durvachai eva mahima tava sarvalokey. Yajneshu devi! Yadi nam na te

vadanti swaheti veda vidusho havaney krutepi. Na prapnuvanti satatam
makhabhagadhein devastvameva. Vividheshwapi vrittipasi.
Myself facing so many sorrowful situations arguing in hundreds of ways did
not find any proof greater than this. Hari going to sleep saw that you are the
Divine Mother of the entire world. O Goddess! Your true nature is not
understood even by great spiritual seers and scholars. Even Vedas do not
know you fully. This Shruti too has manifested from you. Where can one find
a highly intellectual person on planet earth that knows your true inner
nature? I too do not know it. Even Vishnu and Shiva do not know it. Even
other deities do not know it. Munis and my sons too are incapable. None can
describe your deep import and greatness. In Yajnas people knowing the
Vedas say Swaha regarding your name. Lest they fail to do this then despite
doing Havan or fire ritual demigods do not get their share. The inner nature
of deities is yourself only.
Jananti ye na tava devi! Param prabhavam dhyayanti tey hariharavapi
mandachittaha. Jnatam mayadya janani! Prakatam pramanam
yadvishnurpyatitaram
vivashodyashetey.
Dhanyasta
eva
bhuvi
bhaktiparastavandyau tyaktvanyadeva bhajanam twayi leenabhavaha.
Kurvanti devi! Bhajanam sakalam nikamam jnatva samast jananim kil
kamadhenum. Twam shaktireva jagatamakhilaprabhava twannirmitam cha
sakalam khalubhavamatram. Twam krisey nijavinirmitamoha jaley natyey
yatha viharatey swakritey natovai. Vishnuhu swayam prakatitaha
prathamam yugadaudatta cha shaktirmalakhalurakshanaya. Nat cha
sarvamakhilam vivashikrutodya yadrochatey tava tathamba karoshinunam.
While describing Savitri Brahma says O Goddess! Those do not know about
your infinite divine influence they after leaving you due to a weak brain
meditate on Hara and Hari and worship them too. On this earth there are
such type of people who leave others in order to meditate and devote
themselves to you only. O such good fortunate one, you indeed are glorified.
O Goddess! After looking upon you as everyone's Divine Mother and one
that fulfills our desires the entire world worships and meditates on you. You
have created this entire cosmos. It is your divine energy that resides in it.
Like an actor you pervade it. You have manifested Vishnu for propagating
this world and given him divine energy. He acts as per your divine wish.
From where did Lord Vishnu get energy to perform his tasks? Its description
is that one day he got inspired from within to perform a Yajna. At that time
from the Yajna manifested the divine aura of Gayatri and she via a celestial
voice gave a boon so as to render Lord Vishnu powerful. It is well known
that worship-meditation of Lord Rama and Lord Krishna is in vogue and
they were Avataras of Vishnu only.

Ekasminsamaye vishnu vaikunthey sansthitaha pura.

Sudhasindhusthitam deepam samsma manimanditam.
Yatra drishtva mahamaya manashchasaditaha shubhaha.
Yajnam kartu manashchakrey ambikaya ramapatihi.
Juhuvustey havihi kamam vidhivatparikalpit.
Krutetu vitatey homey vaguvacham sharirini.
Vishnum tada samabhashyam suswara madhurakshara.
Vishno twam bhava devanam hareyhey shreshthamaha sada.
Twam janaha pujayishyanti varadastwam bhavishyasi.
Avatareshu sarveshu shaktistey sahacharini.
Bhavishyati mamanshena sarvakaryaprasadhini.
Sadhayishyasi tatsarva mahattadvaradanataha.
Sastwaya navamantavya sarvada garvaleshataha.
Pujaniya prayatnena mananiya cha sarvatha.
Once, Vishnu was dwelling in Vainkuntha. At that time in the ocean of milk
he saw a stage decorated with precious jewels and from there itself he got the
Mantra of the Great Goddess. Then in the heart of Rama's Lord an
inspiration via the Goddess manifested to do a Yajna. Methodically with
Parikalpit Havi he did a Havan or fire ritual. After doing it in great detail a
celestial voice was heard. Whatever the Goddess spoke in a nectarine voice
was heard by Vishnu. The celestial voice said: O Vishnu! I am very pleased. I
give you a boon that you shall become supreme amongst demigods that are
greater than Hari too. People shall worship you and due to my grace you
shall be able to shower boons. In order to ward off the burden of earth you
shall become an Avatar and in it my divine energy shall accompany you. In
the form of my portion it shall fulfill all tasks. I give you a boon that it shall
complete all tasks. Hence out of arrogant pride do not insult it. You must
always honor it.

With his own words Vishnu is describing the divine import of the Goddess:
Jnatam mayakhilamidam twayi sannivishtam tvattosti sambhavalayavapi
mataradya. Shaktishcha tesya karaney vinatprabhava jnatadhuna
sakalalokamayiti nunam. Vistiryaya sarvamakhilam sadasadvikaram
sandarshayanshcha vikalam purushaya kaley. Tatvaishcha shodashbhireva
cha saptabhishcha bhasindrajalamiva naha kila ranjanaya.
O Divine Mother! I have understood perfectly that this entire cosmos dwells
in you and due to you only it gets created and merged in you later. In its
creation your divine energy is very potent. I have now known that definitely
all worlds dwell in you. While propagating this world full of true and false
nature you show your confounded form to the Purusha. One sees a mesh
with 16 and 7 elements for your divine sports.
Vidya twameva nanu budhimatam naranam shaktistwameva kil
shaktimatam sadaiva! Twamkirti kanti kamalamal tushtirupa muktiprada
viratireva manushyalokey. Gayatrayami prathamvedakala twameva swaha
swadha bhagwati sagunardhamatra. Amnaya eva vihito nigamo bhavya
sanjivanaya satatam surapurvajantam.
Lord Vishnu tells Goddess Savitri:
The wisdom of highly intellectual people is you only and those that are
powerful their power too is yourself. In this world of mortals it is you who
are fame, radiance, softness, nature of satisfaction, you are also glory that
gives salvation and the 1st Kala Gayatri of Vedas is you only. You are
Goddess in the form of Swaha, Swadha, Saguna and Ardhamatra. For the
bliss of deities and ancestors you have created the jurisdiction of Nigamas.
Lord Shiva while describing Savitri says:
Bhuvim vihaya tavantakasevanam ka ihavancchati rajyamakatakam.
Trutirasau kila yati yugantata na nikatam yadi tenghrisaroruham. Tapasi ye
nirata manuyomalastava vihaya padambujapujanam. Janani tey! Vidhina
kil vanchitaha paribhavo vibhavey parikalpitaha. Na tapasa na damena
samidhina na cha tatha vihitaiha kratubhiryatha. Tava padabja
paraganishevanadbhavati muktiryajebhavasagarat.
O Divine Mother! Say which is that fool that prefers to rule over the entire
world at the expense of gaining your company in this world. It means in
comparison to the deep import of serving residing close to you to attain a
kingdom is verily lowly. Such mistakes give sorrow for many eras. Those
Munis or deep thinkers leave your divine shelter so as to perform ceaseless

penance it appears O Divine Mother! That good destiny has left them and
also as far as glory is concerned that too leaves them. Despite doing
austerities, going into trance and performing Yajnas they fail to cross the
ocean of material bondage. One can succeed in it only if one takes your
divine shelter.
Evam satyayugey sarve gayatri japa tatparaha.
Taar hrillekhayo chapi japey nishnatmanasaha.
Na vishnupasana nitya vede nokta tu kutrachit.
Na vishnudeeksha nityasti shivasyapi tathaiva cha.
Gayatrayupasana nitya sarvavedaiha samirita.
Yaya bina twadhaha pato brahmansyasti sarvatha.
Tavata kritakrityasya nanyapeksha dwijasya hi.
Gayatrimatra nishnato dwijo mokshamvapnuyat.
Yunjannanyana va kuryaditi dwijo praha manuhu swayam.
Vihaya taam tu gayatrim vishnupasti parayanaha.
Shivaivasti rato vipro narakam yati sarvatha.
Tasmadadyayuge rajan gayatrijapatatparaha.
Devi padambujarata asansarve dwijottamaha.
In the Golden Era or Satyuga everyone zealously chanted Super Mantra
Gayatri. In other eras too everyone was a past master in Mantra chanting.
No where in the Vedas has it been said that meditation-worship on Lord
Vishnu is ceaseless. In fact only Gayatri meditation-worship is ceaseless as
clearly mentioned in the Vedas. Without it Brahmins face a total downfall.
For Brahmins Gayatri chating is quite enough. They need not harbor any
other hope. Only a Brahmin, a master in Gayatri meditation-worship attains
salvation that is the supreme goal of human living. Lord Manu has said that
whether a Brahmin, a master in Gayatri meditation-worship does anything
else or not, he has no requirement of it at all. Brahmins that give up Gayatri

meditation-worship and instead worship only Lord Vishnu or Lord Shiva

definitely enters hell. Hence O King! Hence in Golden Era or Satyuga
everyone was immersed in chanting Super Mantra Gayatri. All Brahmins
would attain bliss in doing Gayatri meditation-worship.
In this manner Super Mantra Gayatri is said to be the icon deity of Brahma,
Vishnu, Shiva etc. Not only this but that Gayatri is said to be the root fount
of all sciences, knowledge, wisdom and energies.
Sarvavedodaghritaha saro mantronyaha samudahritaha.
Brahmadidevai gayatri paramatma samiritaha.
Over here Super Mantra Gayatri is said to be the essence of all Vedas.
Gayatri is said to be Almighty God himself.
In Gayatri Manjari it is said that one day Goddess Parvatiji had asked Lord
Shiva about his icon deity. At that time he had replied that he regulary did
Gayatri meditation-worship.
In Gayatri Manjari it is said:
Gayatrim yo vijanati sarvam janati sa nanu.
Janatyetam na yastasya sarvaha vidyastu nishfalaha...........43
Those that know Gayatri know everything else. Those that do not know it all
their knowledge goes down the drain.
Gayatrayaiva tapo yogaha sadhan dhyanamuchyate.
Sidhirjananam sa mata, nataha kinchit brihattaram..........44
Gayatri is believed to be austerities, Yoga, means, meditation and the Mother
of all Sidhis. Nothing else is more capable than Gayatri.
Gayatri sadhana lokey na kasyapi kadapi hi.
Yati nishfalatametat dhruvam satyam hi bhutaley.........45
None's Gayatri spiritual practices go in vain. This is the indomitable truth of
planet earth.

Prapsyanti paramam sidhim jnasyantye tu ye janaha.

Gupta manum rahasyam yat parvati twam pativratam........46
O Goddess Paravati! Those that know this sacred mystery shall attain Super
Sidhi or success.
All scriptures say that Gayatri is the icon deity of all divine energies. After
taking shelter of Gayatri meditation-worship that has manifested right since
world creation and is said to be supreme a person can attain full benefits of
material and spiritual glories and grandeur.

END OF E-BOOK

LET US PRAY FOR WORLD PEACE AND

BROTHERHOOD AND THUS CREATE

A BEAUTIFUL BORDERLESS WORLD