8 Liebherr R954C Litronic Operation and Maintenance

Litronic
https://www.truck-manuals.net/
FOREWORD
This manual is primarily for the operator and the maintenance crew and
contains information which is vital to the correct and secure operation and proper
maintenance of the LIEBHERR excavator.
It includes:
- Accident Prevention Guidelines
- Operating Instructions
- Maintenance Instructions.
This Operation and Maintenance manual should be given to the OPERATOR and
any other person, who might work on the machine. It is very important that should
read the manual carefully before operating or working on the LIEBHERR
excavator and at regular intervals thereafter, for example:
- Operation, including installing and removing the attachments, trouble
shooting during operation, removing production residue, care, disposing of
operating and auxiliary fluids,
- Maintenance work (maintenance, inspection, repair),
- Transportation.
The manual will make it easier for the operator to get accustomed to the hydraulic
excavator and to prevent any problems due to improper handling.
All maintenance personnel should follow the operating and maintenance

instructions and your LIEBHERR excavator will give you constant and reliable
service with excellent performance, reducing repair costs and down time.
In addition to the operating and maintenance guidelines is this manual, additional

local and national accident prevention guidelines and environmental regulations
might be applicable and must be observed.
The Operation and Maintenance Manual is part of the machine and should be
left in the glove compartment of the operators cab.
Please take notice that we cannot honour any claims which could arise due to
careless handling, improper operation, inadequate maintenance, use of
unauthorized oils or lubricants, non-observance of the safety instructions, etc.
LIEBHERR reserves the right to cancel any warranty claims, service contracts
etc. without prior notice if any other than Original LIEBHERR parts or parts sold
by LIEBHERR are being used for maintenance and repairs.
This Operation and Maintenance manual contains all necessary information to

operate and maintain your Litronic track type excavator. However, should you
need additional information or explanations, please contact LIEBHERRs
Technical Documentation, Service school or Customer Service Department.
0.1
INDEX
Foreword .....................................................................................................................................0.1
Index............................................................................................................................................0.3
Information to the operation and maintenance manual...............................................................0.5
1/ MACHINE DESCRIPTION, TECHNICAL DATA

Machine description, technical data
Digging envelope for backhoe attachment
Lift capacities
Digging envelope for shovel attachment
2/ SAFETY INFORMATION
Destined use ...............................................................................................................................2.1
General safety information ..........................................................................................................2.2
Crushing and burn prevention.....................................................................................................2.3
Fire and explosion prevention .....................................................................................................2.3
Machine start up safety ...............................................................................................................2.4
Engine start up and operating safety ..........................................................................................2.5
Machine operating safety ............................................................................................................2.5
Machine parking safety ...............................................................................................................2.7
Machine transporting safety ........................................................................................................2.7
Machine towing safety.................................................................................................................2.8
Machine maintenance safety ......................................................................................................2.8
Hydraulic lines and hoses ........................................................................................................ 2.10
Protection against vibration...................................................................................................... 2.11
Signs on the hydraulic excavator ............................................................................................. 2.14
3/ CONTROLS AND INSTRUMENTATION

The operators seat .....................................................................................................................3.1
Controls and instrumentation in the cab......................................................................................3.2
Control unit ..................................................................................................................................3.4
Monitoring display .......................................................................................................................3.7
Informations provided in the menus of the LCD screen .......................................................... 3.19
Controls and instrumentation for optional equipments............................................................. 3.26
The heater and air conditioner ................................................................................................. 3.34
Outfit of driver's cab ................................................................................................................. 3.43
Operation of the excavator in safety mode .............................................................................. 3.44
4/ OPERATING PROCEDURES
Pre starting inspection.................................................................................................................4.1
Machine start up safety ...............................................................................................................4.3
Diesel engine operation ..............................................................................................................4.4
Stopping the engine ....................................................................................................................4.7
External starting procedure .........................................................................................................4.7
Hydraulic pumps safety operation...............................................................................................4.8
Machine operating safety ............................................................................................................4.9
Travel functions ....................................................................................................................... 4.10
Location of the two joysticks ................................................................................................... 4.12
Control of the swing.................................................................................................................. 4.12
Working position....................................................................................................................... 4.14
Attachment control ................................................................................................................... 4.14
Transporting the excavator on flatbed trailers or railway cars ................................................. 4.21
Towing the excavator ............................................................................................................... 4.22
Removal and installation of attachments ................................................................................. 4.23
0.3
5/ LUBRICATION
General safety information ..........................................................................................................5.1
Lubricant and fuel chart ..............................................................................................................5.2
Lubricant and fuel specifications .................................................................................................5.4
Lubrication charts..................................................................................................................... 5.10
Diesel engine............................................................................................................................ 5.11
Changing the oil in the splitterbox ............................................................................................ 5.14
Changing the oil in the travel gear ........................................................................................... 5.15
Changing the oil in the swing gear ........................................................................................... 5.15
Oil in the hydraulic system ....................................................................................................... 5.16
Checking the level in the reservoir of the windshield washer .................................................. 5.18
The centralized lubricating system........................................................................................... 5.19
Serially mounted semi automatic system................................................................................. 5.20
Optional mounted automatic system........................................................................................ 5.20
Grapple lubrication ................................................................................................................... 5.25
6/ MAINTENANCE
Machine maintenance safety ......................................................................................................6.1
The fuel system...........................................................................................................................6.4
The diesel engine ........................................................................................................................6.6
The track components.................................................................................................................6.8
The hydraulic system ............................................................................................................... 6.10
The swing and travel brakes .................................................................................................... 6.14
Checking mounting screws for tightness ................................................................................. 6.15
The air filter .............................................................................................................................. 6.16
The electrical system................................................................................................................ 6.18
The heater and air conditioner ................................................................................................. 6.20
Replacing the bucket teeth....................................................................................................... 6.22
Replacing wear and tear items................................................................................................. 6.23
Welding .................................................................................................................................... 6.23
Maintenance schedule ............................................................................................................. 6.25
7/
Controls on joystick handles for US - version .............................................................................7.1
Guidelines for hydraulic excavators when they are used for lifting loads ..................................7.3
The overload warning device ......................................................................................................7.5
8/ OPTIONAL ATTACHMENT
Adjustable cab.............................................................................................................................8.1
Hydraulic quick change adapter.............................................................................................. 8.2.1
Mechanical quick change coupler ........................................................................................... 8.2.9
Hydraulic removable counterweight ............................................................................................8.4
Machines with mechanic adjustable track gauge.................................................................... 8.5.1
Hydraulic aided track gauge adjustment ................................................................................. 8.5.5
Fully hydraulic actuated track gauge adjustment.................................................................... 8.5.7
Bypass oil filter for hydraulic circuit .............................................................................................8.6
Use of environmentally friendly hydraulic fluids ..........................................................................8.7
Refueling pump ...........................................................................................................................8.8
Vacuum pump on hydraulic tank.................................................................................................8.9
0.4
INFORMATION TO THE OPERATION AND
MAINTENANCE MANUAL R 954 C Litronic
EDITION :................... 11 / 05
IDENT / NR : ..... 10101988 A
This Operation and Maintenance Manual is valid for R 954 C Litronic excavators from the following
serial numbers :
Valid from Serial

TYPE
Number
HD 976 14968
EW 783 16155
HD W 781 16155
SHD 784 16155
VH-HD 785 16155
We recommend that you fill in the following table as soon as you receive your excavator. This will also
be helpful when you order parts
Product Id. No. (PIN No.) :
Manufacturing Date : CE 2006
Delivery Date : .. / .. / ..
This excavator meets EC Safety guidelines 98/37/EWG, 89/336/EWG, 91/368/EWG and 93/44/EWG.
Noise emission data has been measured according to EC guidelines 2000/14/EG.
We reserve the right to make any technical changes compared to data and
illustrations given in this manual.
Warranty and liability are subject to LIEBHERRs general business terms and
conditions are not changed in any way by instructions in this manual..
Instructions and photos or drawings in this manual may not be reproduced, used for
any reason and / or distributed without written permission from the publisher.
All rights reserved.
Manufacturer : LIEBHERR FRANCE S.A.S. 2 Avenue Joseph Rey, F-68005 COLMAR, France
0.5
8IGLRMGEP(IWGVMTXMSR 6'
,]HVEYPMG)\GEZEXSV D
PMXVSRMG
3TIVEXMRK;IMKLX[MXL&EGOLSI%XXEGLQIRX i X
)RKMRI3YXTYXO;,4
&YGOIX'ETEGMX] i Q
8IGLRMGEP(EXE
)RKMRI 7[MRK(VMZI
6EXMRKTIV-73 CCCCCCCC O;,4 EX641 (VMZIF] CCCCCCCCCCCCCCCCCCCCCCCCCC 0MIFLIVVW[EWLTPEXIQSXSV[MXLMRXIKVEXIH
1SHIP CCCCCCCCCCCCCCCCCCCCCCCCCCCC 0MIFLIVV(0 FVEOIZEPZIW
8]TI CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC G]PMRHIVMRPMRI 8VERWQMWWMSR CCCCCCCCCCCCCCCCCCCC 0MIFLIVVGSQTEGXTPERIXEV]VIHYGXMSRKIEV
&SVI7XVSOI CCCCCCCCCCCCCCCC QQ 7[MRKVMRK CCCCCCCCCCCCCCCCCCCCCC 0MIFLIVVWIEPIHWMRKPIVEGIFEPPFIEVMRK
(MWTPEGIQIRX CCCCCCCCCCCC P W[MRKVMRKMRXIVREPXIIXL
)RKMRISTIVEXMSR CCCCCCCCCCCCCC WXVSOIHMIWIP 7[MRKWTIIH CCCCCCCCCCCCCCCCCCCC § 641WXITPIWW
YRMXTYQTW]WXIQ 7[MRKXSVUYI CCCCCCCCCCCCCCCCCC O2Q
XYVFSGLEVKIHERHEJXIVGSSPIH ,SPHMRKFVEOI CCCCCCCCCCCCCCCCCC [IXQYPXMHMWGWTVMRKETTPMIHTVIWWYVI
VIHYGIHIQMWWMSRW VIPIEWIH
'SSPMRK CCCCCCCCCCCCCCCCCCCCCCCCCC [EXIVGSSPIHERHMRXIKVEXIHQSXSVSMP 3TXMSR CCCCCCCCCCCCCCCCCCCCCCCCCCCC TIHEPGSRXVSPPIHTSWMXMSRMRKFVEOI
GSSPIV
%MVGPIERIV CCCCCCCCCCCCCCCCCCCCCC HV]X]TIEMVGPIERIV[MXLTVIGPIERIV
TVMQEV]ERHWEJIX]IPIQIRXWEYXSQEXMG
HYWXHMWGLEVKI 3TIVEXSV¬W'EF
*YIPXERO CCCCCCCCCCCCCCCCCCCCCCCC P
7XERHEVH CCCCCCCCCCCCCCCCCCCCCCCC WIRWSVGSRXVSPPIHIRKMRIMHPMRK 'EF CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC VIWMPMIRXP]QSYRXIHWSYRHMRWYPEXIHXMRXIH
)PIGXVMGEPW]WXIQ [MRHS[WJVSRX[MRHS[WXSVIWSZIVLIEH
:SPXEKI CCCCCCCCCCCCCCCCCCCCCC : HSSV[MXLWPMHMRK[MRHS[
&EXXIVMIW CCCCCCCCCCCCCCCCCCCC \%L: 3TIVEXSV¬WWIEX CCCCCCCCCCCCCCCC JYPP]EHNYWXEFPIWLSGOEFWSVFMRKWYWTIR
7XEVXIV CCCCCCCCCCCCCCCCCCCCCC :O; WMSREHNYWXEFPIXSSTIVEXSV¬W[IMKLXERH
%PXIVREXSV CCCCCCCCCCCCCCCCCC XLVIITLEWIGYVVIRX:% WMÎ[E]EHNYWXEFPI0MIFLIVVWIEX
.S]WXMGOW CCCCCCCCCCCCCCCCCCCCCCCC MRXIKVEXIHMRXSEHNYWXEFPIGSRWSPIW
1SRMXSVMRK CCCCCCCCCCCCCCCCCCCCCC QIRYHVMZIRUYIV]SJGYVVIRXSTIVEXMRK
GSRHMXMSRWZMEXLI0'(HMWTPE]%YXSQEXMG
,]HVEYPMG7]WXIQ QSRMXSVMRKHMWTPE][EVRMRKEGSYWXMGEP
ERHSTXMGEPWMKREP ERHWEZMRKQEGLMRI
,]HVEYPMGTYQT HEXEJSVI\EQTPIIRKMRISZIVLIEXMRKPS[
JSVEXXEGLQIRXERH IRKMRISMPTVIWWYVISVPS[L]HVEYPMGSMPPIZIP
XVEZIPHVMZI CCCCCCCCCCCCCCCC X[S0MIFLIVVZEVMEFPIJPS[W[EWLTPEXI %MVGSRHMXMSRMRK CCCCCCCCCCCCCCCC WXERHEVHEMVGSRHMXMSRMRKGSQFMRIH
TYQTW GSSPIVLIEXIVEHHMXMSREPHYWXJMPXIVMRJVIWL
1E\JPS[ CCCCCCCCCCCCCCCCCC \PQMR EMVVIGMVGYPEXIH
1E\TVIWWYVI CCCCCCCCCCCC FEV
4YQTVIKYPEXMSR CCCCCCCCCCCCCC IPIGXVSL]HVEYPMG[MXLIPIGXVSRMGIRKMRI
WTIIHWIRWMRKVIKYPEXMSRTVIWWYVIGSQ
TIRWEXMSRJPS[GSQTIRWEXMSREYXSQEXMG 9RHIVGEVVMEKI
SMPJPS[STXMQMÎV
,]HVEYPMGTYQT :IVWMSR,( CCCCCCCCCCCCCCCCCCCCCC LIEZ]HYX]
JSVW[MRKHVMZI CCCCCCCCCCCC VIZIVWMFPIZEVMEFPIJPS[W[EWLTPEXITYQT (VMZI CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC 0MIFLIVVW[EWLTPEXIQSXSVW[MXLMRXIKVE
GPSWIHPSSTGMVGYMX XIHFVEOIZEPZIWSRFSXLWMHIW
1E\JPS[ CCCCCCCCCCCCCCCCCC PQMR 8VERWQMWWMSR CCCCCCCCCCCCCCCCCCCC 0MIFLIVVTPERIXEV]VIHYGXMSRKIEVW
1E\TVIWWYVI CCCCCCCCCCCC FEV 8VEZIPWTIIH CCCCCCCCCCCCCCCCCCCC PS[VERKI § OQL
,]HVEYPMGXERO CCCCCCCCCCCCCCCCCC P LMKLVERKI § OQL
,]HVEYPMGW]WXIQ CCCCCCCCCCCCCC P (VE[FEVTYPPQE\ CCCCCCCCCCCC O2
,]HVEYPMGSMPJMPXIV CCCCCCCCCCCCCC JYPPJPS[JMPXIVWMRVIXYVRPMRI[MXLMRXI 8VEGOGSQTSRIRXW CCCCCCCCCCCC (+QEMRXIRERGIJVII
KVEXIHJMRIJMPXIVEVIEQ LMKLTVIW 8VEGOVSPPIVW
WYVIJMPXIVJSVIEGLQEMRTYQT 'EVVMIVVSPPIVW CCCCCCCCCCCCCCCCCC
,]HVEYPMGSMPGSSPIV CCCCCCCCCC GSSPIVYRMXGSRWMWXMRKSJVEHMEXSVJSVIRKMRI 8VEGOW CCCCCCCCCCCCCCCCCCCCCCCCCCCC WIEPIHERHKVIEWIH
GSSPERX[MXLEJXIVGSSPIVGSVIWERH[MGLIH 8VEGOTEHW CCCCCCCCCCCCCCCCCCCCCC XVMTPIKVSYWIV
[MXLGSSPIVJSVL]HVEYPMGJPYMH[MXLL]HVS (MKKMRKPSGOW CCCCCCCCCCCCCCCCCC [IXQYPXMHMWGWWTVMRKETTPMIHTVIWWYVI
WXEXMGEPP]GSRXVSPPIHJERHVMZIW VIPIEWIH
13()WIPIGXMSR CCCCCCCCCCCCCC EHNYWXQIRXSJQEGLMRITIVJSVQERGIERH
XLIL]HVEYPMGWZMEEQSHIWIPIGXSVXS
QEXGLETTPMGEXMSR
)'3 CCCCCCCCCCCCCCCCCCCCCCCCCC JSVIWTIGMEPP]IGSRSQMGEPERHIRZMVSR %XXEGLQIRX
QIRXEPP]JVMIRHP]STIVEXMSR
43;)6 CCCCCCCCCCCCCCCCCCCC JSVQE\MQYQHMKKMRKTS[IVERHLIEZ] 8]TI CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC GSQFMREXMSRSJVIWMWXERXWXIIPTPEXIWERH
HYX]NSFW GEWXWXIIPGSQTSRIRXW
0-*8 CCCCCCCCCCCCCCCCCCCCCCCCCC JSVPMJXMRK ,]HVEYPMGG]PMRHIVW CCCCCCCCCC 0MIFLIVVG]PMRHIVW[MXLWTIGMEPWIEPW]WXIQ
*-2) CCCCCCCCCCCCCCCCCCCCCCCC JSVTVIGMWMSR[SVOERHPMJXMRKXLVSYKLZIV] WLSGOEFWSVFIH
WIRWMXMZIQSZIQIRXW 4MZSXW CCCCCCCCCCCCCCCCCCCCCCCCCCCC WIEPIHPS[QEMRXIRERGI
641EHNYWXQIRX CCCCCCCCCCCC WXITPIWWEHNYWXQIRXSJIRKMRISYXTYXZME 0YFVMGEXMSR CCCCCCCCCCCCCCCCCCCCCC IEWMP]EGGIWWMFPIGIRXVEPMÎHPYFVMGEXMSR
XLIVTQEXIEGLWIPIGXIHQSHI ,]HVEYPMGGSRRIGXMSRW CCCCCC TMTIWERHLSWIWIUYMTTIH[MXL7%)WTPMX
JPERKIGSRRIGXMSRW
&YGOIX CCCCCCCCCCCCCCCCCCCCCCCCCCCC WXERHEVHIUYMTTIH[MXLXPMJXMRKI]I
,]HVEYPMG'SRXVSPW
4S[IVHMWXVMFYXMSR ZMEGSRXVSPZEPZIWMRWMRKPIFPSGO[MXLMRXI
CCCCCCCCCCCC
KVEXIHWEJIX]ZEPZIW
*PS[WYQQEXMSR CCCCCCCC XSFSSQERHWXMGO
'PSWIHPSSTGMVGYMX CCCC JSVYTTIVGEVVMEKIW[MRKHVMZI
7IVZSGMVGYMX
%XXEGLQIRXERH
W[MRK CCCCCCCCCCCCCCCCCCCCCCCC §TVSTSVXMSREPZMENS]WXMGOPIZIVW
8VEZIP CCCCCCCCCCCCCCCCCCCCCCCC §TVSTSVXMSREPZMEJSSXTIHEPWSVVIQSZEFPI
LERHPIZIVW
%HHMXMSREPJYRGXMSRW CCCCCCCCCC ZMEJSSXTIHEPWSVNS]WXMGOXSKKPIW[MXGL
8(6'0MXVSRMG https://www.truck-manuals.net/
(MQIRWMSRW
) %
(
; '
,
/ 4
5
0 2
9 7
> &
: +
<
QQ 7XMGO +SSWIRIGO&SSQQ
% 0IRKXL
% Q QQ
' :
(
)
, ;
/
0
4 <
5
7
9
[MXLSYXFYGOIX
>
2
&
+
[MXLSYXKVMT
https://www.truck-manuals.net/ 8(6'0MXVSRMG
&EGOLSI%XXEGLQIRX
[MXL+SSWIRIGO&SSQQ
JX Q

(MKKMRK)RZIPSTI
7XMGOPIRKXLW Q

1E\HMKKMRKHITXL Q

1E\VIEGLEXKVSYRHPIZIP Q
1E\HYQTLIMKLX Q

1E\XIIXLLIMKLX Q

(MKKMRKJSVGI-73 O2
X

&VIEOSYXJSVGI-73 O2
X

3TIVEXMRK;IMKLX
ERH+VSYRH4VIWWYVI

3TIVEXMRK[IMKLXMRGPYHIWFEWMGQEGLMRI[MXLKSSWIRIGOFSSQ
QWXMGOQERHFYGOIXQ

9RHIVGEVVMEKI ,(

4EH[MHXL QQ

;IMKLX OK

+VSYRHTVIWWYVI OKGQ
3TXMSREPLIEZ]HYX]GSYRXIV[IMKLX

Q
,IEZ]HYX]GSYRXIV[IMKLXMRGVIEWIWXLISTIVEXMRK[IMKLXF]OK
ERHKVSYRHTVIWWYVIF]OKGQ
JX
&YGOIXW
'YXXMRK[MHXL QQ
'ETEGMX]-73 Q
;IMKLX OK
7YMXEFPIJSVQEXIVMEPYTXSEWTIGMJMG[IMKLXSJ
[MXLWXMGOQ XQ § §
[MXLWXMGOQ XQ
[MXLWXMGOQ XQ § §
1IHMYQHYX]FYGOIX[MXL0MIFLIVVXIIXLWMÎETTVSTVMEXIJSVQEXIVMEPWYTXSGPEWWMJMGEXMSREGGSVHMRKXS:3&7IGXMSR'(-2
,IEZ]HYX]VSGOFYGOIX[MXL)WGSXIIXLWMÎETTVSTVMEXIJSVQEXIVMEPWEFSZIGPEWWMJMGEXMSREGGSVHMRKXS:3&7IGXMSR'(-2
0MJX'ETEGMXMIW
[MXL+SSWIRIGO&SSQQ
7XMGOQ 7XMGOQ

,( ,(
,( ,(
,( ,(
,( ,(
,( ,(
,( ,(
§ ,( § ,(
§ ,( § ,(
§ ,( § ,(
§ ,( § ,(
7XMGOQ

,(
,(
,(
,(
,(
,(
§ ,(
§ ,(
§ ,(
§ ,(
8LIPSEHZEPYIWEVIUYSXIHMRXSRWX SRXLIFEGOLSIFYGOIX¬WPSEHLSSOERHQE]FIW[YRK SRJMVQERHIZIRKVSYRH:EPYIWUYSXIHMR

FVEGOIXWETTP]XSXLIYRHIVGEVVMEKI[LIRMRPSRKMXYHMREPTSWMXMSR'ETEGMXMIWEVIZEPMHJSVQQ[MHIXVMTPIKVSYWIVTEHW-RHMGEXIHPSEHWEVI
FEWIHSR-73WXERHEVHERHHSRSXI\GIIH SJXMTTMRKSV SJL]HVEYPMGGETEGMX]MRHMGEXIHZME 1E\MQYQPSEHJSVXLIFEGOLSI
FYGOIX¬WPMJXMRKI]IMWX;MXLSYXFYGOIXQ XLIPMJXGETEGMXMIW[MPPMRGVIEWIF]OK[MXLSYXFYGOIXG]PMRHIVPMROERHPIZIVXLI]MRGVIEWI
F]EREHHMXMSREPOK0MJXMRKGETEGMX]SJXLII\GEZEXSVMWPMQMXIHF]QEGLMRIWXEFMPMX]L]HVEYPMGGETEGMX]ERHQE\MQYQTIVQMWWMFPIPSEHSJXLI
PSEHLSSO
;LIRPMJXMRKPSEHWXLIL]HVEYPMGI\GEZEXSVQYWXFIIUYMTTIH[MXLEYXSQEXMGGLIGOZEPZISRMXWLSMWXG]PMRHIVWERHSZIVPSEH[EVRMRKHIZMGI
EGGSVHMRKXS)YVSTIER7XERHEVH)2
0MJX'ETEGMXMIW
[MXL+SSWIRIGO&SSQQERH,IEZ]'SYRXIV[IMKLX
7XMGOQ 7XMGOQ

,( ,(
,( ,(
,( ,(
,( ,(
,( ,(
,( ,(
§ ,( § ,(
§ ,( § ,(
§ ,( § ,(
§ ,( § ,(
7XMGOQ

,(
,(
,(
,(
,(
,(
§ ,(
§ ,(
§ ,(
§ ,(
8LIPSEHZEPYIWEVIUYSXIHMRXSRWX SRXLIFEGOLSIFYGOIX¬WPSEHLSSOERHQE]FIW[YRK SRJMVQERHIZIRKVSYRH:EPYIWUYSXIHMR

FVEGOIXWETTP]XSXLIYRHIVGEVVMEKI[LIRMRPSRKMXYHMREPTSWMXMSR'ETEGMXMIWEVIZEPMHJSVQQ[MHIXVMTPIKVSYWIVTEHW-RHMGEXIHPSEHWEVI
FEWIHSR-73WXERHEVHERHHSRSXI\GIIH SJXMTTMRKSV SJL]HVEYPMGGETEGMX]MRHMGEXIHZME 1E\MQYQPSEHJSVXLIFEGOLSI
FYGOIX¬WPMJXMRKI]IMWX;MXLSYXFYGOIXQ XLIPMJXGETEGMXMIW[MPPMRGVIEWIF]OK[MXLSYXFYGOIXG]PMRHIVPMROERHPIZIVXLI]MRGVIEWI
F]EREHHMXMSREPOK0MJXMRKGETEGMX]SJXLII\GEZEXSVMWPMQMXIHF]QEGLMRIWXEFMPMX]L]HVEYPMGGETEGMX]ERHQE\MQYQTIVQMWWMFPIPSEHSJXLI
PSEHLSSO
;LIRPMJXMRKPSEHWXLIL]HVEYPMGI\GEZEXSVQYWXFIIUYMTTIH[MXLEYXSQEXMGGLIGOZEPZISRMXWLSMWXG]PMRHIVWERHSZIVPSEH[EVRMRKHIZMGI
EGGSVHMRKXS)YVSTIER7XERHEVH)2
)UYMTQIRX
9RHIVGEVVMEKI 7 3 3TIVEXSV¬W'EF 7 3
8[SWXEKIXVEZIPQSXSVW %PPXMRXIH[MRHS[W
8LVIIXVEGOKYMHITIVXVEGO 6SSJLEXGL
0MJIXMQIPYFVMGEXIHXVEGOVSPPIVW (SSV[MXLWPMHMRK[MRHS[
,]HVEYPMGLSWITVSXIGXMSR 6EMRLSSHSZIVJVSRX[MRHS[STIRMRK
-HPIVTVSXIGXMSR ;MTIV[EWLIV
8VEGOWWIEPIHERHKVIEWIH [E]EHNYWXEFPIWIEX
(MJJIVIRXYRHIVGEVVMEKIZIVWMSRW 7IEXERHGSRWSPIWMRHITIRHIRXP]EHNYWXEFPI
(MJJIVIRXXVEGOTEH[MHXL 7XSVEKIXVE]
*SYVXVEGOKYMHI (SQIPMKLX
6IRJSVGIHGSZIV -RWMHIVIEVQMVVSV
7XVIRKFSXXSQWLIIXGIRXIVTEVX 'PSXLLSSO
'MKEVIXXIPMKLXIVERHEWLXVE]
(MWTPE]WJSVIRKMRISTIVEXMRKGSRHMXMSR
1IGLERMGEPLSYVQIXIVWVIEHEFPIJVSQSYXWMHIXLIGEF
7YRVSPPIVFPMRH
9TTIVGEVVMEKI 7 3 6IQSZEFPIGYWXSQMÎHJSSXQEX
)RKMRILSSH[MXLPMJXLIPT %MVGSRHMXMSRMRK
0SGOEFPIXSSPFS\ 'EFLIEXIV[MXLHIJVSWXIV
,ERHVEMPWRSRWPMTWYVJEGIW %Y\MPMEV]LIEXMRK
8SSPOMX %MVTVIWWYVISTIVEXSVWIEX[MXLLIEXMRKERHLIEHVIWX
1EMRXIRERGIJVIIW[MRKFVEOIPSGO 7XIVISVEHMS
1EMRXIRERGIJVII,(FEXXIVMIW 4VITEVEXMSRJSVVEHMSMRWXEPPEXMSR
7SYRHMRWYPEXMSR )PIGXVMGGSSPFS\
)PIGXVMGJYIPXEROJMPPIVTYQT &YPPIXTVSSJ[MRHS[JM\IHMRWXEPPEXMSR§GERRSXFISTIRIH
*SSXTIHEPW[MRKTSWMXMSRMRKFVEOI &IEGSR
)\XIRHIHXSSPOMX )PIGXVSRMGHVMZIE[E]PSGO
'YWXSQMÎHGSPSVW %HHMXMSREPJPSSHPMKLXW
)\XMRKYMWLIV
,]HVEYPMGW 7 3
)PIGXVSRMGTYQTVIKYPEXMSR %XXEGLQIRX 7 3
7XITPIWW[SVOQSHIWIPIGXSV ']PMRHIVW[MXLWLSGOEFWSVFIVW
4VIWWYVIWXSVEKIJSVGSRXVSPPIHPS[IVMRKSJEXXEGLQIRXW[MXL 7IEPIHTMZSXW
IRKMRIXYVRIHSJJ %YXSQEXMGPYFVMGEXMSRW]WXIQ
,]HVEYPMGXEROWLYXSJJZEPZI 7%)WTPMXJPERKIWSREPPLMKLTVIWWYVIPMRIW
4VIWWYVIGSQTIRWEXMSR XPMJXMRKI]ISRFYGOIXW
*PS[GSQTIRWEXMSR ;SVOPMKLXSRFSSQ
*MPXIV[MXLMRXIKVEXIHJMRIJMPXIVEVIEQ 3VMRKWIEPERXFIX[IIRFYGOIXERHWXMGO
4VIWWYVIXIWXTSVXW 7EJIX]GLIGOZEPZIWJSVLSMWXG]PMRHIV
%HHMXMSREPL]HVEYPMGGMVGYMXW 3ZIVPSEH[EVRMRKHIZMGI
&MSHIKVEHEFPIL]HVSMP ,]HVSVQIGLERMGEPUYMGOGLERKIGSYTPIV
*MPXIVJSVWIGSRHEV]GMVGYMX 0MIFLIVVPMRISJGPEQWERHKVETTPIW
5YMGOHMWGSRRIGXLSWIGSYTPIVW
7TIGMEPETTPMGEXMSRFYGOIXW
,]HVPMRIWSRWXMGOJSVGPEQSTIVEXMSR
8[S[E]WIPIGXSVZEPZIJSVFYGOIXGPEQ
)RKMRI 7 3 8[S[E]WIPIGXSVZEPZIWJSVFYGOIXGPEQYWI
%JXIVGSSPIH 'YWXSQMÎHGSPSVW
9RMXTYQTW]WXIQ 0MOYJM\
8YVFSGLEVKIV
(V]X]TIEMVGPIERIV[TVIGPIERIVQEMRERHWEJIX]IPIQIRX
%MVJMPXIV[MXLEYXSQEXMGHYWXINIGXSV
7IRWSVGSRXVSPPIHIRKMRIMHPMRK
)RKMRIGSPHWXEVXMRKEMH
7!7XERHEVH3!3TXMSR
3TXMSRWERHSVWTIGMEPEXXEGLQIRXWWYTTPMIHF]ZIRHSVWSXLIVXLER0MIFLIVVEVISRP]XSFIMRWXEPPIH[MXLXLI
ORS[PIHKIERHETTVSZEPSJ0MIFLIVVXSVIXEMR[EVVERX]
2.SAFETY INFORMATION
Working with an excavator can be dangerous, it could result in injury or death if proper precautions are
not taken! WE URGE YOU TO READ THIS MANUAL CAREFULLY! This safety information is
provided to operators and maintenance mechanics to ensure the safe operation and maintenance of
the excavator. It is essential that you read and familiarize yourself with this information, which
explains safety requirements and precautions and specific hazards of which you should be aware.
This also applies to any personnel which might be working on the machine only occasionally, such as
during set up or maintenance.
Careful adherence to these safety guidelines will permit safe operation and maintenance and
potentially prevent personal injury to yourself and others, and possible damage to the excavator.
Important safety notes such as DANGER, CAUTION or NOTE are used throughout this manual to
emphasize important or critical instructions.
In this manual, DANGER, CAUTION or NOTE are defined as follows :
DANGER
Denotes an extreme intrinsic hazard which could result in a high probability of death or
serious injury if proper precautions are not taken..
CAUTION
Denotes a reminder of safety practices or directs attention to unsafe practices if proper
precautions are not taken.
NOTE
NOTE describes operation and maintenance procedures which should be followed to keep your
excavator operation and to insure long machine life and/ or to facilitate certain procedures.
In addition to these instructions you must follow the safety regulations applicable to your work
environment and job site and any federal, state and local safety requirements (A model excavators
must also follow local and federal highway regulations).
For EC countries, guidelines 89 / 655 / EWG contain the minimum safety guidelines for users.
DESTINED USE
The excavator with the standard backhoe, grapple or bucket attachment may only be used to loosen,
pick up, move, load and dump soil, gravel, rock, or other material and to load trucks, barges, conveyor
belts, or rock crushing systems.
Special guidelines are applicable for machines used for lifting applications and special safety devices
must be installed (for the list of the necessary special safety devices, refer to the section "hydraulic
excavators used for lifting loads" in this manual).
Any other use above and beyond the applications described above, such as breaking out rock or
demolishing buildings, pounding in posts etc. requires special attachments and safety devices.
If the machine is exposed to the risk of falling down objects during operation, the cab of the machine
must be fitted with a safety device according to the FOPS prescriptions.
Transporting personnel or loads etc. is not considered destined use and is therefore prohibited. The
manufacturer / dealer is not responsible for any resulting damage. Any risk must be carried by the
user himself.
Destined use is considered part of observing and adhering to all regulations and inspection and
maintenance guidelines given in this Operation and Maintenance Manual.
2.1
GENERAL SAFETY INFORMATION Align the upper with the undercarriage and so
Study the Operation and Maintenance that the sprocket wheels are on the rear.
Manual before operating or working on the Place all control in neutral position and raise the
excavator. safety lever.
Make sure that you have additional information for
Turn the engine off and remove the ignition key.
special attachments of your machine, read it and
understand it! Before working on the hydraulic circuit, move all
joysticks and pedals with the ignition key in contact
Allow only authorized personnel informed position and the safety lever tilted down to relieve the
about the safety rules to operate, service or repair servo pressure and the remaining pressures in the
the excavator. Make sure to observe any minimum different main circuits. In addition, relieve the
applicable age requirement. pressure in the hydraulic tank as described in the
Allow only properly trained personnel to Operation and Maintenance Manual.
operate or work on the excavator, make sure to Secure all loose parts on the excavator.
clearly specify the person who is responsible for
set up, maintenance and repairs. Never operate the excavator without a
complete walk around inspection. Check if all warning
Make sure the operator knows his decals are on the machine and if they are all legible.
responsibility regarding the observance of traffic
regulations and permit him to refuse any unsafe Observe all danger and safety guidelines.
instructions given by a third person.
For certain special applications, the excavator
Any persons still in training should only must be equipped with specific safety equipment.
operate or work on the machine under the Use the excavator only, if they are installed and
supervision and guidance of an experienced functioning properly.
person.
Never perform any changes, additions or
Check and observe any person working or modifications on the machine, which could influence
operating the excavator periodically and regularly, the safety, without obtaining the written permission
if they observe safety instructions and guidelines from the manufacturer. This also applies to the
given in the Operation and Maintenance Manual. installation and adjustment of safety devices and
safety valves as well as to any welding on load
Wear proper work clothing when operating or carrying parts.
working on the excavator. Rings, watches, It is forbidden to repair the cab.
bracelets and loose clothing such as ties, scarves,
unbuttoned or unzipped shirts and jackets are Do not install any equipment or attachments
dangerous and could cause injury! made by other manufacturers or any which are not
Wear proper safety equipment, such as safety specifically authorized by LIEBHERR for installation
glasses, safety shoes, hard hats, work gloves, without first obtaining the written permission from
reflector vests and ear protection. LIEBHERR.
Consult your employer or supervisor for LIEBHERR will issue any required technical
specific safety equipment requirements and safety documentation for approved installations.
regulations on the job site. Should the electrical circuit be modified or
Always tilt up the safety lever before leaving additional components be installed, so the
the operators seat. modification must be performed according to the
national standards and safety regulations (such as
Do not carry tools, replacement parts or other OSHA per the USA).
supplies while climbing on or off the excavator. The installation must be certificated by an approved
Never use the steering column, control levers or organization and a copy of the certification has to be
joysticks as handholds. sent to the LIEBHERR company.
Never jump off the excavator, climb on and
off the excavator using only the steps, rails and
handles provided.
When climbing on or off the excavator, use both
hands for support and face the machine.
If needed, use the front window as an escape
hatch.
If no other guidelines are given, perform
maintenance and repairs utilizing the following
precautions :
Park excavator on firm and level ground. Rest
the attachment on the ground.
2.2
CRUSHING AND BURN PREVENTION All defects, such as loose connections, burnt out
Never work underneath the excavator unless fuses and bulbs, burnt or damaged cables must be
it is safely resting on the ground and / or is properly repaired immediately by a licensed electrician or
blocked and supported. specially trained personnel.
Never use damaged or insufficient wire Never store flammable fluids on the machine
ropes, slings or chains. Always wear gloves when except in storage tanks intended for the excavators
handling wire ropes. operation.
Never reach into bores during attachment Inspect all components, lines, tubes and hoses
installation or removal. Never align bores with your for oil and fuel leaks and / or damage.
fingers or hands. Use proper alignment tools when Replace or repair any damaged components
installing, changing or servicing attachments by immediately.
qualified mechanics Any oil, which escapes from leaks, can easily cause
a fire.
Keep objects away from the radiator fan.
Rotating fans will swirl and throw out objects, Be certain that all clamps, guards and heat
which can become very dangerous and cause shields are installed. These components prevent
severe injury to yourself and others. vibration, rubbing, chafing and heat build-up. Install
tie wraps to fasten hoses and wires, as required.
Avoid contact with any components
containing coolant. Cold start ether is extremely flammable. Do not
At or near operating temperature, the engine use together with preheat. Use ether only in
coolant is hot and under pressure and could cause ventilated areas and as directed. Never use it near
severe burns. heat sources or open flames, do not permit anybody
to smoke.
Check the coolant level only after the radiator
cap is cool enough to touch. Remove the radiator Know the location of the excavator's fire
cap slowly to relieve pressure . extinguisher and be familiar with its operation. Make
sure you know your local fire regulations and fire
Do not allow your skin to come into contact reporting procedures.
with hot oil or components containing hot oil. At or
near operating temperature, engine and hydraulic A fire extinguisher can be attached inside the
oil is hot and can be under pressure. operator's cab, using the four threaded holes
provided in the rear left support of the cab.
Always wear safety glasses and protective
gloves when handling batteries. Keep sparks or
open flames away!
Never permit anyone to hand guide the
bucket or grapple into position.
When working in the engine area, make sure
the top covers and side doors are properly secured
or closed with the appropriate supports.
Never work underneath or on the excavator
unless it is properly blocked and supported.
FIRE AND EXPLOSION PREVENTION

Always turn off the engine while refuelling the
excavator.
Never smoke or allow an open flame in
refuelling areas or where batteries are being
charged, or where batteries or flammable materials
are stored.
Never leave machine unattended while
fuelling. During this operation, no one but the
employee in charge of refuelling is allowed to stay
on the excavator.
Always start the engine as described in the
Operation and Maintenance Manual.
Check the electrical system regularly and
frequently.
2.3
MACHINE START UP SAFETY making sure it is securely fixed in this position, so it
Before excavator start up, perform a can not be slammed by the wind.
thorough walk around inspection. If the weather conditions are bad, increase
Visually inspect the excavator, look for loose your attention to realise climbing or descent from the
bolts, cracks, wear, any leaks and any evidence of cab with a maximum of precautions, and do or let do
vandalism. the preliminaries operations of preparation which are
necessary so you can move safely.
Never start or operate an unsafe excavator. With those conditions be especially vigilant.
Report all defects to your foreman or Go on climbing up, always holding yourself by
supervisor and make sure they are corrected three points, enter the cab and seat down to the seat
immediately. If applying fasten the seat belt. Unlock the door
Make sure all covers and doors are closed using the unlocking lever and close the door holding
and all warning decals are on the machine. it by the handle designed for this purpose. Only
thereafter lower the safety lever and start the
Make sure all windows, as well as inside and machine.
outside mirrors are clean, and secure all doors and
It is essential to have your seat belt fastened if
windows to prevent any unintentional movement.
you want to operate the machine with the cab door
Be certain that the area surrounding the opened.
excavator is free of other personnel, and that no Should the belt be missing on your machine, so you
one is working on or under the excavator before must compulsorily get one installed before you start
starting the engine. working with opened cab door.
Covers and boxes locks have to be unlocked, After entering the cab, adjust the operators
to facilitate the fight against fire in case of. seat and controls, the inside and outside mirror, the
armrests and fasten and adjust the seat belt. Be
Proceed with the same precaution while certain that all controls can be reached comfortably.
climbing up and down the cab, as for the ascension
of the machine All noise protection devices on the machine
must be functional during operation.
Keep ladders, footsteps, handles and
handrail in clean condition and always free them
from mud, oil, grease, ice, snow or any other
obstacles.
To guarantee an easy opening of the cab
door in all weather conditions, coat the rubber
seals around the door with silicon oil or talcum
every two months and more often if necessary.
Regularly grease the hinges and lock of the cab
door as well the fixing device of the door in
opened position.
During maintenance works, always wear safety
glasses and proper protective clothes..
To climb up or down the cab, the excavator
must be parked on firm, flat and level ground and
the uppercarriage must be swung so to align
ladders and steps on upper and undercarriage.
Face the excavator when climbing up or
down and always hold on to the machine at three
points, i. e. keep the contact with the access
components at the same time with two hands and
one foot or with one hand and the two feet.
As soon as you can reach the handle of the
door with your free hand unlock it, and keeping
yourself apart from the slewing range of the door,
open the door before climbing up any more. Some
external influences, and especially the wind, may
make the opening of the door uneasy. For this
reason, keep and guide the door all the way with
your hand and lock it in its opened position,
2.4
ENGINE START UP AND OPERATING Keep sufficient distance to electrical lines.
SAFETY When working in the vicinity of high voltage
Before start up, check if all indicator lights electrical lines, keep proper distance to assure that
and instruments are functioning properly, place all the attachment does not come close to the lines.
controls in neutral position and tilt the safety lever DANGER! You must inform yourself about safe
up. distances.
Before starting the engine, alert any nearby Preferably have the electrical lines de-energized
personnel that the excavator is being started by (and lockout / tagged out according to the
sounding the horn. regulations applicable on the job-site) each time it is
possible, and in any case if the closeness of the
Start the machine only when seated in the working area make it necessary.
operators seat, and with the seat belt fastened (if
installed). In case you do touch a high voltage line by
accident, proceed as follows:
If you have no other instructions, start the
engine as outlined in the Operation and do not leave the machine,
Maintenance Manual. move the machine, if possible, from the danger
zone until you obtain sufficient distance,
Tilt the safety lever down and check all warn any personnel in the vicinity not to come
indicators, gauges, warning devices and controls close to the excavator and not to touch it,
for their proper indication. instruct or initiate that someone turns off the
Start and operate the engine only in a well voltage.
ventilated area. If necessary, open doors and Do not leave the machine until you are
windows. absolutely sure that voltage in the line, which
Warm up the engine and hydraulic system to had been touched or damaged, has been
operating temperatures. Low engine and hydraulic turned off!
oil temperatures can cause the excavator to be Before moving the machine, make sure that the
unresponsive. attachments and equipment is secured properly to
Check that all attachment functions are avoid accidents.
operating properly. When travelling on public roads, make sure to
Move the excavator slowly into an open area observe traffic regulations, and make sure that the
and check all travel functions for their proper machine meets federal and local public highway
operation, check travel and swing brakes, the standards.
steering function as well as the turn signals and Always turn on the lights if visibility is bad or if
lights. you are still working during dusk.
MACHINE OPERATING SAFETY Never allow other personnel on the excavator.
Familiarize yourself with job site rules. Be Operate the excavator only while seated and
informed about traffic and hand signals and safety with the seat belt fastened, if installed.
signs. Ask who is responsible for signalling.
Check your surrounding for any obstacles in the Report any problems or needed repairs to your
working and movement range, check the load foreman or supervisor and make sure they are
carrying capacity of the terrain, and secure the job corrected immediately.
site to shield it from any public highway traffic.
Do not move the excavator until you are certain
Rope off the working area of the machine and
that no one is endangered by moving the excavator.
install the necessary signs to forbid any non
authorized person entering the area. On machines without negative brakes check
Always keep a safe distance from overhangs, the brake system before starting to work, as outlined
walls, drop offs, and unstable ground. in the Operation and Maintenance Manual.
Never leave the operators seat while the
Be alert of changing weather conditions, bad
machine is still moving.
or insufficient visibility and of changing ground
conditions. Never leave the machine unattended (within
view of machine), with the engine running.
Be alert for utility lines, check the location of
underground cables, gas and water lines, and When moving the excavator, keep the
work especially careful in that vicinity. If uppercarriage in lengthwise direction and keep the
necessary and/ or if required, call local load as close as possible to the ground.
authorities to mark the location, and take
precaution against contact with underground
utilities.
2.5
Prevent any working movements, which Repeated strikes against an object leads to
could tip the machine over. If the excavator begins damage to the steel structures and machine
to tip or slip on a grade, immediately lower the components.
attachment and load to the ground and turn the Please refer to your LIEBHERR dealer if
excavator facing downhill. special teeth for heavy-duty or special applications
If possible, always operate the excavator with the are required.
attachment positioned uphill or downhill, never Do not attach too large bucket or bucket with
sideways. side cutters or that are during operations with rocky
Always travel slowly on rough or slippery material. This would prolong the work cycles and
ground and on slopes, and on loose soils. may lead to damage to the bucket as well as further
Always travel downhill at permissible speed, machine components.
so you dont loose control over the machine. The With the 2x45° offset articulation, the offset
engine must run at nominal speed, use only the position may only be employed if the working tool or
foot pedals to brake and slow down the machine. the attachment does not touch the material.
Never shift during down hill travel, always shift to Operation of the offset articulation to drill into
a lower gear before travelling downhill. the material is not permitted.
Load an occupied truck only if all safety
requirements are fulfilled, notably in order to Do not lift the machine during operation. Should
protect the truck operator. this happen, lower the machine slowly back to the
ground.
For demolition work, clearing, crane
operation, etc. always use the appropriate Do not let the machine fall heavily on the
protection device designed for this specific ground and do not hold it back with the hydraulics.
application. This would damage the machine.
If operating in visually obstructed terrain or During operation with the attachment it is
whenever necessary, have another person guide forbidden to raise the machine with the dozing blade
you. Always have only one person signal you. (e.g. carving at the ceiling when tunnelling).
Allow only experienced persons to attach The hydraulic hammer must be selected with
loads or to guide operators. The guide must be particular care. When using a hydraulic hammer not
visible by the operator and / or must be in voice permitted by LIEBHERR, steel structures or the
contact with him. other machine components can become damaged.
Depending on the attachment combination, it Before beginning breaking tasks, position the
is possible for the bucket teeth to hit the cab, the machine on firm and level ground.
cab protection or the boom cylinders. Be very Use a hydraulic hammer designed exclusively
careful when the bucket teeth get in this range to for breaking stone, concrete and other breakable
prevent any damage. materials.
In case of a thunderstorm : Only operate the hydraulic hammer in the
longitudinal direction of the machine and with the
lower the attachment to the ground and if windshield closed or with a front protective grid.
possible anchor the digging tool into the soil.
Ensure during hammer operation that no
leave the cab and move away from the cylinder is entirely extended or retracted and that the
machine before the storm breaks out. stick is not in the vertical position.
Otherwise, you must stop the excavator, turn
off the radio and keep inside the closed cab In order to avoid damages to the machine, try
until the end of the storm. not to break stone or concrete while performing
retraction and extension motions of the hydraulic
Auxiliary control units can have various hammer.
functions. Always check their functions when
starting up the machine. Do not apply the hydraulic hammer
uninterrupted for more than 15 secs. at a time to the
Stop the swinging motion of the same place. Change the breaking point. Too long
uppercarriage when lowering the attachment into uninterrupted operation of the hydraulic hammer
a ditch without striking the attachment on the ditch leads to an unnecessary overheating of the
walls. hydraulic oil.
Inspect the machine for damage if the Do not use the drop force of the hydraulic
attachment has been swung into a wall or any hammer to break stone or other materials. Do not
other obstacles. move obstacles with the hydraulic hammer. Misuse
Applications in which the attachment is to be of this nature would damage both the hammer and
used to strike the material being extracted are not the machine.
permitted, even when working in a longitudinal Do not use the hydraulic hammer to lift objects.
direction.
2.6
MACHINE PARKING SAFETY Before loading, secure the uppercarriage with
Park the excavator only on firm and level the undercarriage with the lock pin (if lock pin is
ground. installed).
If it becomes necessary to park the machine on a Align the machine with the loading ramp.
grade, properly block and secure it with wedges. Attach the manual control levers to the foot
Before turning off the engine, swing the pedals for sensitive control.
uppercarriage lengthwise to the undercarriage Have another person guide and signal the
and so to have the sprocket wheels at the rear. operator.
This position ensures a secure access to all the
usual maintenance points of the uppercarriage. Have blocks or wedges ready to block the
machine, if necessary, to prevent the machine from
Lower the attachments to the ground and rolling backwards. Be careful to crushing risks when
anchor the bucket lightly in the ground. handling and applying these wedges. Keep clear of
Bring all operating levers in neutral position wheels and do not attempt to chock or block the
and engage the travel and swing brakes. machine before its complete standstill.
Turn the engine off as outlined in the Retract the attachment as far as possible and
Operation and Maintenance Manual and raise lower the attachment as close as possible to the
the safety lever before you leave the operator's loading surface and carefully drive up the ramp and
seat. onto the flat bed trailer.
Proceed with the same precaution while When the excavator is on the trailer, release
climbing up and down the cab, as for the ascension the uppercarriage lock pin, turn the uppercarriage
of the machine back and lower the attachment.
If the backhoe attachment is attached, tilt the stick
Then open the cab door and lock it in and bucket in and relock the uppercarriage (if lock
opened position and make sure it is securely fixed pin is installed).
in this position.
Be aware of difficult weather conditions and Carefully secure the uppercarriage and other
anticipate their possible consequences. The wind parts with chains, wedges and blocks to prevent
for example could slam the cab door. If necessary slipping.
unfasten the seat belt. Release the hydraulic pressure, remove the
ignition key, raise the safety lever, close and lock
Carefully begin climbing down, facing the
the cab and close and secure all other doors and
machine and always holding the contact at three
leave the machine.
points, keeping the contact with the access
components at the same time with two hands and Carefully check out the transport route. Make
one foot or with one hand and the two feet, until sure that width, height and weight allowances are
you reach the height where you can close the cab within the permitted limits.
door in the best conditions, keeping yourself apart Check that there is enough clearance
from its slewing range. Unlock the door using the underneath all bridges, underpasses, utility lines,
unlocking lever designed for this purpose and and in tunnels.
close the door guiding it by the handle. During the unloading procedure, proceed with
If you want so lock the door and take away the the same care and caution as during the loading
key. procedure. Remove all chains and wedges. Start
Slowly and carefully go down to the floor. the engine as outlined in the Operation and
Lock the cab, covers and boxes, remove all Maintenance Manual. Carefully drive off the loading
keys and secure the excavator against vandalism, platform. Keep the attachment as close as possible
unauthorized use, and any attractive nuisance. to the ground level. Have another person guide and
signal you.
MACHINE TRANSPORTING SAFETY
Use only suitable transporting and lifting
devices with sufficient capacity.
Park the machine on firm and level ground
and block the chains or wheels.
If necessary, remove part of the attachments
during transport.
When loading the machine on a flatbed trailer
or railroad car, be sure that the loading ramp
incline is less than 30° and covered with wooden
planks to prevent skidding.
Remove all mud, snow or ice from track
components before moving up the ramp.
2.7
MACHINE TOWING SAFETY be performed with a hard hat, safety shoes, safety
Observe the correct procedure: check the glasses and gloves.
index in your Operation and Maintenance manual During maintenance, do not allow unauthorized
and refer to the appropriate section : Towing the personnel to enter the maintenance area.
Excavator.
Secure the maintenance area, as necessary.
Only tow the excavator if absolutely
necessary, for example to remove it for repairs Inform the operator before any special or
from a dangerous job site. maintenance work. Make sure he knows the
person, who is in charge of the work.
Be sure all towing and pulling devices such
as cables, hooks, and couplers are safe and If not otherwise noted in the Operation and
adequate. Maintenance Manual, always make sure the
excavator is parked on firm an level ground and the
Make sure that the cable or the towing rod engine is turned off.
are strong enough and are routed around the
centre of the undercarriage or to the towing hook Swing the uppercarriage lengthwise to the
on the undercarriage, which is designated for this undercarriage and with the sprocket wheels at the
purpose. Be aware that any damage to the rear so to have a secure access to the locations for
machine caused by towing is never covered by the usual maintenance works on the uppercarriage
the manufacturer's warranty. (engine compartment, tanks, ).
On some models, all ladders and steps are aligned
Never allow anyone to stand near the cable on upper and undercarriage only in this position.
when pulling or towing the excavator.
During maintenance and service work, make
Keep the cable tight and free of kinks. sure you always retighten any loosened screw
Engage travel slowly, and do not jerk. With a connections!
slack cable, the sudden impact of the load being If it is necessary to disconnect or remove any
towed could snap and break. safety devices during set up, maintenance or repair,
Keep personnel out of area. If cable breaks make sure that after completion of repairs, the
while under stress, it could cause severe injury. safety devices are reinstalled and checked for
proper function.
During the towing procedure, keep within the
required transport position, permissible speed Before any maintenance work and especially
and distance. when working under the machine, make sure a Do
not operate tag is attached to the starter switch.
After the towing procedure is completed,
Remove the ignition key.
return the machine to its previous state.
After end of maintenance works or repair, restart
Proceed as outlined in the Operation and the machine according to the instructions "Machine
Maintenance Manual when putting the excavator start up", in this manual.
back in service.
Before any repairs or maintenance work, clean
any oil, fuel and / or cleaning substances from any
MACHINE MAINTENANCE SAFETY fittings and connections .
The machine may not be made unsafe when Dont use any harsh cleaners and use only lint free
performing maintenance work. Never attempt cloths.
maintenance procedures or repairs you do not Use only non-flammable cleaning fluids to clean
understand. the machine.
Check the Operators and Maintenance Any welding, torch or grinding work on the
Manual for service and maintenance intervals. machine must be explicitly authorized. Written
Make sure you use only appropriate tools for all authorization is necessary for welding on carrying
maintenance work. structures. Before any using a welder, torch or
Refer to your Operators and Maintenance grinder, clean off any dust and dirt and remove any
Manual to see, who is authorized to perform flammable materials from the surrounding area.
certain repairs. The operator should only perform Make sure the area is sufficiently ventilated.
the daily / weekly maintenance procedures. Danger of Fire and Explosion!
The remaining work may only be performed by Before cleaning the machine with water or
especially trained personnel. steam (high pressure cleaning) or other cleaning
fluids, make sure that all openings, which , for
Use only replacement parts corresponding to safety and/ or functioning reasons should not be
the technical requirements specified by the exposed to water / steam/ cleaners, are covered
manufacturer. This is assured by using only and / or masked off. Especially sensitive are
original Liebherr replacement parts. electrical motors, control boxes and plug
Always wear proper work clothing when connectors.
maintaining the excavator. Certain work may only
2.8
Make sure that the temperature sensors of the operator and / or must be in direct voice contact
the fire alarm and extinguishers system do not with the operator.
come in contact with the hot cleaning fluids, which When working overhead, use appropriate and
could trigger the fire extinguishing system. safe ladders, scaffolding or other working platforms
Remove all coverings and masking material after designated for that purpose.
completing the cleaning procedure. Never step on parts or components on the machine
Then check all fuel lines, engine oil lines and when maintaining or repairing items overhead.
hydraulic oil lines for leaks, loose connections, When working high above ground, make sure you
chafing and / or damage. are fitted with ropes and appropriate safety devices
Fix any problems immediately. which will prevent a possible fall.
Always keep handles, steps, railings, platforms and
If you use a high pressure cleaner with ladders free of dirt, snow and ice!
steam or hot water to clean the machine, observe
following recommendations : When working on the attachments, for example
the distance between the nozzle and the when replacing the bucket teeth, makes sure the
surface to be cleaned must be no lower than attachment is supported properly. Never use metal
20 inches on metal support!
the water temperature should not exceed 60°c
For safety reasons, never open and remove a
(140°F)
track chain unless having previously totally released
limit the water pressure to 80 bar maximum the pretension of the chain tensioning unit.
(11500 PSI)
if you employ cleaning fluid, only use neutral Never work underneath the machine if it is
cleaning agents such as customary car raised or propped up with the attachment. The
shampoos diluted to 2 or 3 percent maximum undercarriage must be supported with wooden
blocks and supports.
Never employ high pressure cleaning
apparatus during the two first months following Always support the raised machine in such a
machine delivery or repainting. way that any shifting to the weight change will not
influence the stability. Do not support the machine
Observe all product safety guidelines when with metal on metal support.
handling oils, grease, and other chemical
substances. Only qualified, especially trained personnel may
work on travel gear, brake and steering systems.
Make sure service fluids and replacement
parts are disposed of properly and in an environ- If it becomes necessary that the machine must
mentally sound manner. be repaired on a grade, block the chains with
wedges and secure the uppercarriage to the
When using hot service fluids, be very undercarriage with the lock pin.
careful. (They can cause severe burns and
injury!). Only qualified, especially trained personnel may
work on the hydraulic system.
Operate combustion motors and fuel
operated heaters only in well ventilated areas. Never check for leaks with your bare hands,
Before operating these units, check ventilation. always wear gloves. Fluid escaping from a small
In addition, always follow applicable local hole can have enough force to penetrate the skin.
regulations.
Never loosen or remove lines or fittings before
Never try to lift heavy parts. Use appropriate the attachment has been lowered to the ground and
lifting devices with sufficient load carrying the engine has been turned off. Then turn the
capacity. When replacing or repairing parts or ignition key to contact position with tilted down
components, make sure they are mounted very safety lever, move all servo controls (joysticks and
carefully on lifting devices, to prevent any foot pedals) in both direction to release pressures.
possible danger. Use only suitable and Then release the tank pressure as outlined in this
technically sound lifting devices, make sure that Operation and Maintenance Manual.
lifting tackle, wire cables, etc. has adequate load
Always disconnect the battery cable before
carrying capacity.
working on the electrical system or before any arc
Never position yourself, walk or work underneath
welding on the machine. Always disconnect the
suspended loads.
negative (-) cable first and reconnect it last.
Never use damaged lifting devices, or
devices which are not sufficient to carry the load.
Always wear gloves when handling wire cables.
Ask only experienced personnel to attach
loads and guide and signal the crane operator.
The guide must be within the visibility range of
2.9
Check the electrical system regularly. frequencies, multi shift or around the clock
Make sure that any problems, such as loose operations).
connections, burnt out fuses and bulbs, scorched Hoses and lines must be replaced if any of the
or chafed cables are fixed immediately by an following points are found during an inspection (see
electrician or qualified personnel. guidelines ISO 8331):
Use only Original fuses with the specified Damage on the external layer into the inner
amperage. Never use a different size or stronger layer (such as chaffing, cuts and rips);
fuse than the original fuse. Brittleness of the outer layer (crack formation of
the hose material);
On machines with electrical medium or high Changes in shape, which differ from the natural
voltage systems: shape of the hose or line, when under pressure
If there is any problem with the electrical or when not under pressure, or in bends or
energy supply, turn the machine off curves, such as separation of layers, blister or
immediately. bubble formation, crushing or pliers.
Follow established lockout / tag out Leaks;
procedures where applicable. Non observance of installation requirements;
Any work on the electrical system may only Damage or deformation of hose fittings, which
be performed by a qualified electrician or might reduce the strength of the fitting or the
qualified personnel under the guidance and connection between hose and fitting;
supervision of an electrician, according to Any movement of hose away from the fitting;
electro - technical regulations. Corrosion on fittings, which might reduce the
If any work is required on any parts which function or the strength of the fitting;
carry current, use a second person to turn off the When replacing hoses or lines, always use Original
main battery switch, if necessary. Rope the work replacement parts.
area off with a safety rope or chain, and set up Route or install the hoses and lines properly.
warning signs. Use only insulated tools. Do not mix up the connections!
When working on medium and high voltage Always take care to avoid torsional strain when
components, shut off the voltage and connect the installing a new hose. On high pressure hydraulic
supply cable to the ground and ground the hoses, the mounting screws must be first mounted
components, such as the condenser, with a on both hose ends (full flange or half clamp) and
grounding rod. tightened only thereafter.
Check all disconnected parts if they are truly On high pressure hoses having one curved end,
free of current, ground them and close them off always tighten first the screws on the curved hose
quickly. Insulate any close-by, current carrying end and only then the screws on the straight hose
parts. end.
Install and tighten the hose clips that may be
HYDRAULIC LINES AND HOSES mounted on the hose middle only when the both
Hydraulic lines and hoses may never be hose ends are already tightened.
repaired! Always install hoses so to avoid any friction
All hoses, lines and fittings must be checked with other hoses and parts.
daily, but at least every 2 weeks for leaks and any We recommend to keep a distance between hose
externally visible damage! Never check for leaks and other parts of at least one half of the hose outer
with your bare hands, use a sheet of paper or diameter. Keep a minimum gap of 1/2 inch in any
something else. Any damaged sections must be case.
replaced immediately! Escaping oil can cause After mounting a hose connecting two parts that are
injuries and fires! movable to each other, check during the return to
Even if hoses and lines are stored and used service that the hose is not rubbing in the whole
properly, they undergo a natural aging process. moving range.
For that reason, their service life is limited. Check daily that all flanges and covers are fixed
Improper storage, mechanical damage and correctly. It will prevent vibrations and damage
improper use are the most frequent causes of hose during operation.
failures. Concerning the hoses, you must follow the
safety regulations applicable to your work
environment and job site and any federal, state
and local safety requirements.
Using hoses and lines close to the limit
ranges of permitted use can shorten the service life
(for example at high temperatures, frequent
working cycles, extremely high impulse
2.10
PROTECTION AGAINST VIBRATION seat always adheres to the specifications of
the seat manufacturer.
Stress caused by vibration in mobile construction Check the maintenance condition of the machine, in
machinery is predominantly a result of the way in particular: tyre pressure, brakes, steering,
which it is operated. The following parameters mechanical connections, etc.
have a particularly significant influence:
Do not carry out steering, braking, acceleration and
Terrain conditions: Unevenness and potholes; switching, or move or load the machines working
Operational technique: Speed, steering, braking, attachment, in jerky movements.
control of the machines operating elements
during travel and during operation. Adapt the machine speed to the travel path to
reduce vibrational stress:
The machine operators themselves are largely
responsible for the actual stress caused by Reduce the speed when negotiating rough terrain;
vibration as the operators determine speed, gear Travel around obstacles and avoid very rough
transmission, manner of handling and travel terrain whenever possible.
routes.
Ensure that the terrain over which the machine is
Thus, a wide range of different forms of vibrational being driven or operated is well maintained:
stress are resulted for the same machine type.
Remove large stones and obstacles;
Vibrational stress of the machine operators body
can be reduced by noting the following Fill in ditches and holes;
recommendations: Ensure that machines are on-hand for the
Select the correct machine, equipment and preparation and upkeep of practical terrain
accessories for each respective application. conditions and that sufficient time for this work is
allowed for.
Use a machine which features a suitable seat
(thus, for earthmoving machines, e.g. hydraulic Travel over longer distances (e.g. on public roads)
excavators, a seat which complies with EN ISO with adequate (average) speed.
7096).
For machines which are used primarily for
Ensure that the seat remains in good condition travelling, use special auxiliary systems for the
and adjust the seat as follows: journeys (wherever available), allowing a vibration
1. Adjustment of the seat, and thus the reduction for this application type.
vibrations being produced from the seat, Should these auxiliary systems not be available,
should be carried out in relation to the regulate the speed so that a "vibrational build-up" of
weight and size of the operator the machine is avoided.
2. Check the vibration absorption and
adjustment mechanisms of the seat
regularly and ensure that condition of the
2.11
SIGNS ON THE HYDRAULIC EXCAVATOR
Your hydraulic excavator has several kinds of signs.
Warning Signs: Warnings on accident risks with potentially serious or fatal injuries.
Notices: Indicate specific points of control, maintenance and properties of the excavator.
Identification Tags
Contents and location are described hereafter.
Order numbers are contained in the spare parts list
2 Notice Sound Power Level L WA 7 Warning Sign Danger Zone

3 Notice External Start 10 Prohibition Sign
5 Notice Latch Points
2.14
11 Warning Sign Engine Shut Down
20 Sign Control Symbols
21 Warning Sign Attachment
22 Notice Accident Prevention
26 Lifting capacity chart
27 Notice Safety Lever
28 Lubrication Chart
29 Notice Latching and Lifting Points
30 ID Tag Hydraulic Excavator
31 Notice Safety Belt
2.15
Sign 2 Sound power level LWA
. Meaning : Indicates the sound power level of
the hydraulic excavator to the
surrounding area in dB(A).
. (*) Value as example.
Sign 3 External start

. Meaning : When jump starting the hydraulic
excavator, observe the notices in the
operating instructions precisely.
Sign 5 Latch points

. Meaning : Indicates the latch points on the
hydraulic excavator.
Sign 7 Danger zone

. Meaning : It is prohibited to be and remain in
any danger zone.
Sign 10 Prohibition sign

. Meaning : It is prohibited to enter the area
designated.
2.16
Sign 11 Engine Shut Down
Meaning: Open only when the engine is shut off!
Sign 20 Information about Control Symbols

Meaning: Schematic representation of the
correlation between the main controls in
the cab and the induced actions for the
operation of the excavator.
Sign 21 Attachment
Meaning: Attachment reaches up to the operators
cab!
Be aware of retracted attachments.
Sign 22 Accident Prevention

Meaning: When operating the hydraulic
excavator, observe the printed
prescriptions on accident prevention in
the operating instructions precisely.
Sign 27 Safety Lever

Meaning: Before leaving the operators seat, pull
the safety lever all the way up.
2.17
Sign 28 Lubrication chart
. Meaning: See the lubrication chart of the
machine on page 5.11.
Sign 29 Latch Points and Lifting Points

. Meaning: Indicates the latch points and the
stopping points for lifting on the
Sign 31 Seat Belt

. Meaning: Before beginning to work with the
machine, you must fasten the seat
belt.
ID TAGS
ID Tag 30 Hydraulic Excavator
. The ID tag contains the following information:
Type
Vehicle identification number
Authorized Total Weight
Year of manufacture
Authorized Axle Load front
Authorized Axle Load rear
Engine output
Maximum Travel Speed
2.18
3. CONTROLS AND INSTRUMENTATION
OPERATOR'S SEAT
CAUTION
Before adjusting the operator's seat and the joysticks,
make sure that the safety lever (fig. 1) is in the uppermost
position to avoid any unexpected movements of the
Your hydraulic excavator comes equipped with a standard 1

operator's seat (fig. 3) or optionally with a suspension seat
(fig. 4).
ADJUSTMENT
Adjusting the operator's seat horizontally with respect to the
2 control panels is possible after lifting lever 1 (fig. 2).
Independent of this adjustment, the entire seat including the
2 control panels can be slid horizontally after lifting lever 2.
Adjusting the seating suspension to body weight is done via
the outer ring of the rotary switch 5 (fig. 3) or via key 7 (fig.
4).
Adjusting the seat cushion angle and the seat height is done
via levers 4a and 4b (fig. 3 and 4).
By lifting lever 4a the seat cushion in back can be tilted 2
up or down.
By lifting lever 4b the seat cushion in front can be tilted
up or down.
Adjusting the angle of the back rest is done via lever 6 (fig. 3
and 4).
Lift lever 6
Move the back rest to the desired angle
Release lever 6.
Adjusting the lower back support in the back rest occurs via
keys 8 and 9 (fig. 4).
The angle of the right and left arm rests can be adjusted.
Turn the knurled screws 3 (fig. 3) beneath the arm rests in
the appropriate direction.
3
VIBRATION DAMPING
The seat mounted in the excavator corresponds to ISO 7096
standards.
When used according to the excavator's specifications, the
values of the vibration load transmitted by the operator's seat
are less than or equal to the test vibrations of the
corresponding machine type according to ISO 7096
standards. The resulting vibration acceleration values "azw",
measured according to ISO 2631, part 1, standards, meet
the demands for vibration protection of the entire body
according to EN 474-1 (acceleration "azw" between 0,5 and
2,5 m.s-2).
3.1
CONTROLS AND INSTRUMENTATION IN THE CAB
1 Safety lever- Servo control S5L Push button for rotating device left(grapple,
(NA)
2 Arm rests shear, ...), or unlocking of cylinder cut-off
3 Right joystick S5M Horn
4 Left joystick S5R Push button for rotating device right (grapple,
(NA)
5 Pedal for left travel gear shear, ...), or travel alarm on/off
6 Pedal for right travel gear S6L Push button for lifting magnet or rotating
(NA)
7 Attachment or special attachment control * device left
8 Air conditioner vent S6M Push button - reserve
15 Control units - additional attachments * (See S6R Push button travel alarm on/off or rotating
page 3.26) device right (NA)
17 Control unit - air conditioner S55 Switch unlocking of cylinder cut-off or lifting
(NA)
A3 Radio * magnet
H1 Monitoring display S57 Switch for swing brake control
H10 Buzzer S71 Switch for Diesel engine emergency start
H60 Warning light / error with Diesel engine in S72 RPM adjustment during emergency operation
emergency operation S73 Switch / Safety mode of the servo circuits
P5 Hourmeter
S1 Ignition key * Optional equipment
(NA)
S2 Switching unit This location only for North America
3.2
Safety lever - Servo control 1
For safety reasons, a safety lever is installed on the left
console. The operator must move this lever up before
leaving the operators seat.
The operator may only push the lever down when he is again
seated in the operators seat, ready to work.
When the safety lever is up, the servo pressure supply is
interrupted, and no working movements are possible if the
joysticks are accidentally actuated.
At the same time the swing brake apply and can no longer
be released via the button S17.
9
When pushing the safety lever down, the brakes recover the
previous state (applied or released) before the lever had
been pulled up.
Buzzer H10
During operation, the buzzer H10 sounds to alert the
operator, in case of upcoming of an operating fault as:
a low pressure of the engine lubrication oil,
a low level of the engine coolant,
a low hydraulic oil level,
a charge air overheating,
an engine coolant overheating,
In case such an error is detected, a corresponding warning
10
symbol will be displayed on the screen.
For the possible symbols, the results of the errors and the
corrective actions to perform, see page 3.10 and following.
*CAUTION
On machines with US version, the functions of the push
buttons S5L, S5R, S6L, S6R and of the rocker switch
S55 are different from those described below, refer to
page 7.1.
Push button S6L * See on page 4.17.
Push button S6R *

11
On machines fitted with a travel alarm, each time a travel
pedal is pushed, the travel alarm will sound.
This sound can be silenced 10 seconds after travel start by
depressing the push button S6R.
Rocker switch S55 *

This rocker switch is used to unlock a cylinder end position
that has previously been pre selected via switch S54, see
also switch S54 in section "control for optional equipments.
Rocker switch S57 for swing brake control

This rocker switch controls the swing brake when the brake
is pre selected in semiautomatic operating mode via the
push button S17 (see on page 4.12).
12
Switches S71, S72 and S73, see on page 3.24.
3.3
CONTROL UNIT
P4 LED indicator for engine

RPM
S10 Lights on uppercarriage and
working attachment
S11 Windshield washer
S14 Windshield wiper
S17 Swing brake
S18 Overload warning device *
S19 Rotating device*
S20 Automatic low idle
S21 Travel speed increase
S22 Auxiliary floodlights*
S36 Special function - not used -
S41 Beacon*
S56 Pressure cut-in stage
boom*
S85 Grapple operation
S86 Operation mode selection
S228 Engine RPM increase
S229 Engine RPM reduce
S354 Not used
* Optional installation
(M) The function of the push

buttons marked with (M)
are memorized when
stopping the excavator.
This means that the
controlled function recovers
the previous state (on, off,
1/2, L/H, ...) before the
machine had been turned
off
3. 4
S10 - Floodlights
Depressing the push button will successively:
- turn on the floodlights on the uppercarriage,
- turn on only the working floodlights on attachment,
- turn on all the above floodlights,
- switch off all the above floodlights.
S11 - Windshield washer

The electrical windshield washing device is activated by pushing the button S11 when the ignition is
on. The detergent is sprayed and the windshield wipers operate as long as the button is pushed.
The windshield wipers are turned off about 3 seconds after releasing the button.
S14 - Windshield wiper

Depressing the switch S14 (when the ignition is on)will successively:
1 turn on the windshield wiper in intermittent mode (the lighting diode I lights up)
2 turn on the windshield wiper in continuous (the lighting diode C lights up)
3 turn off the windshield wiper (both lighting diodes are extinguished)
Adjusting the delay time for intermittent mode via switch S14:
- Select the intermittent mode and keep the switch S14 depressed until the indicator lamp I starts
blinking rapidly.
- Release the switch as soon as the blinking duration has reached the desired interval time
(settings from 2 - 9 seconds).
S17 - Preselection of swing brake operating mode

With this button the swing brake can be switched, either in position "brake applied" or in position
"brake in semiautomatic" (see on page 4.12).
Pushing the button shifts the brake from one operating mode into the other.
With the brake applied, the red diode in the push button is on.
S18 - Overload warning device

This push button, alternately turns on and off the overload warning device. This device alerts the
operator that the authorized lift capacity of the machine has been reached. It must be turned on
before using the excavator for lifting operation.
Also refer to page 7.5 to turn on the overload warning device.
S19 - Rotating device

An additional hydraulic circuit for rotating device operation is necessary to drive some specific
equipments (such as rotating grapple, rotating bucket, rotating stick, quick change coupling, ...).
The push button S19 turns on and off the control circuit of these specific equipments.
With the control circuit turned on, the specific equipments can be actuated using the push buttons S5
on top of the left joystick handle.
When no rotating device is operated, the button S19 must be turned off.
The button S19 is operative only if the safety lever is pushed down.
S20 - Low idle automatic (see page 4.5)

Via this push button the function "low idle automatic" is turned on, resp. off (the light diode in the
button is on, resp. off).
Adjusting the time lag for low idle automatic via switch S20:
The push button S20 also serves to adjust the time lag between the return to neutral of all joysticks
and pedals and the automatic reduction to low idle of the engine RPM.
The adjustment is performed similar to the one described above for the windshield wiper pause time
via button S14.
3. 5
S21 - Travel speed increase
When the travel speed increase is turned on via S21(indicator light in the button is on) a higher travel
speed is reached, also see page 4.11.
The button is operative only if the safety lever is pushed down.
S22 - Auxiliary floodlights (Optional installation)
S36 - Special function (not used)
S41 - Beacon (Optional installation)
S56 - Pressure increase

When this function is turned on (light diode in the button is on), the forces on the working attachment
are increased, and the movements of the machine become slow at the same time (load lifting
operation,...).
S85 - Grapple operation

This button must be turned on each time when a grapple is operated.
S86 - Engine speed adjustment with mode preselection (see page 4.4 - 4.5)
The button S86 allows to preselect between four preadjusted engine RPM.
Depressing the button S86 causes to change from one mode into the next, in the order L, F, E, P, L,
... and so on.
L (Mode LIFT) = RPM stage 5
F (Mode FINE) = RPM stage 10
E (Mode ECO) = RPM stage 8
P (Mode POWER)= RPM stage 10
RPM stage 8 corresponds to the most favorable specific fuel consumption, RPM stage10 is full engine
RPM.
In mode E or P, the Diesel engine is at the nominal power corresponding to the selected RPM stage.
In the opposite, for modes L and F, the engine output is reduced by about 20%.
S228 - Engine RPM increase

See page 4.4
S229 - Engine RPM reduce

See page 4.4
S354 Special function (not used)
P4 - LED indicator for engine RPM

Via the LED bargraph indicator P4, the engine RPM is displayed.
The complete RPM range is divided into 10 stages.
3. 6
MONITORING DISPLAY
LED INDICATOR
RANGE
Monitors Diesel
engine
LCD
Matrix
indicator
LCD
SCREEN
Push buttons
for menu
control for
LCD indicator
Fig. 1
LED INDICATOR RANGE

Indicator light H2 - low engine oil pressure
If the engine oil pressure drops during operation below a preset value, which depends on the momentary
Diesel engine RPM, the indicator light H2 lights up after 2 seconds.
At the same time, the buzzer will sound to alert the operator that the oil pressure is too low.
Return the engine immediately to low idle. If the pressure remains too low for 5 other seconds, the engine
will turn off automatically, and the warning symbol E522 is displayed on the screen.
Charge indicator light H12
Indicator light H12 lights up if the starter key is moved to contact position and turns off as soon as the
engine starts. During operation, this indicator light lights up if the alternator V-belt or the electrical charge
system is defective.
Turn the engine off and correct the problem.
Engine coolant temperature gauge P2

During operation, the indication must remain in the green range.
If the engine coolant overheats (coolant is above 100°C = 212°F), the red LED indicator light 63 starts to light up
on the right end of the indicator.
Simultaneously, the buzzer will sound in the cab and the warning signal E503 will appear on the LCD screen
The engine power is reduced and the working pumps return automatically to minimum flow at the same time.
Stop working soon and keep the engine running at high idle.
If the default persists for over 60 seconds, lower the engine RPM to low idle and turn the engine off after 3 -5
minutes.
Locate the reason for the trouble and get it repaired.
3.7
Should the coolant temperature increase some more (over 104°C i. e. over 219°F) so the warning signal E523 will
appear on the display. Turn the engine off immediately in this case.
Fuel gauge P3
The LED indicator lights show the fuel level.
When the both red LED 62 light up, about 10% to 20% fuel are left in the tank as reserves.
LCD SCREEN
Adjust the contrast on the LCD screen
The contrast on the LCD monitor can be changed by simultaneously pushing the MENU key and the "UP" or
"DOWN" key. The new setting will be stored in the system.
To retrieve the original contrast setting, depress the both arrow keys "UP" and "DOWN" at the same time during
system start (when all the light diodes are on).
Adjust the background lighting on the LCD screen

The background lighting on the LCD monitor can be changed by simultaneously pushing the RETURN key and
the "UP" or "DOWN" key. The new setting will be stored in the system.
A light sensor on the upper left hand side of the display controls the LCD lighting, depending on the ambient light
conditions.
The follow up control by the light sensor is performed around the basic setting adjusted via the keys. If the ambient
light conditions are low, the background lighting will be reduced accordingly.
LCD screen control keys

The display can be controlled via 4 keys S349 "RETURN", S350 "DOWN", S351 "UP" and S352 "MENU" (see
above illustration).
These keys are used to change from the main display to the menu selection and to scroll through various other
menus.
MAIN SCREEN
The main screen appears after the unit is turned on and remains in place until the "MENU" key is pressed to
change to the menu selection.
3.8
Main screen view
SY field : The upper field of the monitor shows operating fault symbols, and also a clock, if no more than 2
warning symbols are shown.
Should more than two symbols be shown, so the clock is no more displayed and up to four symbols
can be shown at the same time in the field SY (see fig. below).
If more than 4 symbols must be shown, then every 10 seconds, the symbols move to the left by one
symbol.
The list on following pages shows all operating fault symbols which can appear in this field.
Note: The error codes corresponding to the operating faults are in the shape of "E5XX". They are
registered in the error statistics of the machine
EC field : The EC window displays any applicable error codes for any electrical errors in the excavator
electronics, (line errors, sensor errors, ...). Max. 7 error codes can be displayed at the same time . If
more than 7 errors occur, an arrow next to the error code window points to additional error codes on
the list.
Press the arrow key to move the error code window in the selected direction on the error code list.
For detailed error codes list, refer next pages.
INF field:: The INF field on the right hand side of the main
screen displays temporary information, also in graphic
form.
If more than 3 symbols must be shown, then every 10
seconds, the symbols move to the left by one symbol.
Displays are shown as graphics or text and inform
about specific operating conditions (such as actuated
flow reduction, emergency operation of Diesel engine
or hydraulic pumps, )
TI field This field, at the bottom right of the screen displays the main hour meter and the daily hour meter of
the machine.
During the display start-up phase, the operator will be alerted about a possible upcoming service
interval, by a graphic symbol. In this case the hours of this interval are displayed instead of the
machine hour meter (as an example 500 hours on fig. beside).
The recalling of upcoming service interval lights up to about 8 seconds.
The symbol is displayed when an external flow limitation is activated for the pumps.
The symbol indicates that none of the external flow limitations (i.e. I1,I2, I3 and I4) is actually
activated.
Control of the screen at error recognition:

In case a new error, displayed in field SY, is recognized, the presentation will return to main screen, and the
corresponding symbol is displayed.
Depending on the default (urgency step), the buzzer will alert acoustically at the same time, either buzzing in
continuous or emitting intermittent sounds.
The symbol signals that the buzzer of the control unit is activated. Using the key it is possible to quit
the defaults indicated by a continuous buzzing.
3.9
Symbols und error codes for operating faults
Symbol PLD Origin of

Error
code (or indicator Error- Denomination of operating faults error Sensor Results
light) code code
Buzzer H10 starts to sound after 2
Low engine lubrication oil
seconds
E 501 3031 pressure Warning stage PLD B5 ( Engine is stopped automatically
(H2) after 5 other seconds )
Buzzer H10 starts to sound.
E 502 3032 Low engine coolant level PLD B3 Engine is stopped automatically
by the BBT after 5 seconds
Engine coolant overheating Buzzer H10 starts to sound.

1st Stage Diesel power will be reduced after
E 503 3038 PLD B2 3 seconds. Working pumps return
Also indicated by to minimal flow
E 504 Low hydraulic oil level BST B14 Working pumps return to minimal
flow
E 505 Hydraulic oil overheating BST B8
E 506 Pumps splitterbox overheating BST B15
E 511 Over voltage in electrical system BBT
Low batteries voltage

E 512 PLD
Safety stage for Diesel Control
High batteries voltage

E 513 PLD
Safety stage for Diesel Control
E 517 Injectors default PLD Diesel engine stops automatically
E 518 Starting synchronisation default PLD Diesel engine stops automatically
Over speed Diesel engine

E 519 Warning stage
PLD
Overspeed of Diesel engine B12-1

E 520 3004
Safety stage
PLD Diesel engine stops automatically
B12-2
3001 Both RPM sensors of the Diesel

B12-1
E 521 + engine are simultaneously PLD Diesel engine stops automatically
3002 defective B12-2
Low engine lubrication oil Buzzer H10 starts to sound.

E 522 3041 pressure PLD B5 Engine is stopped automatically
Safety stage by the BBT after 7 seconds
Engine coolant overheating Buzzer H10 starts to sound.

E 523 3048 nd PLD B2
2 Stage (default 7 seconds)
3.10
Symbol PLD Origin of
Error
code (or indicator Error- Denomination of operating faults error Sensor Results
light) code code
Boost air overheating Buzzer H10 starts to sound.

E 524 3049
2nd Stage (default 7 seconds)
PLD B98
B2 Buzzer H57 starts to sound.

Diesel engine in emergency control and
(Depending on occurring error also
E 525 simultaneous upcoming of engine error BBT B5
buzzer H10, power reduction,
E501, E503, E597, E522, E523 or E524 B98 automatic engine stop, )
High fuel temperature

E 526 Warning stage
PLD
High fuel temperature

E 527 Safety stage
PLD
High water level in fuel filter

E 528 PLD
Upcoming simultaneous with one of the

E 530 "safety stage" errors E522, E523, E524, PLD
E527, E533, E535, E537 or E539
Low fuel pressure

E 532 Warning stage
PLD
Low fuel pressure

E 533 PLD
Safety stage
High fuel pressure

E 534 Warning stage
PLD
High fuel pressure

E 535 Safety stage
PLD
Low fuel pressure in rail 1

E 536 PLD
Warning stage

E 537 Safety stage
PLD

E 538 Warning stage e
PLD

E 539 PLD
Safety stage

Boost air overheating
E 597 3039 st PLD B98 Diesel power will be reduced after
1 Stage
3 seconds
3.11
Operating faults : error codes, possible causes and corrective action
Symbols
& Error - Detected fault Possible causes Checks to perform
codes
Low engine lubrication oil pressure- Warning Stage
Check the Diesel engine:
The oil pressure indicated by the pressure transmitter
- Lubrication oil level
B5 is below the programmed characteristic curve
- Condition of the lubrication oil pump
pressure / RPM for over 2 seconds.
E 501 - Viscosity of the lubrication oil
Check the pressure transmitter B5
Low engine lubrication oil pressure- Safety Stage Check the connection wire to the transmitter B5
The oil pressure indicated by the pressure transmitter Check the programmed characteristic curve
B5 is below the programmed characteristic curve minimum engine oil pressure / engine RPM.
E 522 pressure / RPM for over 7 seconds.
Check the engine coolant level

Find out and correct possible leakages in the engine
Low engine coolant level coolant circuit
Indicated by the level transmitter B3 Check condition of level transmitter B3 (Function,
operating level, )
E 502 Check the connection wire to the transmitter B3
Check the cooling system of the Diesel engine :

Engine coolant overheating - Temperature in cooling circuit
1st Stage (warning) - Contamination of cooler core
E 503 Indicated by the temperature transmitter B2 - Condition of the cooler fan blades
Engine coolant overheating Check the temperature transmitter B2
2nd Stage (safety) Check the connection wire to the transmitter B2
Indicated by the temperature transmitter B2 Check the programmed values for warning level
and engine stop level
E 523
Check the hydraulic oil level in the tank

Find out and correct possible leakages in the
Low oil level in hydraulic tank hydraulic circuit
Indicated by the level transmitter B14 Check condition of level transmitter B14 (Function,
operating level, )
E 504 Check the connection wire to the transmitter B14
Check the hydraulic circuit:

- Temperature of hydraulic oil .
- Contamination of hydraulic oil cooler core.
Hydraulic oil overheating
- Condition of the cooler fan blades.
Indicated by the temperature transmitter B8
Check the temperature transmitter B8 .
E 505 Check the connection wire to the transmitter B8 .
Check the programmed value for warning level.
Check the cooling circuit for the splitterbox oil:

- Temperature of splitterbox oil.
- Contamination of cooler core.
Overheating of the oil in the Pumps splitterbox
- Condition of splitterbox oil pump.
Indicated by the temperature switch B15
Check the temperature switch B15.
E 506 Check the connection wire to the switch B15.
Overvoltage in electrical system

Check the generator for good condition.
Indicated by the control unit S2
E 511
3. 12
Symbols
& Error - Detected fault Possible causes Checks to perform
codes
Check the programmed value for overspeed.
Check the programmed value for the number of
teeth of the flywheel of the Diesel engine.
Overspeed of Diesel engine Check the engine RPM adjusting system.
The overspeed is indicated simultaneously by both Check the connection wire to the actuator element
RPM sensors B12-1 and B12-2 of the injection pump.
E 520
Check the correct mounting of the actuator element
of the injection pump, if necessary replace the
actuator.
Check the correct mounting of both transmitters

Both RPM sensors of the Diesel engine are - distance between transmitter and toothing
simultaneously defective - Privileged direction of pulse transmitters.
(RPM sensors B12-1 and B12-2) Check the RPM transmitters B12-1 and B12-2.
E 521
Check the connection wires to the transmitters.

Check the cooling circuit for the boost air :
2te Stage (Safety)
- Boost air temperature
- Condition of the boost air cooler.
E 524
Check the temperature transmitter B98.
Check the connection wire to the transmitter B98 .
1st Stage (Warning)
Check the programmed values for warning level
and engine stop level.
E 597
Diesel engine in emergency control and

simultaneous upcoming of engine error E501, E503, Successively perform the corrective actions
E597, E522, E523 or E524 recommended above for the corresponding error
Recognize the active error code(s) which is (are) codes.
E 525
responsible for the upcoming of the codes E 525.
3. 13
Indicator symbols displayed in field INF
Preheat
This symbol appears as long as the preheating of the air in the intake manifold is activated (preglow
process).
End of preheat
After about 20 seconds (depending on the engine coolant temperature), the preheat action will be
stopped automatically and the symbol "end of preheat" will be displayed on the LCD screen.
Overload warning device

On machines with overload warning device: when this device is turned on via the push button S18, this
symbol appears when the load limit has been reached.
At the same time an audible signal alerts the operator to this fact.
No overload warning device recognized

This symbol appears when switching on the overload warning device via the push button S18 (see page
3.4) and if no overload warning device has been correctly installed and initialized on the machine.
Warm up procedure
This symbol shows that a warm up procedure is actually current. ( page 4.6).
Upcoming service interval

This symbol appears to alert that the working hours for the next service interval have been reached.
The symbol will go out after the corresponding service works have been carried out and confirmed using
the menu "set service" of the display (see thereafter).
Engine RPM in safety mode

The symbol informs the excavator's operator that the Diesel engine is actually operated in safety mode
and that, by the fact, the RPM can be controlled only via the safety RPM-switch, see the section
« operation in safety mode »..
Servo pressure circuit in safety mode
These symbols show that the servo pressure circuit has been turned into emergency mode, also see
the section « operation in safety mode ».
3.14
Error codes for electrical errors of the electronic control system
Error Related.
code EDC Defective component Default recognized
Errorr
E 002 Transmitter for engine oil pressure Short circuit + 24 V
E 003 Short to ground or Broken wire
E 004 Transmitter for engine coolant level Short to ground
E 005 Short circuit + 24 V
E 006 Broken wire
E 007 Transmitter for engine coolant temperature Short to ground
E 009 Broken wire
Short circuit + 24 V
E 010 Transmitter for hydraulic oil level Short to ground
E 012 Broken wire
E 013 Transmitter for hydraulic oil temperature Short to ground
E 015 Broken wire
E 016 Switch for pumps splitterbox oil temperature Short to ground
E 018 Broken wire
E 022 Signal for engine RPM between engine regulator Short to ground
E 023 and printing plate A1010 Short circuit + 24 V
E 024 Broken wire
E 027 Regulation solenoid valve -pump power control(LR) Connection wire defective
E 033 Regulation solenoid valve Cooler fan RPM Connection wire defective
E 036 Regulation solenoid valve Oil flow Pump P1 (EV1) Connection wire defective
E 039 Regulation solenoid valve Oil flow Pump P 2 (EV2) Connection wire defective
E 042 Regulation solenoid valve Reserve (EV3) Connection wire defective
E 045 Reg. solenoid valve Pressure reduction (EV6) Connection wire defective
E 063 Transmitter for boost air temperature Short to ground or Broken wire
E 070 RPM transmitter Transmitter defective

E 072 Transmitter for boost air pressure Short circuit + 24 V
E 074 Starter of Diesel engine Starting time too long
E 075 Starter defective
E 078 Regulator for Diesel engine Hardware default
E 079 Regulator for Diesel engine Software default
E 081 RPM transmitters for Diesel engine RPM transmitter B12- 1 defective
E 082 RPM transmitter B12- 2 defective
E 083 Actuator of injection pump Error in feedback of injection pump
actuator
E 084 Fuel solenoid valve Short circuit + 24 V
E 085 Short to ground
E 086 Broken wire
E 087 RPM transmitters for Diesel engine Measured RPM difference B12-1/B12-2
E 088 Ambient pressure transmitter in engine - regulator Pressure below lower fault limit
Pressure above upper fault limit
E 089 Water detector in fuel filter Connection wire defective

E 090 Fuel temperature transmitter Short to ground
E 091 Short circuit + 24 V or Broken wire
3.15
Error Related.
Errorr
E 092 Fuel pressure transmitter Short circuit + 24 V
E 094 Fuel pressure transmitter in bank 1 Short circuit + 24 V
E 096 Fuel pressure transmitter in bank 2 Short circuit + 24 V
E 098 24V Generator D+ channel of generator defective
E 099 24V Generator Generator defective
E 100 RPM transmitter 1 Signal error
E 101 RPM transmitter 2 Signal error
E 102 Synchronisation of crankshaft Signal error
E 103 RPM transmitter of camshaft Transmitter defective
E 104 RPM transmitter of camshaft Signal of transmitter not plausible
E 105 Synchronisation of camshaft Signal error
E 106 Control of cold starting device Function error
E 107 Control of cold starting device Broken wire
E 108 Control of cold starting device Short circuit + 24 V
E 109 CAN 1 Hardware error
E 110 CAN 1 Signal error
E 111 Injector A1 Injector defective
E 112 BIP / FZM error
E 119 Injector B1 Injector defective
E 127 Bank 1 Parameter error
E 128 Bank 2 Parameter error
E 129 Pressure transmitter in bank 1 Short to ground or Broken wire
E 131 Pressure transmitter in bank 1 Signal error
E 132 Pressure transmitter in bank 2 Short to ground or Broken wire
E 134 Pressure transmitter in bank 2 Signal error
E 135 5 Volt circuit REF1 Defective
3.16
Error Related.
Errorr
E 302 Coding plug Coding plug is missing
E 303 Printing plates and CAN - No CAN 1 Connection between control unit (BBT) and BSt
connections regulator circuit board (Error is detected also if BSt regulator is
not operative, as an example no voltage supply ...)
E 305 Printing plates and CAN - No CAN 2 Connection between control unit (BBT) and circuit
connections board ESP01 (Error is detected also if ESP01 is not operative,
as an example no voltage supply ...)
E 306 Printing plates and CAN - No CAN 2 Connection between control unit (BBT) and circuit
connections board ESP02 (Error is detected also if ESP02 is not operative,
as an example no voltage supply ...)
E 307 Printing plates and CAN - No CAN 1 Connection between control unit (BBT) and engine
connections control circuit PLD (U32) (Error is detected also if PLD is
not operative, as an example no voltage supply ...)
E 308 Printing plates and CAN - Default in CAN 2 Connection between control unit (BBT) and
connections display or control unit defective
E 309 Printing plates and CAN - No compatibility between control unit (BBT) and display or control
connections unit defective
E 310 Printing plates and CAN - No concordance from Hardware to Software on machine with
connections piling or drilling rig
E 319 Printing plates and CAN - Bst regulator detects a Hardware- Coding which is not compatible
connections with excavator type
E 321 Printing plates and CAN - Bst regulator receives unknown excavator type from the control
connections unit (BBT)
E 322 Printing plates and CAN - Hardware- Coding is not recognized by the Bst regulator
connections
E 442 Sensitive switch on joystick handle left Short circuit + 24 V
E 445 Sensitive switch on joystick handle right Short circuit + 24 V

E 450 Pressure transmitter in boom cylinder circuit Transmitter defective
E 454 RPM Transmitter for swing gear Short circuit + 24 V

E 456 Transmitter for fuel tank level Short to ground

E 458 Short circuit + 24 V or Broken wire
3.17
INFORMATIONS PROVIDED IN THE MENUS OF THE LCD
SCREEN
MENU SELECTION
Depressing the "MENU" key when the main screen is displayed shows the
list of the accessible menus (see fig. 1)
The current menu selection can be changed by pressing the "UP" and
"DOWN" keys (the selected menu is inverse displayed, as an example in
the figure beside the menu "reset hours" is selected).
When depressing the "MENU" key again, the inverse displayed function is
branched out.
fig. 1
MENUS IN LEVEL I - (GENERALLY ACCESSIBLE)
MENU ( "i - hours")
INFORMATION ABOUT OPERATING HOURS FOR VARIOUS

COMPONENTS AND MOVEMENTS
The Information screens 1/4 to 3/4 shows an overview about operating

hours for various components, functional flows and operating modes.
As an example, the screen 1/4 indicates the operating hours for:

fig. 2
- Diesel engine in Mode "P"
- Diesel engine in Mode "E"
- Diesel engine in Mode "F"
- Diesel engine in Mode "L"
- Diesel engine at maximum RPM
- Diesel engine at low idle
Manual operation for Diesel engine RPM control
the screen 2 / 4 the operating hours for:

- Attachment movements
- Travel movements with normal speed
- Travel movements with increased speed
fig. 3
and the screen 3 / 4 the operating hours for:
- swing movements
- the movements of the additional attachment.
The screen 4 / 4 gives following informations:

fig. 4
3. 19
- The type of the excavator
- The serial number of the excavator.The installed Software-Versions for,
respectively, the monitoring display, the control unit BBt, the pump
regulator BSt, and, on the second line, the installed version of the
Diesel engine control circuit PLD and also the SPF nb. (specification
number) of this circuit.
- The two indications behind " Nom" are not activated
- The penultimate line provides indication for the momentary operating
voltage.
- The last line "hours" indicates the operating hours for respectively:
Operation with the input X2.8 activated (special equipment
presently not in use),
fig. 5 Operation with the input X2.14 activated (special equipment
presently not in use),
Operation of the Diesel engine with standard power curve
(maximum power)
MENU
a) INFORMATION ABOUT THE HYDRAULIC PUMP

information screens 1/7 and 2/7
This screen gives information about the operating position of the hydraulic
pumps.
The screen 1/7 gives following indications for each working pump:
if one (or several) flow limitation is activated for the pump. (Regulation
solenoid valves EV1 and EV2 for pumps flow limitation).
If a pressure reduction signal is activated for the hydraulic system
fig. 6 (Regulation solenoid valve EV6).
graphic bars indicating the momentary electric current flowing to the
different regulation solenoid valves.
The fig. 6 shows an example where an external limitation (Hardwareinput I1,
option 2) is activated, limiting the oil flow of the pumps P1 and P2 to 55% of
nominal flow values via the solenoid valves EV1 and EV2 and at the same
time reducing the system pressure to 80% of maximum pressure via the
solenoid valve EV6.
The fig. 7 shows an example where the internal limitation (Pressure cut
in stage boom) and the external limitation (Hardware input I1, option 1) are
simultaneously activated.
In this example, the limits the flow of the working pump P1 to 50%, and
"I1, option1" the flow of the working pump P2 to 70% and also reduces the
system pressure to 60% of nominal pressure.
If an external limitation is activated, the symbol "R" is displayed in the field
fig. 7 TI, see description of the main screen.
If only one internal limitation is activated, the symbol " " is displayed
instead of the symbol "R".
Should several flow limitations be actuated at the same time, so the one with
the smallest flow value has priority and is displayed on the screen.
On screen 2/7 the present LR solenoid current is shown (current value for
power control).
fig. 8
3. 20
b) INFORMATION CONCERNING THE COOLER FAN CONTROL
SYSTEM
(This function is existing since Software Version V2.4)
The screen 3/7 appears only on machines fitted with an electronically

regulated cooler fan drive.
The graphic bar in the lower part of the screen gives the momentary value
of the current to the regulation solenoid valve for the fan RPM..
fig. 9
c) INFORMATION ABOUT THE STATUS OF INPUT TERMINALS -
Screens 4/7 up to 7/7
This screens (fig. 10 to fig. 13) show an overview about the status of
different electrical inputs.
The sign means "Input not active".

The sign " " means "Input active".
The indication "NC" under the terminal description means that the
corresponding input is deactivated in the software.
fig. 10 The status of the inputs can be changed using the menu "set data" - "set E-
code".
For the frequency inputs B53 and B12, the sign " " means that a significant
frequency is recognized by the system.
The sign " " at "service" means that a key plug is recognized on the
connector X30 or X31 of print plate A1001.
The sign " " at "MEM OFF" means that the update procedure for the data
copy in the codage plug is not activated.
The durations indicated on the last line M4/Time, resp. B19/Time on the last
line on the screen 4/7 correspond to the time lags for the intermittent
operation of the windshield wiper, resp. for the engine idle automatic.
M1, M2, ...correspond to machine specific (internal) oil flow limitation.
Presently only M1, M2 and M3 are assigned to the flow limitation for travel
motions, respectively for pressure increase and bottom dump shovel.
fig. 11
fig. 12
3. 21
The screen 7/7 gives information about the components of the PLD control
system of the Diesel engine:
2/13 Input X2/13 for operation of the Diesel engine with standard
power curve
2/15 Input X2/15 for external commutation of hydraulic power
PWRred Power reduction of the Diesel engine
..
fig. 13
MENU
INFORMATION ABOUT DETECTED ERRORS (OPERATING AND
ELECTRICAL SYSTEM ERRORS)
In this menu (fig. 14):
- select "list Exxx" to list all the operating errors detected by the switches
and sensors for machine parameters monitoring (fig. 19).
- select "list S-Exxx", to show a listing of the above mentioned errors which
occured during service operation,
fig. 14 - select "list E-elec.", to show a listing of all the electrical errors (system
errors) detected during operation of the machine,
When selecting the operating errors "list Exxx" all the occurred operating
errors are listed, with error code and number of occurence
Move the arrow keys "UP" and "DOWN" to select the desired error. (fig. 15).
fig. 15
By pressing the "MENU" key, the overview of the selected error appears,
with the indication of the operating hour and duration for the 10 first and the
10 lest occurrences of the error.
Move the arrow keys "UP" and "DOWN" to page in this overview.
fig. 16
3. 22
When selecting the electrical errors "list E-elec" all the electrical system
errors according to the list on page no. 3.11 are listed, with error code and
number of occurrence (fig. 17 and fig. 18).
See the list of all possible electrical system errors before in this chapter.
fig. 17
The column "Sum" shows the number of all errors which were ever noted.
The column "Test" shows the number of errors occurred since the last
deletion of this test error memory listing.
The operating hours above the test column show the operating hour when
the last test memory was deleted (reset).
fig. 18
Selecting "list S-Exxx" also shows the operating errors (as when selecting
"list S-Exxx" ), but this time only the errors which occurred during "service
operation".
fig. 19
fig. 20
For each error, an overview can be shown and paged in just like for the "list
Exxx" selection.(.
fig. 21
3. 23
MENU ("set option")
ALLOCATION OF FLOW LIMIT OPTIONS TO THE EXTERNAL INPUT I1

(Special attachment input; as an example for operation of hydraulic hammer,
scrap shear, )
In this menu, pre-defined flow limitations (options) are allocated to the
hardware input I1.
The arrow near the symbol gives the actual allocation. (fig. 22).
fig. 22 In example fig. 22, the option 1 is active for the input I1. This means, if the
external hardware input I1 is activated, then the nominal pump values
allocated in option 1 for the excavator control are given as maximum
nominal values.
If another option must be allocated to input I1 (as an example due to a
replacement of the working tool), so first select another attachment in the
vertical symbol range via the key "UP" or "DOWN" (as an example in fig. 23,
the option 10).
Confirm the selected option by pressing the "MENU" key, the new option
must then appear in the column.
The right part of the screen provides indication for the currently set pump
fig. 23 values corresponding to the option shown in the selection window.
The values EV1 and EV2 determine the flow limitation of the main pumps
when the special attachment is actuated.
The value EV6 determines the maximum allowed pressure level for the
actuation of the special attachment.
When selecting an option, a designation related to this option is displayed in
the right lower area of the screen, provided that this designation has been
memorized during the setting of the parameters of the option.
As an example, in fig. 22 the designation "BRV55" appears, which is the
designation for the hydraulic hammer allocated to the selected option.
MENU ("set service")
INFORMATION AND CONFIRMATION OF SERVICE INTERVAL
This screen is an information screen and can be used to confirm a

completed service interval.
The screen shows the operating hour for the next service interval (in
example beside ="500 hrs") and the current operating hours ("174 hrs").
fig. 24
An upcoming service interval can be confirmed within max. 50 operating

hours before the next service interval.
When this time frame is reached, the screen will display a question
regarding completion of the service works for this interval.
If the question is answered with "OK" then this menu will be discontinued.
If it is answered with "OK", then the current operating hour will be stored as
the last confirmed service interval.
fig. 25
3. 24
MENU ("reset data")
DELETION OF THE DAILY HOURMETER
This menu allows to reset the daily hour meter.
To reset the daily hour meter, first select "OK" via the key "UP" or "DOWN",
and then confirm this choice by pressing the "MENU" key.
fig. 26
MENU ("set clock")
Via this menu the clock displayed in the upper right corner of the main
screen can be set.
The selection of this menu is possible only on machines with Software
Version 3.1 and later.
After function start, the presently set time will appear in the lower
section of the screen with the first digit shown inversely (unity digit of
fig. 27 the minutes) fig. 27.
Use the arrow keys to modify the inversely displayed position
Use the "MENU" key to change the inversely displayed to the next
higher number (more left digit).
When the highest number has been reached, it will start over with the
lowest number.
fig. 28
Once all the digits have been set, press the "RETURN" key to leave the
function and to store the set time.
The confirmation message update xx : xx will appear momentarily on
the screen fig. 29.
fig. 29
3. 25
CONTROLS AND INSTRUMENTATION FOR OPTIONAL EQUIPMENTS
Right side control desk
H40 Control light / Pre-selection hydraulic circuit

H90 Control light / Rotation in opposite direction of reversible fan
H292 Control light / Special control system
S26 Touch / Fuel preheater
S40 Touch / Frequency commutation for hydraulic hammer
S45 Touch / Priority for special equipment
S46 Touch / Lifting magnet
S47 Push button / Quick disconnecting device
S53 Touch / Special control circuit
S54 Key switch / Unlocking of hydraulic cylinder end position
S74 Code key / Start locking device
S76 Touch / Travel brakes
S77 Touch / Pressurized driver's cab
S79 Touch / Flow divider for special attachment
S84-1 Push button / Centralized lubrication
S98 Touch / Low pressure protection for boom cylinders
S104 Touch / Width adjustable undercarriage
S114 Rotating switch / Control of special attachments via switches of the joysticks
S117 Rotating switch / Pre-selection hydraulic circuit
S160 Push button / Control of reversible fan in opposite direction
S168 Key switch / Oil flow limitation when operating a super long working attachment
S218 Touch / Cab roof window wiper
S247 Key switch / Commutation of control system Normalized control / Special control
S275 Touch / Additional floodlight rear of cab roof
S276 Touch / Additional floodlight on counterweight
S358 Push button / Cab roof window washer
Left side control desk
S78 Push button / Height adjustable cab - emergency down

S80 Push button / Height adjustable cab - locking device on / off
S200 Push button / Height adjustable cab - up
S201 Push button / Height adjustable cab - down
S232 Control unit / Standstill cab heater
3. 26
* The location of these controls may differ, depending on the type of the other installed optional equipments.
3. 27
Control light H40 - Pre-selection hydraulic circuit
This lamp reports pre-selection of a certain consumer via rotating switch S117.
Control light H90/ Rotation in opposite direction of reversible fan

On machines fitted with the special equipment "cooler fan reversible", this control light lights up to
indicate that the fan has been changed over to rotation in opposite direction via the push button
S160.
Control light H292 - Spécial control system

This control light lights up to indicate that a special, non standart lever arrangement has been turned
on via the key switch S247.
Touch S26 - Fuel preheater

This button turns on the installed fuel heating system (Thermoline fuel hose, or heater resistor inside
the fuel filter).
The Control light inside the push button shows when the heating system is on.
Touch S40 - Frequency commutation for hydraulic hammer

This touch allows to increase the cycle frequency of an hydraulic hammer.
Touch S45 - Priority for special equipment

If an hydraulic actuator ( cylinder, hydraulic motor, ) of a special attachment requires a constant oil
flow, the speed of the remaining attachment movements can be reduced by depressing the push
button S45 (the control light inside the button must light).
The necessary oil flow for the hydraulic actuator is maintained, even by simultaneous actuation of
other attachment movements.
Touch S46 - Operation with a lifting magnet

This button turns on the generator which supplies the lifting magnet, and also switches on the control
circuit of the magnet (push buttons S6 at the top of the right joystick handle, see also page 4. 17).
The control light inside the touch lights up when the control circuit is on.
In this case, the engine idle automatic is deactivated; the engine RPM is automatically set to a fixed
value and can not longer be set using the buttons S228, S229 and S86.
Push button S47 - Quick change adapter

The push button S47 turns on the control circuit for the quick change adapter for the working tool.
When the touch S47 is depressed, the locking pins of the adapter can be retracted via the push
button S5R on the top of the left joystick handle. (Also see on chapter 8.2).
Touch S53 - Special control circuit supply

When this touch is actuated, an additional control circuit for a special equipment is made alive.
The green indicator light in the touch lights up to show that the additional servo control circuit is under
pressure
3. 28
Key switch S54 - Unlocking of cylinder end position
On some special working attachments, or on attachment showing particular cinematic capacities (as
example on industrial attachment), certain movement(s) may be stopped automatically by electrical
end switches. The main purpose of this movement limitation is to prevent possible damages due to
components frequently reaching their end stops.
With the key switch S54 turned to the left into position I, the automatic limitation can be unlocked
temporarily while tilting up or down the rocker switch S55 mounted to the left joystick handle (see
page 3.2).
Notice : on machines destined to the north-American market and also fitted with a lifting magnet
controlled via the rocker switch S55, the both push buttons S5 at top of the left joystick handle must
be used to unlock the limitation.
Should a special attachment comprise two different automatic stops of movement, so the key switch
S54 must be turned to the right into position II to be able to release from the second automatic
limitation.
No unlocking is possible with the switch S54 in neutral position.
Code key switch S74 - Anti-theft protection system

The Auto-Scan protection unit interrupts the current supply of the excavator about 30 seconds after
shut down of the machine (ignition key in 0-position), the red LED lights up.
To restart the machine, a code key must be stuck briefly in the anti-theft system S74 to unlock the
protection. The red LED will then turn off and the electrical system must be energized immediately
thereafter (ignition key in contact position).
Touch S76 - Travel parking brake

This touch controls the travel parking brake on the machines fitted with a special undercarriage, or on
machines mounted on a loading bridge, a wagon, ...
When the red indicator light in the touch lights up, the travel brake is applied.
On machines with a standard undercarriage, the travel brakes are controlled directly via the travel
pedals and the touch S76 does not exist.
Touch S77 - Pressurized driver's cab

Depressing this button start the air fan for the pressurization of the driver's cab.
The entering of dust or no filtered air into the cab is then almost prevented.
Touch S79 - Flow divider for special attachment

Should a certain user (cylinder, hydraulic motor, ...) has to be fed with a constant oil flow during the
actuation of a special attachment, so the necessary oil flow can be reserved to give priority to this
user while depressing the touch S79.The indicator light in the touch is then lighting up.
The velocity of the other simultaneously actuated working movements is correspondingly reduced.
Push button S84-1 - Central lubrication system

On machines fitted with a central lubrication system, an additional lubrication cycle of the attachment
bearing points and swing ring can be started by depressing the button S84 (see on pages 5.21 to
5.23).
Touch S98 - Low pressure protection for boom cylinders

If the touch S98 is actuated, the pressure protection of pressure relief valve in the circuit for retraction
of the boom cylinders is reduced, so to limit the possible downward thrust exerted by the working
attachment onto the materials to be dug out.
This safety device must be turned on, as an example, when unloading a boat or a barge, so to avoid
damage to its bottom.
3. 29
Touch S104 - Hydraulic width adjustment of undercarriage
This button concerns excavators fitted with an undercarriage with adjustable track gauge. The button
must be actuated before moving the side frames.
- On machine type HV (excavators with fully hydraulic actuated track gauge adjustment),
pushing the button commutes the high pressure circuit in the undercarriage from travel control to the
width adjustment cylinders (see page 8.5.7).
- On the other machines with hydraulic aided track gauge adjustment (bolt connection between
side frames and central piece), actuating this button makes alive a 24 volt connector situated on the
upper carriage and which is intended to supply the control box for the hydraulic width adjustment of
the undercarriage (see page 8.5.6).
Rotating switch S114 - Control of special attachments with switches of the joysticks
The purpose of this rotating switch is to commute the control over pedals for some special
attachments into a control via the rocker switch S55 on the left joystick, (or, depending on execution
or customer's wishes, via the two touches S6L and S6R at the top of the handle of the right joystick)
When the switch is in position "joystick", special attachments as hydraulic hammer or scrap shear are
controlled via the three positions rocker switch S55 (resp. via the touches S6L and S6R).
With the switch turned to position "pedal", these attachments are controlled using the pedals 7c and
7d, as described on pages 4.15 and 4.16.
Rotating switch S117 - Pre-selection hydraulic circuit

With machines featuring several additional consumers, two different consumers can be allocated to
the same hydraulic circuit (servo control circuit and consumer output on the spool valve).
Via the rotating switch S117 the hydraulic circuit can be switched over from one consumer to the
other.
Should it be necessary to supply both consumers with different amounts, the necessary adaptation of
flow limitation is resulted simultaneously upon pre-selection with the rotating switch.
In one position of the rotating switch (turn symbol, example for the drive of a swivel bearing), the
control light H40 lights up simultaneously.
Push button S160 - Control of reversible fan in opposite direction

On machines fitted with the special equipment "cooler fan reversible", the direction of revolution of the
cooler fan can be inverted while actuating the push button S160. In some particular working
conditions, this inversion of the direction of the fan rotation allows an easy cleaning of the radiator
core and of suction area of the fan.
Cleaning procedure:
- With running Diesel engine depress the push button S160 and keep it
depressed. During approx. 15 seconds the fan will be progressively stopped, then the control light
H90 lights up and the fan will start rotating in opposite direction,
- bring the Diesel engine to high idle while keeping the push button S160 depressed,
- let the engine run at high idle for approx. one minute, (three minutes at the maximum),
- release the push button S160,
To check the condition of the cooler, the Diesel engine must be shut down. If neccessary repeat the
cleaning procedure.
3. 30
Key switch S168 - Oil flow limitation when operating a super long working attachment
This key switch allows to limit the speed of the whole working attachment.
When using a super long working attachment, the key switch S168 must be turned to position "1", so
to keep the speed of all attachment movements within reasonable limits.
Notice: To limit all the excavator movements, not just the movements of the working attachment, use
the push button S354 of the control unit, refer to page "control unit".
Touch S218 - Cab roof window wiper

Depressing this push button alternately causes the wiper to be turned on in continuous and to be
stopped.
3. 31
Control unit S232 - Standstill cab heater
This unit controls an eventually installed standstill heater for the cab or .other circuits on the
uppercarriage. Refer to the special issued operation and maintenance manual of the maker of
the additional heater.
Key switch S247 - Commutation Normalized control system / Special control system
This key switch allows to commute electrically from a Standard lever arrangement (ISO - PCSA) into
a Special lever arrangement (LIEBHERR, other lever arrangement, ...).
Touch S275 - Additional floodlight on rear of cab roof

Actuating the touch will turn on and off above mentioned floodlight. At the same time, the control light
inside the button will light up and go out.
Touch S276 - Additional floodlight on counterweight

Same control as for S275.
Push button S358 - Washer for cab roof window

The button turns on the electric window washer system. Washer fluid will be sprayed to the window
and the cab roof window wiper will be actuated as long as the push button S358 is depressed.
3. 32
THE HEATER AND AIR CONDITIONER
As standard equipment the driver's cab is fitted with a heater and air conditioner unit (fig.76) which can be
used for heating, cooling off and also as a fresh air ventilation for the cab.
The main functions of the control unit for this heater and air conditioner are described thereafter. For a more
detailed description, refer to the pages 3.37 and followings at the end of this chapter.
THE CONTROL UNIT
Control Touches LCD Indication

1 - Touch - Air conditioner On / Off 13 - Symbol indicates recirculated air operation
2 - Touch - Increasing the set value for cab temperature, fan 14 - Symbol indicates REHEAT- operation
RPM, ... 15 - Symbol indicates air conditioner on
3 - Touch - Reducing the set value for cab temperature, fan 16 - Symbol indicates ventilation flap to cab rear side OPEN
RPM, ...
17 - Symbol indicates ventilation flap to control board OPEN
4 - Touch-Control unit heater and air conditioner On / Off
18 - Symbol indicates lower ventilation flap in MIDDLE
5 - Commutation Touch - manual / automatic control for position
evaporator fan RPM
19 - Symbol indicates lower ventilation flap OPEN
6 - Touch - REHEAT operation On / Off
20 - Symbol indicates full automatic operation is ON
7 - Commutation - Heater control manual / automatic
21 - Bar graph shows fan RPM (if manually adjusted)
8 - Touch - Fresh air admission On / Off
22 - Symbol indicates manual fan control is ON
9 - Touch - ventilation flap to cab rear side OPEN /CLOSED
23 - Symbol indicates manual heating power control is ON
10 - Touch - ventilat. flap to control board OPEN / CLOSED
24 - Bar graph shows heating power (if manually adjusted)
11 - Commutation Touch - Lower ventilation flap in MIDDLE
position / CLOSED 25 - Indicates set value for temperature or error code
12 - Commutation Touch - Lower ventilation flap OPEN / in 26 - Indicates the employed temperature unit - (°) or (F)
MIDDLE position
TURNING THE CONTROL UNIT ON ADJUSTMENT OF DESIRED CAB

TEMPERATURE
The heater and air conditioner is turned on via
the touch (4). After turning on, the control unit will The 4 positions indication range (25) shows the
perform an auto-check for approx. 12 second. set value for cab temperature.
Heater and fresh air ventilation of the cab are Use the touches (2) and (3) to increase or reduce
now operative. The control unit controls in this value.
automatic the heating power and the RPM of the
fan inside the heater and air conditioner.
RECIRCULATED AIR AND FRESH AIR
However heating power, respec. fan RPM can
OPERATION
also be adjusted manually while actuating the
touch (7) respec. (5) and adjusting immediately The heater and air conditioner can be operated
after the heating power respec. the fan RPM via with 100% recirculated air, but also with a mixing
the touches (2) and (3) of fresh air (F) and recirculated air (R).
3.34
Depressing the touch (8) alternately opens and closes the fresh air flap
The recirculated air operation is indicated by the symbol (13).
In position "fresh air" the fresh air flap 7 is open, and about 10% fresh air is admitted into the cab
(depending on the contamination of the filters 5 and 6).
ADJUSTMENT OF THE AIR FLOW

The air flow enters the cab via the louvers 3 at the seat console, 4 at the front windshield, 2 at the
control board and 1 at the rear wall area.
The blow out direction of the air flow can be adjusted while opening or closing the 4 following
ventilation flaps:
opens and closes and the symbol

The touch
the ventilation ( ... ) goes on
( ... )
flap to ... and off
(9) rear side of cab ( 16 )
( 10 ) control board ( 17 )
area
( 11 ) windshield and ( 18 ) and ( 19 )

pedals area
( 12 ) windshield ( 18 )
3.35
TURNING ON THE AIR CONDITIONER
The air conditioner operation is turned on and off via the

touch (1). The symbol (15) indicates that the air conditioner
is on.
The electronic control system then turns the compressor on
and off according to the desired cooling effect and
automatically adjusts the RPM of the evaporator fan inside
the heater and air conditioner.
The air conditioner should only be turned on after the engine
is running. This will prevent an overload on the starters and
batteries.
The air conditioner may also be switched on temporarily in
winter season to dehumidify the cab by high air moisture.
To do this actuate the "REHEAT" touch (6). The reheat
operation is indicated by the symbol (14) of the control unit.
The reheat operation will turn off automatically after 10
minutes.
IMPORTANT REMARKS
78 The air flow through the heater and air conditioner unit is
controlled by adjustable and swivelling louvers.
To reach a maximal feeling of comfort we recommend:
when heating, to blow the air out of the louvers 2 at the
control console, 3 at the seat console and 4 at the
windshield,
during air conditioner operation, to blow the air out of
the louvers 1 in the air ducts at the rear cab corners
and 2 in the control console area.
The best heating, respectively cooling effect is reached in
recirculated air operation (symbol 13 is displayed)..
To defrost or dehumidify the windshield quickly, blow the
whole air flow out of only the louvers 2 in the control console
area and 4 at the windshield,
In case of high outside temperature, and especially if the cab
79
has been heated up by the sun, decrease the temperature
inside the cab as far as possible before turning on the air
conditioner.
Open the windows and the door for a few minutes and adjust
the blower fan to maximum RPM via the touches (5) und (2).
In case of very high outside temperature, preferably close
the louver 4, so to avoid an unnecessary warming up of the
inside air along the windshield.
Should the machine be operated for a longer period without
use of the air conditioner (winter season, ...), so it is
necessary to start the compressor for about 10 minutes
every second week while actuating the "REHEAT" touch (6).
80
3.36
Detailed description of the control unit for heating and air-conditioning
Fig. 1.
Switching on the system:
ON/OFF key (4) Comment:

As the control unit is carrying out a self
test, the software version is displayed for
approx. 12 sec.!
Press
Fig. 2.
Setting the desired cab temperature:
Set cab temperature is displayed in Key (3)
°C, e.g. 26 °C.
Control unit is in automatic operation,
the circulated air/fresh air-
flap is open (fresh air operation). Press 5 x
All other vent flaps are closed!
Desired cab temperature

21 °C is displayed.
The evaporator fan turns at min.
speed, as all air flaps are closed!
Fig. 3.
Fresh air- / circulated air operation:
The fresh air flap is closed, symbol (13)
Key (8)
indicates circulated air operation.
Press 1 x
Note:
By applying the key once again (8) fresh air operation is reactivated, Symbol (13) will no longer be displayed..
3.37
Fig. 4.
Opening / closing the vent flap rear panel:
Key (9) The vent flaps rear panel opens,

Symbol (16) indicates that the vent flap
is open.
Press 1 x
Note:
By applying the key once again (9) the vent flaps rear panel is closed, symbol (16) will no longer be displayed.
Fig. 5.
Opening / closing the vent flap armrest:
Key (10) The vent flaps arm rest is opened,

symbol (17) indicates that the vent flap is
open.
Press 1 x
Note:
By applying the key once again (10) fresh air operation is reactivated, symbol (17) will no longer be displayed.
Fig. 6.
Opening / closing the vent flap front window and foot room area:
Key (11) The vent flap front window and foot room
area are opened, symbol (18 + 19)
indicates that the vent flap front window
and foot room area is open.
Press 1 x
Note:
By applying the key once again (11) the vent flap front window and foot room area are closed again, symbols (18+19) are no
longer displayed.
Fig. 7.
Opening / closing the vent flap foot room area:
The vent flap front room area opens,
Key (12)
symbol (18) indicates that the vent flap
foot room area is open.
Press 1 x
Note:
By applying the key once again (12) the vent flap foot room area is closed again, symbol (18) is no longer displayed.
3.38
Fig. 8.
Switching air-conditioning operation on / off:
Air-conditioning operation has now been
Key (1) activated. Symbol (15) indicates that air-
conditioning operation is on, the
compressor is activated from the control
unit as required.
Press 1 x
Note:
By applying the key once again (1) air-conditioning operation is deactivated, symbol (15) is no longer displayed.
Fig. 9.
Switching REHEAT operation on / off:
REHEAT operation has now been
Key (6) activated, symbol (14) indicates that
REHEAT operation is on, the
compressor is constantly active. The
evaporator fan speed is raised to
100 %, the vent flap front window and
foot room area opens in order that the
Press 1 x front window is cleared of condensation.
The control unit switches on the heating
as required to retain the room
temperature at a set value. REHEAT
operation is limited to 10 min.
automatically.
Note:
By applying the key once again (6) REHEAT operation is deactivated, symbol (14) is no longer displayed.
Fig. 10.
Manual setting of the evaporator fan speed:
Key (5) Manual setting of the fan speed is now

active , the symbol (21) in the bar
display shows the current set fan speed,
symbol (20) AUTO is no longer
displayed. The fan symbol (22) flashes
for 5 sec., and during this time, the fan
Press 1 x speed can be adjusted in 10% steps via
keys + (2) or (-). The lowest speed which
can be set is 30% (three bars are
Manual fan speed is set at 100%! displayed).
Note:
By applying the key twice (5) automatic operation is reactivated, symbol (20) is displayed, symbols (21+22) are no longer
displayed.
Fig. 11.
Manual setting of the heating output:
Key (7) Manual setting of the heating output is

now active, the symbol (24) in the bar
display shows the current set heating
output, symbol (20) AUTO is no longer
displayed. The heating symbol (23)
flashes for 5 sec., and during this time,
the heating output can be adjusted in
Press 1 x
10% steps via keys + (2) or (-).The
lowest heating output which can be set
Manual heating output is set at 70%!
is 0% (no bars are displayed).
Note:
By applying the key twice (7), automatic operation is reactivated, symbol (20) is displayed. Symbols (23+24) are no longer
displayed.
3.39
Fig. 12.
Switching over the temperature display in ° Fahrenheit:
Press + hold
key (8), then

press
Set temperature is displayed at 21° Set temperature is displayed at 69°

Celsius! Fahrenheit!
key (3 )
Note:
By applying the keys (8+3) once again, the temperature display is changed over to °Celsius again.
Fig. 13.
Operation with auxiliary heating: (optional)
1. 0 4.
Ignition is
switched off
2. Auxiliary heating control unit authorizes standard heating

operation.
Auxiliary heating operation is indicated in the display.
3. 5. Start
Ignition key
After the diesel engine has been started, standard

heating operation is switched off and normal operation
Comment: is reactivated. The setting, which was last stored is
As the control unit is carrying out a self-test, the software version active.
is displayed for approx. 12 sec.!
Note:
It is not possible during auxiliary heating operation to carry
out manual settings. The heating valve position is always
100%. The evaporator fan speed is 50%.
Display of faults and notes on fault remedying

Fig. 14
Error code F0 faulty room temperature gauge:
Note:
The control unit has recognised a faulty room temperature gauge, the regulation
is no longer ready for operation.
Cause of gauge error, short-circuit or interruption of gauge power supply line,
plug connection on gauge or control unit, temperature gauge faulty.
The regulator is then only ready for operation again when the fault of the gauge
has been remedied, the gauge error will then no longer be displayed!
Room temperature gauge error is displayed

flashing!
Note:
Should a gauge error occur, the regulator continues to operate to the setting which was valid before the fault was recognised!
3.40
Fig. 15
Error code F1 faulty blow-out temperature gauge:
Note:
The control unit has recognised a faulty blow-out temperature gauge, the
regulation is no longer ready for operation.
Blow-out temperature gauge error is displayed

flashing!
Note:
Fig. 16
Error code F2 faulty reserve temperature gauge:
Note:
The control unit has recognised a faulty reserve temperature gauge, the
regulation is no longer ready for operation.
Note!
Reserve temperature gauge error is displayed Is not currently used!!!!!
flashing!
Note:
Fig. 17
Error code F3 faulty vent flap foot room area and front window:
Note:
The control unit has recognised a faulty vent flap room area and front window, the
regulation is once again ready for operation.
Cause of flap fault, short-circuit or interruption of the power supply line, plug
connection on fan flap motor or control unit, flap motor faulty.
After remedying of the fault, the fault is no longer displayed!
Vent flap foot room area and front window error

is displayed flashing!
Note:
Should a flap error occur, the regulator carries on working as usual, only the middle position of the vent flap can no longer be
started!
Fig. 18
Error code F4 pressure fault and faulty magnetic coupling:
Note:
The control unit has recognised a pressure fault or faulty magnetic coupling.
Cause of fault, short-circuit or interruption of the power supply line to the
magnetic coupling, plug connection on the coupling or control unit, overpressure
or underpressure (lacking refregerating agent) in the refregerating system of the
air-conditioning unit
After remedying of the fault, the fault is no longer displayed!
Pressure fault and faulty magnetic coupling is

displayed flashing!
Note:
Should a pressure fault or faulty magnetic coupling occur, the regulator carries on working as usual, only the magnetic coupling
output is interrupted!
3.41
Fig. 19
Error code F5 faulty data transmission operating feature / control unit:
Note:
Data transmission from the operating feature to the control unit is faulty, cause of the
fault, short-circuit or interruption of the data line to control unit, plug connection on
operating feature or control unit.
The operating feature continues to try to establish data connection to the control unit, if
the connection is once again OK, F5 fault will no longer be displayed.
Faulty data transmission is displayed flashing!

Note:
If the data transmission from the operating feature can not be established again, the ignition must be switched off, and RESET will be
carried out following the restart!
3.42
OUTFIT OF DRIVER'S CAB
ENTERING OR EXITING THE OPERATORS CAB
The excavator must be entered and exited at all times via the
steps provided for this purpose.
CAUTION
Never jump off of the hydraulic excavator!
Never use the control elements as handles! 89
OPERATORS CAB DOOR
Opening the cab door from the inside:

Push down the lever (fig. 89) on the doors lock.
Open the door completely and secure it in stop position.
Unlocking the cab door after being opened completely:

Push out the lever (fig. 90) next to the operators cab
frame.
90
FIRE EXTINGUISHER / FIRST AID KIT*

Optional installation
The storage space for the fire extinguisher and the first aid
kit is to be found at the bottom in the rear left corner of the
operators cab.
* Operators prescription!
3.43
OPERATION OF THE EXCAVATOR IN SAFETY MODE
The printed board E52 containing all necessary switches and lights
for the safety operation of the excavator is situated at the rear end
of the right side control desk. Thanks to this printed board, the
excavator can, in case of a trouble in the main electronic circuit, be
maintained operating temporarily and with some restrictions.
Switch S71 for engine start in safety mode

In normal operation, the engine is started via the main electronic
circuit when the ignition key is turned to start position.
In case the engine can no longer be started or kept running due to
troubles in the main control circuit of the excavator, it can be started
in safety operation via the safety mode start switch S71.
To start, turn the ignition key to start position, with the switch S71
101 tilted to the right, until the engine is started.
The engine can also be switched into safety operation
automatically, as an example consecutively to a communication
default in the control system.
In safety operation, the control light H11 is lighting up at the safety
control board E52 and at the same time the warning symbol S71a
appears on the monitoring display.
In safety operation the stop of the Diesel engine is achieved just like
in normal operation, while turning back the ignition key to the "off"
position.
In safety operation, the communication between the electronic
control box of the engine and the main circuit of the excavator may
be no longer established.
H11 Warning light / Diesel engine in safety mode
In case of the occurrence of any operating error on the Diesel
H60 Warning light / operating error on Diesel
engine, the red warning light H60 lights up on the safety control
engine with safety mode turned on
board E52, at the same time a buzzer will sound inside the cab and
E52 Printed board for safety operation the error code E525 is displayed on the screen.
S71 Switch / engine start in safety mode
S72 Switch / RPM selection in safety mode
In safety operation the followings remain guaranteed:
S71 Switch / servo pressure circuit in safety mode - the automatic engine power reduction in case of overheating of
the engine coolant or of the charge air.
- the memorization of the occurring engine faults into the inner
error memory of the control box of the engine.
At the opposite, the shutdown of the engine in case of low engine oil
pressure and of overheating of the engine coolant or of the charge
air is no longer ensured.
CAUTION
In case the warning light H60 lights up, the operator must
shut the engine down as soon as possible and recognize
which error has occurred.
It's the operator's own responsibility to decide if the
machine can be maintained operating or not.
3. 44
In safety operation, the engine works with reduced output in
comparison with the normal operation.
Tilt back the rocker switch S71 from safety operation into
normal operation (position AUTO) only when the excavator is
turned off.
Switch S72 for safety control of the Diesel engine RPM

In normal operation, the set point for the engine RPM is
entered via the buttons S86, S228 and S229 (see page 4.4),
and the engine speed is controlled in consequence by the
electronic system of the machine
If the engine has been started in safety mode via the rocker
switch S71 so it can be operated only with two different RPM,
depending on the position of the switch S72 :
- With the switch S72 tilted to the left, the engine RPM is set to
lower safety RPM.
- With the switch S72 tilted to the right, the engine is running
at upper safety RPM.
The values for upper and lower safety RPM of the engine are
memorized in the electronic engine control box.
Immediately after starting, the engine runs at lower safety
RPM.
Notice: Should the engine be switched automatically into
safety operation, so the momentary set RPM will be
maintained until the next shutdown of the engine.
Switch S73 for safety mode of the servo pressure circuits

During normal operation, the servo pressure supply to the
swing brake and to the joysticks and pedals is controlled over
the electronic circuit of the machine.
While tilting the switch S73 in safety position, this servo
pressure supply can be enforced, and is maintained even in
case of a trouble in the normal control circuit.
The operator is alerted that the servo circuits safety mode is
turned on by the three indicator symbols S73a, S73b and
S73c (fig. 103) appearing on the display of the machine.
107
DANGER
The safety mode must be turned on only temporarily and in
order to move the machine for emergency reasons and
when, due to a trouble in the normal control circuit,
releasing the swing brake or supplying the pilot controls is
hindered.
In safety mode, the swing brake will be released as soon as
the ignition key is turned to contact position, and the
normal brake control (see page 4.12) is out of function.
However, even with the switch S73 in safety position, the

interruption of the servo pressure supply to the joysticks and
pedals when lifting the safety lever (see page 3.3) is
maintained.
108
3.45
4. OPERATING PROCEDURES
PRE-STARTING INSPECTION
CHECK AIR FILTER FOR CONTAMINATION

Check the dry air filter on side of the Diesel engine to
determine the degree of contamination.
When the maximum permissible depression has been
reached, a red stripe will appear in the inspection port 10 of
the maintenance indicator 12 (fig. 1) and the filter must be
serviced, see page 6.16. 1
ENGINE OIL LEVEL

Check the engine oil level with the machine on level ground.
After engine shut down, allow 5 minutes for the oil to drain
into the oil pan.
The oil level must be between the MIN. and MAX. mark on
the dipstick , see fig. 2.
CAUTION
The engine oil is very hot at or near operating temperature.
Avoid contact with hot oil and components containing oil,
since it could cause severe burns.
2
COOLANT LEVEL
CAUTION
At or near operating temperature, the engine coolant is hot
and under pressure.
Avoid contact with components containing coolant, since
it could cause severe burns.
Check coolant level only after the cap 6 at the filler tube is
cool enough to touch.
To check the coolant level, turn the filler cap 6 slowly to
relieve pressure . 3
When the coolant is cold, the coolant level should reach the
top of the tube under the filler cap (fig. 3, pos. 6).
The proper antifreeze concentration (about 50% antifreeze)
must be maintained all year long.
The excavator is delivered from the factory with a cooling
system protection to -31 °F (-35 °C).
4.1
CHECK FUEL SYSTEM / FUEL LEVEL
. The condensation in the fuel system and fuel tank must

daily be checked and if necessary drained.
. To drain the water of the tank, unscrew the drain plug 5

at the fuel tank bottom (fig. 5) about two turns, then
retighten the plug as soon as water free fuel flows out.
. If the corresponding warning symbol appears on display

(fig 8, pos b), showing that the water level is high in the
water separator of the prefilter 1 (fig. 5) turn the plug 3 on
5 the water separator and drain the condensation until fuel
drains off.
. Retighten the plug.
. Under ideal operating conditions, this interval may be

extended to one week.
. Check the fuel gauge P3 on the monitoring display (fig. 7)

before starting to work.
If the reds diodes 62 on the left of the indicator P3 lights
up, only a little reserve of fuel remains in the tank.
Refill the tank, if fuel level is low.
. Notice: Since a high fuel level in tank reduces

condensation inside the tank, the refuelling
should be done preferably at the end of the
6 working day.
HYDRAULIC OIL
. When checking the oil level or adding oil,

park the machine on level ground,
rest the attachments on the ground,
with stick and tilt cylinders fully extended
and, if applying with bottom dump bucket closed.
The Diesel engine must be shut down.
. Check oil level in the hydraulic tank :

7
. In this position, the oil level must not below the middle
mark on the sight gauge (fig. 8),
. Otherwise oil has to be added through the return filter
until the oil reaches the middle mark.
. See page 5.16 for description of procedure for adding oil.
. The upper mark (maxi) shows the maximum oil level
when all cylinders are retracted.
. The lower mark (mini) shows the minimum oil level when
all cylinders are extended.
. If the oil level drops below the lower mark on the sight
gauge, the corresponding warning symbol appears on
display (fig. 8, pos a).
4.2
MACHINE START UP SAFETY
Before excavator start up, perform a thorough walk Be certain that the area surrounding the
around inspection. excavator is free of other personnel, and that no
one is working on or under the excavator before
Visually inspect the excavator, look for loose bolts, starting the engine.
cracks, wear, any leaks and any evidence of
vandalism. After entering the cab, adjust the operators seat
and controls, the inside and outside mirror, the
Never start or operate an unsafe excavator. armrests and fasten and adjust the seat belt. Be
Report all defects to your foreman or supervisor and certain that all controls can be reached
make sure they are corrected immediately. comfortably.
Make sure all covers and doors are closed and all All noise protection devices on the machine must
warning decals are on the machine. be functional during operation.
Make sure all windows, as well as inside and
outside mirrors are clean, and secure all doors and
windows to prevent any unintentional movement.
4.3
DIESEL ENGINE OPERATION
IGNITION KEY POSITIONS (Fig. 13).
-0- Off
-1- Contact position
-2- Position is not used
-3- Start
TURN ON THE ELECTRICAL SYSTEM
. Turn the key to contact position -1- .
. Immediately after turning the system on, the display and
the control unit will run through a self test.
13
. Make sure all indicators function properly after turning the
electrical system on, i. e. the light emitting diodes (indicator
lights and gauges) turn on for a short time then the
complete field of the LCD indicator 200 turns momentarily
black (the matrix indicator is energized completely for a
short time).
. Only the diode in the button S22 (fig. 14) turns not on at
that time.
STARTING THE ENGINE AT AMBIENT TEMPERATURES

TO -12° C (10° F)
. - Turn the ignition key to starting position 3.
. - As soon as the engine is running, release the key.
. The engine can not be cranked for more than
approximately 10 seconds. After this time lag, the starter
14 will be stopped automatically.
. The next starting procedure is possible only after a
programmed off period is over.
. The coming up of the symbol "preheating", fig. 19, signals
that an automatic preheat procedure is actually occurring,
see the section "automatic preheating for cold start"
thereafter.
.
ENGINE SPEED ADJUSTMENT
. The LED indicator P4 (fig. 16) displays the engine RPM. It
divides the complete RPM range into 10 Stages.
. The engine RPM can be set either using the arrow keys
S228 and S229, or using the MODE key S86 (fig. 16).
. With the arrow keys

. Depressing an arrow key causes the RPM to jump in the
next higher or lower RPM stage.
. With mode pre selection

. Via the MODE key, different preset RPM can be selected.
. Depressing the button S86 causes to change from a pre
selected mode into the next, in the following order L, F, E,
P, L, ... and so on.
. Immediately after starting, the engine will run either on
RPM stage 1 (low idle) or on RPM stage 3 if a warm up
16 procedure of the engine is necessary.
4.4
One of the four light emitting diodes (fig. 17, pos. 61) blinks
to show which mode L, F, E or P is pre-selected (the pre-
selected mode which was in use before the machine was
turned off remains stored).
L Mode LIFT = RPM stage 5
F Mode FINE = RPM stage 10
E Mode ECO = RPM stage 8
P Mode POWER = RPM stage 10
By pushing the mode key S86, the initial condition is
confirmed, the corresponding engine speed and power are
transferred to the running Diesel engines, and the LED
remains on. 17
If the engine speed is changed via the arrow keys to the
engine speed for mode L, F, E or P, then it jumps
automatically to the corresponding mode.
If the engine speed does not correspond to the pre-selected
mode (either because the engine speed had been changed
via the arrow keys or lowered via the low idle automatic), the
LED blinks to indicate the mode selected before.
In mode E and P, the engine is running at its rated power
curve (line II on fig. 18), in mode L and F it works at a power
reduced by approx. 20% (line I).
The fig. 18 also show the variation for RPM stages and
corresponding engine power when using the buttons S228
and S229.
18
Adjustment via low idle automatic
The low idle automatic is turned on or off via the key S20 (left
light emitting diode on the switch is on or off).
When the low idle automatic is turned on, the engine speed
increases by itself to the preselected RPM stage as soon as
any one of the pilot control units is actuated, and it is
automatically reduced to low idle speed, if no pilot control
unit is actuated within a given time frame.
AUTOMATIC PREHEATING FOR COLD START
When the coolant temperature is low, the intake air is

preheated automaticaly by flame glow plugs situated in the
19
intake manifolds so, to improve the starting of the engine.
As long as the preglow plugs are energized, the symbol
"preheating" (fig. 19) will be displayed at the screen.
After about 20 seconds (depending on the coolant
temperature) the symbol "end of preheat" (fig. 20) will start
blinking at the screen.
Then turn the ignition key to start position and let it go off as
soon as the engine has started.
If the engine does not start, the starting procedure will be
switched off automatically after completion of a preadjusted
cranking time.
In this case first turn the starting key back to the off position
before preheating and starting again..
Notice ! The engine can be started any time, even
during a preheating procedure. 20
4.5
AFTER THE ENGINE IS RUNNING
. The following indicator lights must turn off after the engine
is running (Fig. 22) :
. - H2- Oil pressure
. - H12- Battery charge indicator
. If an operating fault occurs as the engine is running, so a

corresponding symbol or error code will be displayed at the
screen to indicate this error.
. For the exhaustive list of possible operating faults on the

Diesel engine, as well for their results and for the corrective
21 actions refer to chapter 3.
. WARM UP PROCEDURE FOR ENGINE

. When the engine is cold, the RPM is increased
automatically above the value which has been set for low
idle, from an amount depending on the coolant
temperature.
. Increase the engine load slowly, until the second green
lighting diode goes on on the temperature gauge P2 (fig.
22).
. Do not run the engine for more than 10 minutes at low idle,
or the engine can be damaged. Turn the engine off if the
machine is not used for a longer period of time.
.
. WARM UP PROCEDURE FOR HYDRAULIC CIRCUIT
22 . With cold hydraulic oil (temperature below 20° C), the pump
output is automatically limited (the pump output is limited to
the same value as for mode F).
. As soon as the oil temperature increases above 20° C, the
full power of the machine is available.
. The warm up procedure for hydraulic circuit can be
activated and deactivated while programming the display.
. During a warm up procedure for Diesel engine or hydraulik
oil, the symbol fig. 23 will be displayed on the screen.
DANGER
23 Only run the engine if good ventilation is provided. Open
doors and windows, if necessary, to provide sufficient
ventilation.
4.6
CAUTION
Run the engine until the hydraulic oil is at operating

temperature. Low engine and hydraulic oil
temperatures cause the excavator to be sluggish and
unresponsive.
Carefully move the machine outside and check the
function of the travel and swing brakes.
Check if all attachment functions are operating
properly.
25
ENGINE SHUT DOWN PROCEDURE
Do not suddenly turn the engine off when the engines are
running at high idle.
Reduce first the engine RPM to low idle via the arrow key
S229, and continue to run the engine run for 3-5 minutes to
lower the temperature.
Then turn the ignition key to the "O" position (fig. 25) to turn
the engine off and remove the key.
Do not turn the starter while as the engine is running, this

could damage the starter and the starter gear.
EXTERNAL STARTING PROCEDURE 26
CAUTION
Connecting old batteries or batteries which have been

recharged several times to charged batteries may
result in increased gas formation in the discharged
batteries.
Always wear safety glasses and protective gloves and
avoid open flame and formation of sparks in the area
close to the discharged batteries.
Use only battery cables with suitable diameter and
proceed as follows to reduce to a minimum the
formation of sparks.
First connect one cable to the terminal of the

discharged battery and then to the terminal of the
charged (external) battery, next connect the second
cable to the terminal of the discharged battery and
then to the terminal of the charged battery.
Start the engine as described on previous pages .
Before removing the external starting cables, always
bring to low idle the Diesel engine of the excavator and,
if applying, also the Diesel engine of the external
machine.
First disconnect the cable from the terminal of the
charged (external) battery and then from terminal of
the discharged battery, next disconnect the cable from
the terminal of the charged battery and then from the
terminal of the discharged battery.
4.7
HYDRAULIC PUMPS SAFETY OPERATION
. During normal operation of the excavator, the electronic
horsepower control continuously adjusts the pumps flow to
the pressure level of the working circuits.
. If a trouble occurs in the circuit of the regulator, the pumps

are swivelled back to minimal flow.
. However, it remains possible in this case to carry on the

working with the machine (with somewhat reduced pump
power) by changing over the lever 3 on the servo oil unit
which is mounted to the rear face of the spool valve
29 console.
. Disconnect the connector 1 from the solenoid valve, pull

out the pin 2 and tilt the lever 3 in horizontal position (safety
position).
4.8
MACHINE OPERATING SAFETY
Familiarize yourself with job site rules. Be informed corrected immediately.
about traffic and hand signals and safety signs. Ask Do not move the excavator until you are certain
who is responsible for signalling. that no one is endangered by moving the
Check your surrounding for any obstacles in the excavator.
working and movement range, check the load On machines without negative brakes check the
carrying capacity of the terrain, and secure the job brake system before starting to work, as outlined
site to shield it from any public highway traffic. Rope in the Operation and Maintenance Manual.
off the working area of the machine and install the
necessary signs to forbid any non authorized person Never leave the operators seat while the machine
entering the area. is still moving.
Always keep a safe distance from overhangs, walls, Never leave the machine unattended (within view
drop offs, and unstable ground. of machine), with the engine running.
Be alert of changing weather conditions, bad or When moving the excavator, keep the
insufficient visibility and of changing ground uppercarriage in lengthwise direction and keep the
conditions. load as close as possible to the ground.
Be alert for utility lines, check the location of Prevent any working movements, which could tip
underground cables, gas and water lines, and work the machine over. If the excavator begins to tip or
especially careful in that vicinity. If necessary and/ or slip on a grade, immediately lower the attachment
if required, call local authorities to mark the location, and load to the ground and turn the excavator
and take precaution against contact with facing downhill.
underground utilities. If possible, always operate the excavator with the
attachment positioned uphill or downhill, never
Keep sufficient distance to electrical lines. When sideways.
working in the vicinity of high voltage electrical lines,
keep proper distance to assure that the attachment Always travel slowly on rough or slippery ground
does not come close to the lines. DANGER! You and on slopes, and on loose soils.
must inform yourself about safe distances. Always travel downhill at permissible speed, so
Preferably have the electrical lines de-energized (and you dont loose control over the machine. The
lockout / tagged out according to the regulations engine must run at nominal speed, use only the
applicable on the job-site) each time it is possible, foot pedals to brake and slow down the machine.
and in any case if the closeness of the working area Never shift during down hill travel, always shift to
make it necessary. a lower gear before travelling downhill.
In case you do touch a high voltage line by accident, Load an occupied truck only if all safety
proceed as follows: requirements are fulfilled, notably in order to
- do not leave the machine, protect the truck operator.
- move the machine, if possible, from the danger For demolition work, clearing, crane operation,
zone until you obtain sufficient distance, etc. always use the appropriate protection device
- warn any personnel in the vicinity not to come close designed for this specific application.
to the excavator and not to touch it, If operating in visually obstructed terrain or
- instruct or initiate that someone turns off the whenever necessary, have another person guide
voltage. you. Always have only one person signal you.
- Do not leave the machine until you are absolutely
Allow only experienced persons to attach loads or
sure that voltage in the line, which had been
to guide operators. The guide must be visible by
touched or damaged, has been turned off!
the operator and / or must be in voice contact with
Before moving the machine, make sure that the him.
attachments and equipment is secured properly to
Depending on the attachment combination, it is
avoid accidents.
possible for the bucket teeth to hit the cab, the cab
When travelling on public roads, make sure to protection or the boom cylinders. Be very careful
observe traffic regulations, and make sure that the when the bucket teeth get in this range to prevent
machine meets federal and local public highway any damage.
standards.
In case of a thunderstorm:
Always turn on the lights if visibility is bad or if you - lower the attachment to the ground and if
are still working during dusk. possible anchor the digging tool into the soil.
Never allow other personnel on the excavator. - leave the cab and move away from the machine
Operate the excavator only while seated and with the before the storm breaks out. Otherwise, you
seat belt fastened, if installed. must stop the excavator, turn off the radio and
Report any problems or needed repairs to your keep inside the closed cab until the end of the
foreman or supervisor and make sure they are storm.
4.9
LOCATION OF THE TWO JOYSTICKS
The left lever (Fig. 45, pos. 4) controls the stick and swing
movements
The right lever (Fig 45, Pos. 3 ) controls the boom and bucket
movements.
CONTROL OF THE SWING (left joystick)

45
Moving the joystick (Fig. 46, pos. 4) to the left (c) causes the
uppercarriage to turn to the left (Fig. 47).
Moving the joystick 4 to the right (d) causes the uppercarriage to
turn to the right (Fig. 47).
SWING BRAKE
1) Hydraulic service brake:
No deceleration of the uppercarriage is achieved by
moving the swing joystick to neutral position..
46 By moving the joystick to the opposite direction,
maximum hydraulic braking action is achieved..
2) Mechanical parking brake:

A multi disk swing brake, which is integrated in the swing
gear, serves as an additional mechanical brake.
The brake is negatively acting, hydraulically actuated and
serves as a holding or parking brake. .
When working, the swing can be locked in any position
with this brake .
The operating mode of the mechanical brake is pre
selected via the push button S17 (fig. 48)
In one position the brake remains always applied.
In the other position, the brake is in semiautomatic
mode and is controlled via the rocker switch S57 (fig.
47
68) mounted to the right joystick lever:
with the rocker switch S57 tilted down, the brake
is applied when the uppercarriage is at standstill,
respectively it applies as soon as the
uppercarriage speed gets lower than a limit value,
with the switch tilted up, the brake remains
released.
Notice:
The red control light in the button S17 lights up each time the
brake is applied. If this light does not go out when the rocker
switch S57 is tilted up, the button S17 must first be pushed
to pre select the semiautomatic mode.
48
4.12
CAUTION
The brake only applies when the uppercarriage is near
standstill!
In order to stop the uppercarriage when working on a
slope, tilt the switch S57 (fig. 48) down and reduce the
uppercarriage speed by braking with joystick 4.
Move the joystick 4 back to 0 position only after the
brake has applied.
Optional foot pedal for positioning brake

This pedal (Fig. 49, pos. 89) can be actuated progressively
Fig. 49
while working, this allowing a more sensitive deceleration or
positioning of the uppercarriage (necessary as an example
when working on a slope, lifting loads, ).
CAUTION
This pedal should only be used as a positioning and
standstill brake, not to stop continuously the
uppercarriage from maximum swing speed.
Emergency Stop of the uppercarriage swing motion :

The swing brake can be applied independently of the
uppercarriage RPM by pushing the button S17 (Fig. 48) in
position brake applied Fig. 50
CAUTION
Perform this braking via button S17 only in emergency
cases, since it causes fast abrasion of the brakes discs.
To check the swing brake :

Apply the swing brake via push button S17 (Fig. 48).
Then move the left joystick 4 (Fig. 50) to the right and then to
the left to stop.
The brake is working properly if the uppercarriage does not
move.
4.13
CONTROL OF BOOM CYLINDER
(right joystick 3 - fig.57)
Push joystick 3 forward (g) to lower the attachment
(fig.58).
Pull joystick 3 backward (h) to lift the attachment.
CONTROL OF THE BUCKET OR GRAPPLE CYLINDER

(right joystick 3 - fig. 57)
Push joystick 3 to the left (e) to tilt the bucket in or close
the grapple (fig. 58). 57
Push joystick 3 to the right (f) to tilt the bucket out or open
the grapple.
DANGER
Never allow anybody to guide the grapple by hand !
CONTROL OF A SPECIAL EQUIPMENT (TELESCOPIC STICK,

PULLING DEVICE, ... ) 58
The control of special equipments such as telescopic stick

(fig. 59A), pulling device (fig. 59B), hydraulic adjustable
boom, ... is achieved using the two pedals, 7c and 7d (fig.
61).
For special equipments with two hydraulic cylinders, the
second cylinder is controlled via the pedals 7a and 7b
(fig.61) of the right pilot control.
CAUTION
Auxiliary control units can have various functions. Always
check their functions when starting up the machine..
59
CONTROL OF THE BOTTOM DUMP SHOVEL BUCKET

(optional equipment)
The bottom dump shovel bucket is moved via two pedals, 7 a

and 7 b (fig. 61).
Push pedal 7a to open the shovel bucket (fig. 60).
Push pedal 7b to close the shovel bucket.
60
4.15
CONTROL OF HYDRAULIC HAMMER
(optional equipment)
The hydraulic hammer is actuated via the pedal 7d of the
left pilot control (fig. 61).
Notice:
The operation of a hydraulic hammer requires the
previous setting of the correct option which have been
allocated to use of this hammer, using the menu "Set
Option" of the display (fig. 62). Normally the
designation appearing in the lower right corner of the
screen must correspond to the definition of the
installed hammer.
61 In case of a doubt, contact your supervisor to obtain
this information.
CAUTION
The choice of the option in the menu "set option"
determines pressure and oil flow adjustment in the
hydraulic circuit.
A wrong choice of the option could lead to damage or
unsatisfactory operation of the additional equipment.
The choice of the option does neither have an influence
upon the allocation of the pedals, nor lead, to a switching-
off of the pedal function.
62 For operation with a hydraulic hammer:
The hydraulic hammer must be selected with particular care.

When using a hydraulic hammer not permitted by LIEBHERR,
steel structures or the other machine components can become
damaged.
Before beginning breaking tasks, position the machine on firm
and level ground..
Use a hydraulic hammer designed exclusively for breaking
stone, concrete and other breakable materials.
Only operate the hydraulic hammer in the longitudinal direction
of the machine and with the windshield closed or with a front
protective grid.
Ensure during hammer operation that no cylinder is entirely
63 extended or retracted and that the stick is not in the vertical
position.
In order to avoid damages to the machine, try not to break
stone or concrete while performing retraction and extension
motions of the hydraulic hammer.
Do not apply the hydraulic hammer uninterrupted for more
than 15 seconds. at a time to the same place. Change the
breaking point. Too long uninterrupted operation of the
hydraulic hammer leads to an unnecessary overheating of the
hydraulic oil.
Do not use the drop force of the hydraulic hammer to break
stone or other materials. Do not move obstacles with the
hydraulic hammer. Misuse of this nature would damage both
the hammer and the machine.
Do not use the hydraulic hammer to lift objects.
64
4.16
CAUTION
SPECIAL CONTROLS ON US VERSION
On machines sold in North America, the controls for
rotating device, lifting magnet and for float position differ
from those described below. For US version controls, refer
to page 7.01.
CONTROL OF A ROTATING DEVICE

An additional hydraulic circuit for rotating device operation is
65
necessary to drive some specific equipments (such as
rotating grapple, rotating bucket, rotating stick, quick change
coupling, ...).
Depress the switch S19 (fig. 63) to make operative the
control circuit of the added attachment.
The specific equipment with rotating device is then controlled
via the both push buttons S5L and S5R in the left joystick
handle 4 (fig. 64 and 65).
Example: Control of a rotating grapple
If the right button S5R is pushed, the grapple will rotate
clockwise.
If the left button S5L is pushed, the grapple turns
counter clockwise.
The grapple rotates until the buttons are released.
66
CONTROL OF A LIFTING MAGNET (optional equipment)

The control circuit for the lifting magnet as well the hydraulic
driven generator are made alive while depressing the touch
S46 on the rear control desk (control light in the touch S46
must be on).
The lifting magnet is energized and de-energized via the left
push buttons S6L on the right joystick 3 (fig. 66).
COMBINATION OF JOYSTICK MOVEMENTS

A diagonal movement of the joystick combines the
movements of the attachment functions.
This makes it possible for all attachment movements to be
controlled at the same time.
The operator can do the following movements without any
additional manipulations :
When the swing movement is actuated, all working
functions/movements are possible without affecting the
swing movement.
During travel, every attachment movement is possible,
but the swing movement has priority. In this case, the
travel movement is reduced.
68
4.17
5. LUBRICATION
GENERAL SAFETY INFORMATION
It is very important that all guidelines describing lubrication, checking the oil level, replacing the oil are
strictly adhered to!
This maintenance increases the life of the excavator and improves its dependability.
It is especially important to change the oil regularly and in the intervals noted on the maintenance
schedule! Only use specified lubricants and oils!
CAUTION
When checking or replacing the oil, observe the following :

Park the machine on level ground, if not otherwise stated, and turn the engine off.
When working in the engine area, make sure the covers and side doors are secured.
Only add fuel when the engine is turned off.
Never smoke or allow an open flame in refuelling areas.
Cleanliness is especially important when changing engine, gear or hydraulic oil.
Before removing fittings or plugs, make sure the surrounding areas are cleaned.
When changing the oil, clean the fill or drain plugs.
The machine's zone of operation must always remain clear of lubricating materials to
prevent the personnel working in the area from slipping. Be sure to clean excess oil or
grease from the machine, especially where the various bearings are connected to the
central lubrication devices.
IMPORTANT!
Be sure to drain oil into a suitable container and dispose of oil and filter cartridges properly.
5.1
LUBRICANTS AND FUEL CHART R 954 C LITRONIC
VISCOSITY
COMPONENTS SYMBOLS SAE SPECIFICATIONS QUANTITIES
DIN 51 512
DIESEL
ENGINE
43 l.
11.3 USgal.
- Lubricant
Below 25°C ( -13°F ) preheat the engine before starting

API/: CI-4, CH-4
706 l.
- Fuel Use only Diesel fuels with a sulphur content of less than 0,5 %.
186 USgal.
Ethylen glycol based antifreeze and anticorrosive mixture
% of antifreeze:
81 l.
- Coolant
21.3 USgal.
Coolant protected
to:
See recommendations concerning engine coolant on page 5.6.
HYDRAULIC
SYSTEM
570 l.
150 USgal.
In hydraulic
tank
800 l.
211 USgal.
In whole circuit
Warming up the hydraulic system
o
1. For temperatures 18°F (10 C) below the lower limits :
Run engine at half speed. Warm up the hydraulic system by fully actuating
hydraulic cylinders and motors for short periods. Continue to warm up during
about 10 minutes or until operating temperature is reached.
2. For temperatures below the limits listed under 1 :
Preheat hydraulic oil in the tank before starting the engine.
5.2
LUBRICANTS AND FUEL CHART R 954 C Litronic
COMPONENTS SYMBOLS VISCOSITY SPECIFICATIONS QUANTITIES
1) With swing brake only used as a parking brake

SAE 90 or SAE 80W90 API GL-5 and MIL-L-2105 B, C or D
2) With swing brake also used as a service brake 10.5 l.

SWING GEAR
(Actuated via a foot pedal) 2.8 US gal
SAE 90LS API GL-5 and MIL-L-2104 B, C or D

MIL-L-2105 B
2 × 9.5 l.
API GL-5 and
TRAVEL GEAR SAE 90 or SAE 80W90 2×2.5 US
MIL-L-2105 B, C or D
gal
API GL-5 and 10.5 l.

SPLITTERBOX SAE 90 or SAE 80W90
MIL-L-2105 B, C or D 2.8 Us gal
GENERAL
LUBRICATIÓN CONSISTENCY 2 MULTUPURPOSE GREASE
POINTS NL GI N°2 Grade KP2k or EP2
Swing ring (Extreme pressure N°2 Grade)
Attachment
bearings,
Track tensioner,,
Hinges,
couplings, Engine oil
locks
Rubber seal on
doors and Silicon Spray or talcum
covers
REFRIGERATING
1.9 kg
AGENT FOR AIR R 134a
CONDITIONER (4.5 lbs.)
REFRIGERATOR
OIL IN AIR 0,21 l.
CONDITIONER
PAG SP 20 (ELF)
( 5 oz.)
COMPRESSOR
WINDSHIELD Commercial Windshield

5.0 l.
WASHER washer fluid or denatured
SYSTEM 1.3 Us gal
alcohol
5.3
LUBRICANTS AND FUEL SPECIFICATIONS
NOTES ON LUBRICANT AND OPERATING MATERIALS CHART AND ON LUBRICATION

SCHEDULE
The amounts indicated on the lubricant and operating materials chart and on the lubrication schedule
located in the operator's cab are guidelines.
Check level in appropriate aggregate after every oil change or refill.
1) DIESEL ENGINE LUBE OIL:

Lube oil quality
The lube oil guidelines for Liebherr-Diesel engines are based on the following specifications and
guidelines:
API - classification: CI-4, CH-4
(American Petroleum Institute)
ACEA - classification: E4, E5
(Association des Constructeurs Européens de l'Automobile).
Lube oil quality viscosity

The lube oil viscosity must be selected in accordance with the SAE- classification (Society of
Automotive Engineers).
The ambient temperature is definitive for the correct selection of the SAE class.
The SAE class of the Diesel lube oil can be selected using the graph on page 5.2.
Notice:
Too high a viscosity can lead to starting difficulties, and too low a viscosity could jeopardise the
lubricating efficiency.
The selection of the SAE classification gives no indication of the quality of the lube oil.
For ambient temperatures of 20 °C / 4 °F to +45 °C / 113 °F the following Diesel engine oil is
recommended
LIEBHERR Diesel engine oil Identification Nb 8610049 (20 litre drum)
Specification ACEA 4 - SAE 10W-40
Intervals for lube oil and lube oil filter changes

First oil and filter change at 500 operating hours if first filling with oil according to quality E4
Further filter changes every 500 operating hours
Further oil change depending on climate zone, sulphur content in fuel and oil quality according to
the chart below.
If indicated operating hours are not reached within one year, change engine oil and filter at least
once a year.
Oil change intervals for turbocharged engines (in operating hours)
Sulphur content in Oil Quality

Ambient temperature
fuel CI-4, CH-4 E4, E5
0,5 % 250 h 500 h

- 10°C
> 0,5 % 125 h 250 h
0,5 % 125 h 250 h

< - 10°C
> 0,5 % 125 h
5.4
2) DIESEL FUELS:
The Diesel fuels must comply with the minimum requirements of the fuel specifications
prescribed as follows.
Authorised fuel specifications:
DIN EN 590
ASTM D 975-(89a) 1D and 2D
Further fuel specifications only upon consultation with the Diesel Engine Development
Department of LIEBHERR Machines Bulle S.A.
Sulphur content in the Diesel fuel

In DIN EN 590, a max. 350 mg/kg = max. 0.035 weight.% sulphur content is permissible.
Low-sulphur Diesel fuels featuring a sulphur content of below / less than 0.05 weight% are only
applicable if lubricity can be guaranteed with the admixture of additives. The Diesel fuel
lubricating proficiency must be a max.460 µm in accordance with the HFRR (60) test. [lubricity
corrected wear scar diameter (1.4) at 60°C]
For Diesel fuels featuring a sulphur content above / more than 0.5 weight.%, the oil-
change intervals are to be halved.
Diesel fuels featuring a sulphur content above / more than 1 weight% are not permissible.
Note:
In accordance with the Diesel engine lube-oil quality an authorisation can be granted!
Fuel standard ASTM D 975 does not stipulate that the fuels must pass a fuel-lubricity test. A
written confirmation of the fuel supplier must be requested. Any additions should be undertaken
by the supplier as he is responsible for the quality of the fuel. The addition of secondary lubricity-
additives by the customer is not recommended.
Cetane number
A cetane number of at least 45 is required for fuels in accordance with ASTM D975. A cetane
number above 50 is preferable, especially with temperatures below 0°C or 32°F.
Diesel fuel at low temperatures (winter operation)
Diesel fuel precipitates paraffin crystals as the temperature drops. This increases flow-resistance
in the fuel filter to such an extent that a sufficient supply of fuel to the diesel engine can no longer
be guaranteed.
For Diesel fuels complying with the DIN EN 590, in moderate climates, the cold-flow properties
are guaranteed up to:
0°C from 15.04. to 30.09.
-10°C from 01.10. to 15.11.and from 1.3. to 14.04.
-20°C from 16.11. to 29.02.
If the cold-flow properties of the Diesel fuel is insufficient, or with even lower ambient
temperatures than 20°C, we recommend that a fuel filter heating be used.
CAUTION
The mixing, even in low quantity, of regular gasoline, of kerosene, or of other available flow
improvers in order to prevent operating problems at low temperatures is not authorized.
Such an admixture is not compatible with the high pressure fuel injection system of your
Diesel engine and would lead to engine troubles due to insufficient lubricity of the fuel.
Further authorised Diesel fuels:

Diesel fuel in accordance with DIN EN 590 and with up to 5 % vol. FAME are also authorised.
5.5
3) ENGINE COOLANT - Specifications for anticorrosion and antifreeze protection
Using a mixture of antifreeze and anticorrosion with "DCA 4" anticorrosion additive.
To assure the protection from corrosion of the cooling system, the coolant must contain at least
50% corrosion / antifreeze mixture all year round. This protects the cooling system to about - 35°
C ( - 33° F).
When fluid is added to the coolant mixture, it must be assured that the mixture maintains a 50% antifreeze
content.
Caution : The percentage of antifreeze should not exceed 60 % . A higher concentration would lead
to reduced antifreeze and cooling properties.
In addition, the cooling system must contain DCA4 (DCA = Diesel Coolant Additive) from FLEETGUARD. The
prescribed concentration is from 0.3 to 0.8 DCA units per liter of coolant (1.2 to 3.0 units per US Gallon).
The coolant must be changed every 2 years. Before adding new coolant, check the circuit for cleanness and if
necessary flush it with water.
Using a mixture of water and DCA4 (without antifreeze and anticorrosion)

In certain circumstances, and if ambient temperatures are constantly above the freezing point, for instances in
tropical regions, and if there are no corrosion or antifreeze fluids available, then a mixture of water and DCA4
additives may be used.
To maintain sufficient anticorrosion properties however, the DCA4 concentration of the coolant must in this
case be about doubled in comparison with the one prescribed when using a mixture also containing
antifreeze and anticorrosion, it equals a concentration from 0.6 to 1.6 DCA units per liter of coolant (2.4 to 6.0
units per US Gallon) .
Important !
If employing a mixture consisting only of water and DCA4 additives :
the use of coolant refiners (corrosion protective oils) is not authorized,
the coolant change interval must be reduced to once a year.
Checking and maintaining the right DCA4 concentration in the cooling circuit
To check the DCA4 concentration, we recommend the use of the test kit CC 2602 M from FLEETGUARD
(LIEBHERR order No 5608459).
The DCA concentration has to be checked every 500 working hours, after each important coolant make up,
and at regular intervals if smaller coolant quantities are refilled frequently.
If the concentration is too low, or when changing the coolant in the system, the necessary DCA4 units must
be added to the system in liquid form (see schedule).
The LIEBHERR order number for a 0,5 liter can containing 5 DCA4 units is 7363898..
Cooling system Quantity of DCA4 (1) For use with a

capacity liquid(1) mixture containing
(liter / US. 50% antifreeze and
0,5 liter anticorrosion
Gallons) DCA4 units
cans
24 - 39 / 6.3-10.4 3 15
40 - 59 / 10.5-15.7 4 20
60 - 79 / 15.8-20.9 5 25
80 - 115 / 21.0-30.4 8 40
Fresh water guidelines:

To mix the coolant fluid, only clean, preferably soft water should be used. Often, but not always, regular
drinking water can be used. Sea water, brackish waters, sole water or industrial waste water may not be
used.
Fresh water quality
Sum of alkalies (water hardness) 0,6 to 2,7 mmol/l
(3 to 15°d) * * 1° dGH (total hardness - germany)
ph value at 20° C ( 68° F) 6,5 to 8,0 = 1,2° (englisch hardness)
Chloride - ion content max. 80 mg/l = 17.9 ppm (US hardness)
Sulfate - ion content max. 80 mg/l
5.6
The following corrosion and antifreeze fluids may be used:
Approved anti-corrosion / antifreeze fluid (concentrate, undiluted)
Brand........................................................Manufacturer .......................................Country
Agip Antifreeze Plus.................................. Agip Petrol S.p.A., Rom ....................................I
Agip Langzeit-Frostschutz .......................Autol-Werke GmbH, Würzburg ........................ D
Antigel DB 486 .........................................Sotragal S.A., St. Priest .................................. F
Aral Kühlerfrostschutz ..............................Aral AG, Bochum ............................................ D
Avia Frostschutz APN (G48-00) ..............Deutsche Avia-Mineralöl GmbH, München ..... D
BP Antifrost X 2270 A ..............................Deutsche BP AG, Hamburg ............................ D
BP Napgel C 2270 / 1 ..............................BP Chemicals LTD., London ........................ GB
Caltex Engine Coolant DB .......................Caltex UK Ltd, London ................................. GB
Caltex Extended Life Coolant ..................Caltex UK Ltd, London ................................. GB
Castrol Anti-Freeze O ..............................Deutsche Castrol Vertriebs GmbH, Hamburg . D
Century F.L. Anti-Freeze .........................Century Oils, Hanley, Stoke-on-Tent ........... GB
Chevron DEX-COOL Extended Life
Anti-Freeze /Coolant .................................Chevron Texaco.................................... CA USA
DEUTZ Kühlschutzmittel 0101 1490 ........Deutz Service International GmbH, Köln ........ D
Esso Kühlerfrostschutz ............................Esso AG, Hamburg ......................................... D
Fricofin .....................................................Fuchs Mineralölwerke GmbH, Mannheim ....... D
Frostschutz Motorex (G48-00) .................Bucher & Cie, Langenthal ............................ CH
Frostschutz 500 .......................................Mobil Oil AG, Hamburg ................................... D
Glacelf Auto Supra ...................................Total Nederland N.V., Den Haag .................. NL
Glycoshell AF 405 ....................................Shell Deutschland GmbH, Hamburg ............... D
Glycoshell N .............................................Shell Deutschland GmbH, Hamburg ............... D
Glysantin (G 48-00) ..................................BASF AG, Ludwigshafen ................................ D
Havoline XLC ...........................................Arteco, Gent .................................................... B
Havoline DEX-COOL Extended Life
Anti-Freeze/ Coolant .................................Chevron Texaco, San Ramon, ............. CA USA
Igol Antigel Type DB ................................Igol France, Paris ............................................ F
Labo FP 100 ............................................Labo Industrie, Nanterre ................................. F
Motul Anti-Freeze .....................................Motul SA, Aubervilliers .................................... F
OMV Kühlerfrostschutzmittel ...................OMV AG, Schwechat ...................................... A
Organifreeze ............................................Total Deutschland GmbH, Düsseldorf ............ D
OZO Frostschutz S ..................................Total Deutschland GmbH, Düsseldorf ............ D
Total Antigel S-MB 486 ............................Total Deutschland GmbH, Düsseldorf ............ D
Total Frostfrei ...........................................Total Deutschland GmbH, Düsseldorf ............ D
Veedol Anti-Freeze O ..............................Deutsche Veedol GmbH, Düsseldorf .............. D
Wintershall Kühlerschutz .........................Wintershall Mineralöl GmbH, Düsseldorf ........ D
Approved anti-corrosion / anti-freeze fluid / 50:50 premix
Liebherr Anti-Freeze APN Mix Ident-Nr. 8611045 Liebherr ............................................... D
Caltex Extended Life Coolant Pre-Mixed 50/50
(ready-to-use-version)...............................Caltex UK Ltd, London ................................. GB
Chevron DEX-COOL Extended Life Prediluted
50/50 Anti-Freeze/Coolant ........................Chevron Texaco, San Ramon, ............. CA USA
Havoline XLC, 50/50 ................................Arteco, Gent .................................................... B
Havoline DEX-COOL Extended Life Prediluted
50/50 Anti-Freeze/Coolant ........................Chevron Texaco, San Ramon, ............. CA USA
Organicool 50/50 ......................................Total Deutschland GmbH, Düsseldorf ............ D
4) HYDRAULIC OIL :
Hydraulic oil specifications
1. Mineral oils
Recommended and approved are engine oils, which conform to the following specifications
For single viscosity oils API - CD / CCMC- D4 / ACEA - E 1
Mercedes-Benz specifications -page No 226.0 and 227.0
For multi viscosity oil : API - CD +SF / CCMC - D5 / ACEA - E3
Mercedes-Benz specifications -page No 227.5, 228.1 and 228.3
2. Environmentally friendly hydraulic fluids (also called "BIO oils" -biodegradable oils-)
The "environmentally friendly hydraulic fluids" recommended by LIEBHERR are limited to
synthetic ester based hydraulic fluids with a viscosity according to ISO VG 46.
Initial filling is performed ex works according to customer desires.
The use of environmentally friendly hydraulic fluids must be arranged with the LIEBHERR
Co beforehand.
Organic oils should not be used due to their poor temperature consistency.
Notes: It is absolutely necessary never to mix different brands of environmentally friendly
hydraulic fluids or to mix fluids with mineral oils.
For further information on operating while using environmentally friendly hydraulic
fluids, see page 8.7.
5.7
Hydraulic oil change intervals
1. Oil changes in pre-set intervals

Note: Oil changes in pre-set intervals are only permitted for mineral oils. When using environmentally friendly
hydraulic fluids, oil sample analysis reports must be used to determine the time of the oil change, see §2
a) in standard applications
Operating
hours
0 500 1000 1500 2000 2500 3000 3500 4000 4500
b) in dust intensive applications
Operating
hours
0 500 1000 1500 2000 2500 3000 3500 4000 4500
2. Optimised oil change intervals determined through oil sample analysis reports.
Use this procedure to take oil samples in pre-set intervals. The intervals may be extended between two oil
changes as long as the properties of the oil are still satisfactory. The time when the oil must be changed is
determined by the lab report.
LIEBHERR recommends to submit the oil samples to "WEAR- CHECK" for oil analysis. A kit for 6 complete
analysis at WEAR - CHECK is available : Id. No. 7018368 (The kit contains the sample containers,
documentation, shipping container and oil sample hose). A hand pump is required to take the oil sample, and
should be ordered separately (Id. No. 8145666).
a) in standard applications
°nd
2 Other oil samples every 500 hours,
1st
MINERAL Oil
Oil sample
OILS sample
0 500 1000 1500 2000 2500 3000 Operating hours
"BIO" 1st sample

OILS 2nd oil 3rd oil
(New oil Other oil samples every 500 hours,
sample sample
sample)
b) in dust intensive applications

st °nd
1 2 Other oil samples every 250 hours,
Oil Oil
MINERAL
sample sample
OILS
0 250 500 750 1000 1250 1500 Operating hours
"BIO"
OILS 1st sample
2nd oil 3rd oil
(New oil
sample sample
Other oil samples every 250 hours,
sample)
time for oil change determined by lab report.
5.8
DIESEL ENGINE
CHECKING THE ENGINE OIL LEVEL
Park the machine on firm, level ground to check the engine oil
level. Turn the engine off and wait a few minutes for the oil to
collect in the oil pan.
The oil level must be between the minimum and maximum
mark on the dipstick 1 (fig. 1).
CAUTION 1
The engine oil is very hot at or near operating temperature.
Avoid contact with hot oil and components containing oil,
CHANGING THE ENGINE OIL
To drain the oil :

Bring the engine to operating temperature before changing the
oil.
Open the cover on the uppercarriage below the Diesel
engine.
Attach the oil drain hose (fig. 2, pos. 6) to the drain valve
2
7 on the engine oil pan.
Drain the oil into an appropriate container.
To replace the oil filter elements:

The oil filters are arranged in an upright position on the
aggregate carrier of the Diesel (fig. 3).
Prepare a strap spanner, a suitable container and two
original LIEBHERR oil filter cartridges.
Position the suitable container under the diesel engine.
CAUTION
Be careful when removing the filter cartridge to avoid 3
contact with hot oil.
Protect the ribbed V-belt against escaping oil when
replacing the oil filter cartridge!
After replacing the oil filter, remove all traces of oil on the
Diesel engine, as well as behind the vibration damper in
order that this will not be later diagnosed as leaks in the
rotary shaft seal.
Loosen the oil filter cartridges 1 with the strap spanner

and unscrew the filters.
Clean the sealing faces of the filter bracket. The old filter
seal and all of its remnants must be removed.
Apply a thin coat of Diesel engine oil to the rubber sealing
ring on the new oil filter cartridge.
5.11
Screw on the new oil filter cartridge, until the sealing ring
is resting on the filter bracket
Tighten the oil filter cartridge by approx. ½ - ¾. (do not
use any tools for tightening).
To add oil:
Remove the oil filler cap 2 at the top of the rocker box
cover (fig. 5).
Add oil via the oil filler tube 3 until the level is between
the minimum and maximum mark on the dipstick 1 (fig.
1).
5
Clean the oil filler cap 2, reinstall the oil filler cap 2 and
close.
- When adding oil after an oil change or after replacement of

the oil filter cartridges you must in addition:
Start the Diesel engine.
Check the oil pressure on the monitoring display of the
machine and check the oil filters for tightness.
Switch off the Diesel engine.
Check the oil level after 2 - 3 minutes on the dipstick.
CHECKING THE COOLANT LEVEL
ACHTUNG
At or near operating temperature, the engine coolant is
hot and under pressure.
Avoid contact with components containing coolant,
Check coolant level only after the cap of filler neck 6 is
cool enough to touch.
To check the coolant level, turn the cap 6 slowly to
relieve pressure!
5.12
. When the coolant is cold, the coolant level should reach the
top of the filler neck under the cap 6 of the radiator (fig. 10).
ANTIFREEZE AND CORROSION PROTECTION OF THE

COOLANT
. Add the proper antifreeze mixture to the cooling system on a
year round basis, not just in the cold season.
. The excavator is delivered from the factory with a cooling
system protection to -35° C /-31° F (this corresponds to
about 50% antifreeze).
. For the cooling system capacity : see lubrication chart.
. Also the correct concentration of corrosion inhibitors inside
the coolant must be maintained permanently.
. The concentration has to be checked after each important
coolant make up, and at regular intervals if smaller coolant
quantities are refilled frequently.
. If necessary, anticorrosion additives must be added to the
cooling system, refer to page 5.6.
CHANGING THE COOLANT

. The coolant in the cooling system has to be changed at least
once every two years.
. Preferably keep the valves for the cab heating circuit closed
when changing the coolant.
10
. If the coolant in the heating circuit has to be drained too, the
heater core must be vented correctly when refilling the
circuit.
. The water flow through the cab heater is possible only with
ignition key in contact position.
. To drain coolant :
Unscrew the cover of the drain valve 1 at the bottom of
the engine coolant radiator. Attach the drain hose to the
valve 1 and drain the coolant into an appropriate
container.
Remove the cover of the drain valve 2 on the engine oil
cooler housing (fig. 12) and attach the drain hose to the
valve 2.
To add coolant and vent the cooling circuit :

Remove the drain hoses and screw on and retighten the
caps of the drain valves 1 and 2.
Add coolant until the level reaches the top of the filler
tube under the cap 6.
Remount the sealing cap on the expansion tank and
close.
Diesel Start the Diesel engine and allow to run warm.
Check the coolant level again when the Diesel has cooled
off and refill as required.
Important!
When adding coolant, make sure that the expansion tank is
filled up to the top of the filler tube. Add coolant until the level
12
does no longer drop (it is not possible to overfill the coolant
system).
5.13
CHANGING THE OIL IN THE SPLITTERBOX
Fig. 13, pos. 4 shows the oil filler and bleeder screw of the
splitter box and pos. 5 shows the dipstick to check the oil
level.
TO CHECK THE OIL LEVEL

Check the oil level a few minutes after turning off the engine.
TO DRAIN THE OIL

Drain the oil when the oil is at operating temperature
13
To drain, remove the cap on the drain 7 (fig. 14), install drain
hose 6 and drain the oil into an appropriate container.
TO ADD OIL
Add oil to the oil level mark on the dipstick 5, run the engine
for a few minutes, stop it and check again the oil level.
Add some oil again if necessary.
See lubrication chart for oil quantities and specifications.

See maintenance chart for oil change intervals.
14
5.14
CHANGING THE OIL IN THE TRAVEL GEAR
If possible, drain the oil when the oil is at operating

temperature.
Before draining or adding oil, move the machine until the drain
plug 2 is straight below the centre axle of the gear (fig. 17).
If both plugs are situated on different diameters, always take
the outer plug for the drain plug.
TO DRAIN THE OIL

Remove the both plugs and drain the oil into a suitable
container.
TO ADD OIL
17
Remove plug 1.
Reinstall plug 2 and add oil until it drains from bore 1, then
reinstall the plug 1.
See lubrication charts for quantities and specifications.

See maintenance chart for oil change intervals
CHANGING THE OIL IN THE SWING GEAR
If possible, drain the oil when the oil is at operating

temperature.
Fig. 20 shows:
1 : Oil drain valve
4 : Oil filler cover / breather cover
6 : Expansion reservoir for swing gear oil
10 : Swing gear
TO DRAIN THE OIL

Remove the filler cover 4, unscrew the plug of the drain valve
1 through the opening in the sheet in the lower middle area of
the upper carriage structure. Attach an oil drain hose to the
valve 1 and drain the oil into an appropriate container.
Remove the drain hose and reinstall the plug of the drain
valve 1.
Reinstall the protective plate 6.
TO ADD OIL
Add oil via the opening of the cover 4 until the level reaches
the mark "MAXI" of the expansion reservoir 6. Reinstall the
cover 4.
See lubrication charts for quantities and specifications. 20

See maintenance chart for oil change intervals.
5.15
CHECKING THE LEVEL IN THE RESERVOIR OF THE
WINDSHIELD WASHER
. The tank for the windshield washing detergent is mounted

outside, to the outer wall of the operator's cab.
. Regularly check the level in the windshield washer
reservoir , and, if necessary, remove the cover at the filler
neck (fig. 29), and refill the reservoir with standard
windshield washing detergent .
. Quantity : see the lubricants chart.
. Interval : see the lubricants chart.
29
5.18
THE CENTRALIZED LUBRICATION SYSTEM
Your machine is serially fitted with a centralized lubrication

system. With this system all or most of the lube points of the
machine which require at least daily lubrication are lubricated via
an electrical driven grease pump.
This grease pump (fig.38, pos. 3) is mounted in the area behind
the driver's cab.
SERIALLY INSTALLED SEMI-AUTOMATIC SYSTEM OR OPTIONAL

INSTALLED FULLY AUTOMATIC SYSTEM
33
The serially mounted pump (fig.38) is started and stopped by a
push button on the rear control console of the driver's cab (semi
automatic system).
As an option, the system can be fitted with a pump comprising a
control unit (fig.44) which automatically starts and stops the
lubrication procedures during working (automatic system).
CONSTRUCTION
The grease delivered by the pump is distributed to the different
lubrication points in metered quantities, first via the main
distributor 4 (fig. 39) and further via the secondary distributors
mounted to the front of the upper carriage (fig. 33, pos. 5) and to
the working attachment (as an example, the position 6 on figure
35).
The following lubrication points are connected to the centralized 34

lubrication system::
- the ball bearing races of the swing ring (fig. 33, pos. 8)
- the housing around the output pinion of the swing ring (fig. 34,
pos 11), which contains the grease reserves for the swing ring
teeth lubrication,
- All or the most of the lubrication points of standard working

attachments. The position 9 in figure 35 shows as an example
the bearing point bucket tilt cylinder to stick which is connected
to lube system.
On some backhoe attachments, some grease fittings may be

installed separately in the area of the connector bracket and
shifting lever for the digging tool (fig. 36). 35
With special attachments (Telescopic stick, hydraulic offset

boom, ...) some bearing points at the attachment or at the
working tool are possibly not connected to the central
lubrication system.
This bearing points have to be lubricated daily via separately

mounted, red marked lubricating nipples.
CAUTION
When operating a machine and especially if it is fitted with
a special working attachment, make sure to lubricate daily
all the lubrication points which may be installed separately,
i. e. which are not connected to the central lubrication 36
system.
5.19
The lubrication unit complete 2 (fig. 38) mainly consists of a
transparent grease container 13, and an electric motor 14 driving
a lube pump 15. The optional mounted automatic lubrication
pump also comprises a control unit 16 (fig. 44) which starts and
stops the lubricating procedures.
SERIALLY MOUNTED SEMI AUTOMATIC SYSTEM
OPERATION OF THE SEMI AUTOMATIC SYTEM

In the semi automatic system, the pump is controlled by the
push button S84 on the rear control desk of the driver's cab.
Depressing the button S84 alternately turns on and off the lube
pump. When the pump is greasing, the indicator lamp inside the
button lights up.
To lubricate, turn on the button S84 and keep the pump running
until clean grease runs out of the bearing points boom cylinders to
upper carriage (fig 33, pos. 10).
LUBRICATION INTERVALLS
Under normal working conditions a semi automatic lubrication
must be performed daily.
If the machine is used under hard conditions (working under
water, in very abrasive material, ) or in multi shift service,
lubricate more often (up to once a working shift or every 4 hours).
38 OPTIONAL MOUNTED AUTOMATIC SYSTEM

FUNCTION
During a lubricating procedure, all lube points are lubricated one
after the other in a certain sequence (progressive system).
After completion of a lubrication procedure, the pump is turned off
by a proximity switch 7 (fig. 49) mounted to a distribution element
of the main distributor 4.
At each stroke of a piston in this element, the switch 7 gives a
pulse signal to the control unit 16, which stops the lubricating
procedure as soon as the preadjusted number of strokes has
been reached.
During lubrication, the delivery of grease can be checked visually
39
while observing that the indicator stem 27 mounted to the top of
the main distributor 4 (fig. 39) moves alternately in and out.
The flow sequence and amount of lubricant for each lubrication
point depend on the combination of the distributors and
lubrication lines and of the piston size of the distribution elements.
OPERATION OF THE LUBRICATION SYTEM

After turning on the excavator the control light inside the touch
S84 (fig. 40) and the green LED 17 (fig. 41) light up for approx.
1,5 sec. to show that the electric pump is operative.
A lubrication procedure will begin automatically after a "cycle
time" is over and stop after all points have been lubricated, this
without any action by the operator.
5.20
If the lubrication system is in working order, an additional
lubricating procedure of the lube unit can be started any time by
depressing either the push button S84 on the rear control desk (fig.
40) or the touch 19 on the motor housing (fig. 44).
MONITORING OF THE AUTOMATIC LUBRICATION SYTEM.

During a lubrication procedure of the lubrication unit 2, the control
light inside the push button S84 and the green LED 17 are on
continuously.
In case of a failure in the lube circuit (no stroke signal delivered by
the proximity switch 7 about 20 minutes after begin of a lubrication
41
procedure) both LEDs 17 and 18 and the control light inside S84
will start blinking simultaneously.
Possible causes are:
- a plugged or kinked lubrication line, (in this case the grease will
flow out of the relief valve 26, fig. 44), 2 Lubrication unit cpl.
13 Grease container
- a defective switch or defective wire, 14 Electric motor
- the use of too viscous grease at very low temperatures, 15 Grease pump
S84 Control-switch inside the cab
- not enough grease in the grease tank 13,
16* Control unit
- a problem in the 24 V electrical circuit for the motor 14. 17* LED green / Pump operative, resp. pump is
lubricating
Immediately locate and remedy the cause of the trouble. 18* LED red / failure
19* Touch / reset
CD* Rotary switch / Cycle Duration
NS* Rotary switch / Number of strokes
ADJUSTMENT AND GREASE CONSUMPTION FOR AUTOMATIC S84* Monitoring and Reset-switch inside the cab
SYSTEM * With automatic system
The Cycle Duration can be adjusted between 0,5 and 8 hours via
the rotary switch CD (Cycle Duration) after removal of the
transparent protection cover.
From factory, the Cycle Duration is adjusted to 1 hour.
The Number of Strokes to be carried out at main distributor for a
complete lubricating procedure can be adjusted between 1 and 16
via the rotary switch NS (Number of Strokes) after removal of the
transparent protection cover.
From factory, the number of strokes per cycle is adjusted to:
8 strokes for machines fitted with an earthmoving or an
demolition attachment (digging application),
2 strokes for machines with an industry attachment (material
handling application).
The factory adjusted values for cycle duration and number of

3
strokes determine a lubricant consumption of approx. 28 cm
grease per lubrication cycle, it equals approx. 2,5 kg (5.5 lbs)
grease every 100 working hours.
42
5.21
In case the lubrication pump does not work, all lubrication
points connected to the centralized system may be lubricated
via the lube fitting 25 (fig. 46) using a lubrication gun. In this
3
case, press daily or per working shift approx. 200 cm grease
into the fitting 25.
TO REFILL THE GREASE CONTAINER
The grease level in the container 13 of the pump must be

checked weekly, and if necessary, the container refilled.
See the lubricant chart for grease specification.
The refilling of the grease container should only be done via

the special fitting 21.
Insert a grease cartridge in the special filling pump 31 (Id. No.

10009239), connect the pump to the fitting 21 and push the
whole content of the cartridge into the container 13 (fig. 46).
Avoid refilling via the upper tank cover 23, since it could
create an air pocket in the container and cause the pump to
run dry.
For indication of ordering number of grease cartridges, refer

to page 5.9.
Without the special filling pump 31 or grease cartridges, the

container 13 must be refilled through the grease fitting 22 (fig.
46), using a grease gun.
46
5.22
CHANGES IN THE LUBRICATION CIRCUIT
Before you make any changes to the lubrication system (for

example when changing the attachment configuration),
always check with a LIEBHERR mechanic first.
Never remove a line and close off an outlet, which is not
being used, or the whole lubrication system would be
blocked.
Only plug an outlet after the line has been removed from the
distributor and the necessary changes have been achieved at
the corresponding distribution elements.
This applies as well for main distributor 4 (fig. 49) as for 49
secondary distributors 5 (fig. 50).
50
5.23
GRAPPLE LUBRICATION
The grapple must be lubricated regularly.
The lubrication points on the grapple are marked with red dots on easily accessible points (see
arrows).
Every grease fitting must be lubricated daily or once per shift, until clean grease emerges from the
bearing.
Lubricate the grapple in the same intervals as noted for the attachment.
In difficult or severe applications, this lubrication interval must be reduced.
Grease Specification: see Lubrication Schedule.
5.25
MACHINE MAINTENANCE SAFETY
The machine may not be made unsafe when Before any repairs or maintenance work, clean
performing maintenance work. Never attempt any oil, fuel and / or cleaning substances from
maintenance procedures or repairs you do not any fittings and connections.
understand. Dont use any harsh cleaners and use only lint
free cloths.
Check the Operators and Maintenance Manual for
service and maintenance intervals. Make sure you Use only non-flammable cleaning fluids to clean
use only appropriate tools for all maintenance work. the machine.
Refer to your Operators and Maintenance Manual Any welding, torch or grinding work on the
to see, who is authorized to perform certain repairs. machine must be explicitly authorized. Written
The operator should only perform the daily / weekly authorization is necessary for welding on
maintenance procedures. carrying structures. Before any using a welder,
torch or grinder, clean off any dust and dirt and
The remaining work may only be performed by
remove any flammable materials from the
especially trained personnel.
surrounding area. Make sure the area is
Use only replacement parts corresponding to the sufficiently ventilated.
technical requirements specified by the Danger of Fire and Explosion!
manufacturer. This is assured by using only original
Before cleaning the machine with water or steam
Liebherr replacement parts. (high pressure cleaning) or other cleaning fluids,
Always wear proper work clothing when maintaining make sure that all openings, which, for safety
the excavator. Certain work may only be performed and/ or functioning reasons should not be
with a hard hat, safety shoes, safety glasses and exposed to water / steam / cleaners, are covered
gloves. and / or masked off. Especially sensitive are
electrical motors, control boxes and plug
During maintenance, do not allow unauthorized connectors.
personnel to enter the maintenance area.
Make sure that the temperature sensors of the
Secure the maintenance area, as necessary. fire alarm and extinguishers system do not come
Inform the operator before any special or in contact with the hot cleaning fluids, which
maintenance work. Make sure he knows the person, could trigger the fire extinguishing system.
who is in charge of the work. Remove all coverings and masking material after
completing the cleaning procedure.
If not otherwise noted in the Operation and Then check all fuel lines, engine oil lines and
Maintenance Manual, always make sure the hydraulic oil lines for leaks, loose connections,
excavator is parked on firm an level ground and the chafing and / or damage.
engine is turned off. Fix any problems immediately.
During maintenance and service work, make sure If you use a high pressure cleaner with steam or
you always retighten any loosened screw hot water to clean the machine, observe
connections! following recommendations:
- the distance between the nozzle and the
If it is necessary to disconnect or remove any safety
surface to be cleaned must be no lower than
devices during set up, maintenance or repair, make
20 inches
sure that after completion of repairs, the safety
- the water temperature should not exceed 60°c
devices are reinstalled and checked for proper
(140°F)
function.
- limit the water pressure to 80 bar maximum
Before any maintenance work and especially when (11500 PSI)
working under the machine, make sure a Do not - if you employ cleaning fluid, only use neutral
operate tag is attached to the starter switch. cleaning agents such as customary car
Remove the ignition key. shampoos diluted to 2 or 3 percent maximum
After end of maintenance works or repair, restart the Never employ high pressure cleaning apparatus
machine according to the instructions "Machine start during the two first months following machine
up", in this manual. delivery or repainting.
6.1
Observe all product safety guidelines when handling Always support the raised machine in such a way
oils, grease, and other chemical substances. that any shifting to the weight change will not
influence the stability. Do not support the machine
Make sure service fluids and replacement parts are with metal on metal support.
disposed of properly and in an environ-mentally
sound manner. Only qualified, especially trained personnel may
work on travel gear, brake and steering systems.
When using hot service fluids, be very careful. (They
can cause severe burns and injury!). If it becomes necessary that the machine must be
repaired on a grade, block the chains with wedges
Operate combustion motors and fuel operated and secure the uppercarriage to the undercarriage
heaters only in well ventilated areas. Before with the lock pin.
operating these units, check ventilation.
In addition, always follow applicable local Only qualified, especially trained personnel may
regulations. work on the hydraulic system.
Never try to lift heavy parts. Use appropriate lifting Never check for leaks with your bare hands,
devices with sufficient load carrying capacity. When always wear gloves. Fluid escaping from a small
replacing or repairing parts or components, make hole can have enough force to penetrate the skin.
sure they are mounted very carefully on lifting
devices, to prevent any possible danger. Use only Never loosen or remove lines or fittings before the
suitable and technically sound lifting devices, make attachment has been lowered to the ground and
sure that lifting tackle, wire cables, etc. has the engine has been turned off. Then turn the
adequate load carrying capacity. ignition key to contact position with tilted down
Never position yourself, walk or work underneath safety lever, move all servo controls (joysticks and
suspended loads. foot pedals) in both direction to release pressures.
Then release the tank pressure as outlined in this
Never use damaged lifting devices, or devices which Operation and Maintenance Manual.
are not sufficient to carry the load.
Always disconnect the battery cable before
Always wear gloves when handling wire cables.
working on the electrical system or before any arc
Ask only experienced personnel to attach loads and welding on the machine. Always disconnect the
guide and signal the crane operator. The guide must negative (-) cable first and reconnect it last.
be within the visibility range of the operator and / or
must be in direct voice contact with the operator. Check the electrical system regularly.
Make sure that any problems, such as loose
When working overhead, use appropriate and safe connections, burnt out fuses and bulbs, scorched
ladders, scaffolding or other working platforms or chafed cables are fixed immediately by an
designated for that purpose. electrician or qualified personnel.
Never step on parts or components on the machine
when maintaining or repairing items overhead. Use only Original fuses with the specified
When working high above ground, make sure you amperage. Never use a different size or stronger
are fitted with ropes and appropriate safety devices fuse than the original fuse.
which will prevent a possible fall. On machines with electrical medium or high
Always keep handles, steps, railings, platforms and voltage systems:
ladders free of dirt, snow and ice! - If there is any problem with the electrical energy
When working on the attachments, for example supply, turn the machine off immediately.
when replacing the bucket teeth, makes sure the - Follow established lockout / tag out procedures
attachment is supported properly. Never use metal where applicable.
on metal support! - Any work on the electrical system may only be
performed by a qualified electrician or qualified
For safety reasons, never open and remove a track personnel under the guidance and supervision of
chain unless having previously totally released the an electrician, according to electro - technical
pretension of the chain tensioning unit. regulations.
Never work underneath the machine if it is raised or
propped up with the attachment. The undercarriage
must be supported with wooden blocks and
supports.
6.2
On machines with electrical medium or high voltage Changes in shape, which differ from the natural
systems, shape of the hose or line, when under pressure
if there is any problem with the electrical energy or when not under pressure, or in bends or
supply, turn the machine off immediately. curves, such as separation of layers, blister or
bubble formation, crushing or pliure.
Any work on the electrical system may only be
performed by a qualified electrician or qualified Leaks;
personnel under the guidance and supervision of Non observance of installation requirements;
an electrician, according to electro - technical Damage or deformation of hose fittings, which
regulations. might reduce the strength of the fitting or the
If any work is required on any parts which carry connection between hose and fitting;
current, use a second person to turn off the main Any movement of hose away from the fitting;
battery switch, if necessary. Rope the work area off Corrosion on fittings, which might reduce the
with a red and white safety rope or chain, and set up function or the strength of the fitting;
warning signs. Use only insulated tools.
When replacing hoses or lines, always use
When working on medium and high voltage Original replacement parts.
components, shut off the voltage and connect the
supply cable to the ground and ground the Route or install the hoses and lines properly. Do
components, such as the capacitors, with a not mix up the connections!
grounding rod. Always take care to avoid torsional strain when
Check all disconnected parts if they are truly free of installing a new hose. On high pressure hydraulic
current, ground them and close them off quickly. hoses, the mounting screws must be first
Insulate any close-by, current carrying parts. mounted on both hose ends (full flange or half
clamp) and tightened only thereafter.
Hydraulic lines and hoses - Maintenance On high pressure hoses having one curved end,
always tighten first the screws on the curved
safety
hose end and only then the screws on the
straight hose end.
Hydraulic lines and hoses may never be repaired!
Install and tighten the hose clips that may be
All hoses, lines and fittings must be checked daily, mounted on the hose middle only when the both
but at least every 2 weeks for leaks and any hose ends are already tightened.
externally visible damage! Never check for leaks
with your bare hands, use a sheet of paper or Always install hoses so to avoid any friction with
something else. Any damaged sections must be other hoses and parts.
replaced immediately! Escaping oil can cause We recommend to keep a distance between hose
injuries and fires! and other parts of at least one half of the hose
outer diameter. Keep a minimum gap of 1/2 inch
Even if hoses and lines are stored and used in any case.
properly, they undergo a natural aging process. For
that reason, their service life is limited. After mounting a hose connecting two parts that
are movable to each other, check during the
Improper storage, mechanical damage and improper return to service that the hose is not rubbing in
use are the most frequent causes of hose failures. the whole moving range.
Concerning the hoses, you must follow the safety
regulations applicable to your work environment and Check daily that all flanges and covers are fixed
job site and any federal, state and local safety correctly. It will prevent vibrations and damage
requirements. during operation.
Using hoses and lines close to the limit ranges of
permitted use can shorten the service life (for
example at high temperatures, frequent working
cycles, extremely high impulse frequencies, multi
shift or around the clock operations).
Hoses and lines must be replaced if any of the
following points are found during an inspection (see
guidelines ISO 8331):
Damage on the external layer into the inner layer
(such as chaffing, cuts and rips);
Brittleness of the outer layer (crack formation of
the hose material);
6.3
THE FUEL SYSTEM
TO DRAIN AND CLEAN THE FUEL TANK
. The fuel tank bottom is equipped with a drain plug 5 (fig. 2).
. To drain the water of the tank, unscrew the plug 5 about
two turns, then retighten the plug as soon as water free fuel
flows out.
. To empty the tank remove the cover 4 and drain plug 5,
and drain the fuel into a suitable container.
. Regularly check the tank and screen filter 6 for
contamination.
. If necessary, replace the fuel screen filter 6 and/or flush the
fuel tank.
TO DRAIN THE WATER IN THE FUEL PREFILTER
2 . The water separator of the fuel prefilter must be drained

each time the symbol:
. "high water level in fuel prefilter"

. appears on the display.
. Open drain plug 5 (fig. 3) of fuel prefilter 3.
. Drain the water until fuel emerges, then tighten the drain
plug 5.
FUEL FILTERS
Replace the cartridges of fuel prefilter 3 (fig. 8) and the fuel fine
filter 4 every 1000 working hours.
Changing the fuel prefilter
3 Position a collecting container under the fuel prefilter 3.
Clean fuel pre-filter and the surrounding area thoroughly
Disconnect electrical connections of water level sensor
and fuel prewarming (fig. 5 a and b).
Drain fuel : Unscrew bleeder screw 6 and drain plug 5.
Loosen filter cartridge 3 with strap spanner or similar tool
and unscrew.
Unscrew the water separator reservoir 7 from the filter
cartridge 3 (fig. 6).
Dispose of the old filter cartridge 3.
Clean the water separator reservoir 7 with water and dry
with compressed air.
Apply a little oil to the O-ring 9 of the water separator
reservoir.
Screw the water separator reservoir onto the new filter
cartridge 3 until the O-ring 9 is resting on the filter
cartridge.
6.4
Tighten the water separator reservoir 7 by hand from half a
turn.
Tighten the drain plug 5.
Check cleanliness of filter head 8 and ensure that the
thread adapter is sitting securely in the filter head.
Clean the filter head if necessary.
Lubricate sealing ring 10 of the new filter cartridge with
clean fuel.
Fill new filter cartridge 3 with clean fuel and screw on until
the sealing ring 10 is resting on the filter head 8.
Tighten the filter cartridge 3 by hand from half a turn.
Reconnect the electrical connections a and b and close the
bleeder screw 6. 5
Bleed the fuel system.
Changing the fuel fine filter

Position a collecting container under the fuel fine filter 4.
Clean fuel fine filter and the surrounding area thoroughly.
Loosen filter cartridge 4 with strap spanner or similar tool
and unscrew.
Dispose of the old filter cartridge 4.
Check cleanliness of filter head and ensure that the thread
adapter is sitting securely in the filter head.
Clean the filter head if necessary.
Lubricate sealing ring 12 of the new filter cartridge 4 with
clean fuel.
Fill new filter cartridge 4 with clean fuel and screw on until
the sealing ring 12 is resting on the filter head. 6
Tighten the filter cartridge 4 by hand from half a turn.
Bleed the fuel system.
TO BLEED THE FUEL SYSTEM

It is necessary to bleed the fuel system after:
changing of the fuel filter.
cleaning of the fuel tank.
repairs to the fuel system.
running the fuel tank empty.
CAUTION
Do not open any fuel lines, injection lines or screw
connections for bleeding of the fuel system.
Only open the bleeder screw 1 on the filter head of the 7
fine filter 4.
To bleed the fuel system:
Loosen the bleeder screw 1 on the filter head and
unscrew 2 to 3 turns of thread.
Actuate the hand pump 2.
When bubble-free fuel flows out of the bleed screw
tighten bleeder screw 1 again.
Continue to actuate the hand pump 2 until resistance
becomes intense.
Start the Diesel engine.
Repeat the bleeding procedure if the Diesel engine will not
continue to run after starting.
6.5
THE DIESEL ENGINE
COOLING CIRCUIT
. Clean the cooling grid of the water cooler as required.

. To clean:
Blow out the cooling grid with compressed air or
steam jet from the engine room outwards.
. Replace the pressure relief valve filler cap (fig. 9, pos.

6) if it leaks.
. Check the condition and for leaks of the hoses between
9 the radiator and engine and check the heater hoses
regularly
LUBRICATION OF THE STARTER RING GEAR ON THE

FLYWHEEL
. The maintenance cover is mounted on the right-hand

side of the diesel engine on flywheel housing.
. To lubricate the starter ring:
Unscrew the maintenance cover 1 from the flywheel
housing (fig.10).
Only grease the starter ring gear 4, the sensor ring
gear 5 must be free of grease (fig. 11).
10 Check ring gear and, if necessary, grease lightly with
regular lubricating grease.
Turn the engine using the starter and repeat the
lubrication on several points.
Screw on the maintenance cover again.
11
MOUNTING SCREWS
. Check the mounting screws 2 (fig. 12) of the engine

supporting brackets mounts and retighten, if necessary.
(Torque to 280 Nm (207 ft. lbs.)).
. Check the mounting screws 7 (fig. 12) of the engine
rubber mounts and retighten, if necessary. (Torque to
390 Nm (290 ft. lbs.)).
SPLITTERBOX MOUNTING SCREWS
. The mounting screws (fig. 12, pos 3) from splitterbox to

the Diesel engine SAE housing must also be checked
regularly and retightened, if necessary.
12 . Torque: 68 Nm (50 ft. lbs.)
6.6
RIBBED V-BELT
The Diesel engine is equipped with a tensioning device for
the ribbed V-belt for generator and air conditioner
compressor drive. (fig. 13). This is self-tensioning and thus
maintenance-free.
Checking the ribbed V-belt for damage:
Check the V-belt for good condition every 500 working
hours.
Damages to the ribbed V-belt include:
Rib fractures
Transversal fractures in several ribs
Rubber nodules in between the ribs 13
Deposition of dirt or stones
Ribs becoming loosened at the base of the ribs
Transversal fractures on the belt exterior
Replacing the ribbed V-belt:

Make sure that a ratchet, complying with DIN 3122 D
12,5 (1/2"), as well as a new ribbed V-belt are on-hand.
Pivot back the tensioning device against the spring
force in an anticlockwise direction up to the stop(fig.
14)..
Remove the ribbed V-belt
Check tension pulley and belt pulley for sound
condition (e.g. worn bearing of tension pulley, as well
as wear of the belt pulley profile).
If parts are damaged, replace the parts 14
Mount new ribbed V-belt with pivoted back tensioning
device onto the belt pulley of the crankshaft, air-
conditioning compressor, generator and deflection
pulley
OIL SEPARATOR FILTER CRANKCASE BREATHER

The oil separator is mounted on the right-hand side of the
Diesel engine on the same side of the flywheel
The oil separator filter element must be replaced every 1000
working hours.
To replace the oil separator filter element: 15

Ensure that an original LIEBHERR oil separator filter
element is on-hand.
Clean the oil separator and the surrounding area
thoroughly.
Unscrew and remove the oil separator sealing cap, if
required use a screwdriver (fig. 15).
Pull out the oil separator filter element and dispose of in
an environmentally-friendly manner(fig. 16)..
Insert new oil separator filter element and push in up to
the stop.
Mount the oil separator sealing cap and tighten by hand
to the stop.
16
6.7
THE TRACK COMPONENTS
. The tracks are maintenance free until the track pads or

flanges need to be reconditioned or replaced.
. The lifetime seals in carrier rollers, track rollers and idlers
increase the life expectancy of the tracks and protect
from dirt and contamination .
. However, even though the track is virtually maintenance
free, the following points do need to be checked.
17 TIGHTENING THE TRACK TENSION
. Fig. 17 A shows a track, that is not tightened properly,

Fig. 17 B shows a track that is tightened properly.
. The track tension needs to be checked regularly due to
normal wear of the tracks, and tightened, if necessary.
. The track chain tension is correct when the slack
between both carrier rollers is about 1.2 (30 mm).
.
. To check the chain slack (fig. 18) :
. - measure X1, distance between running surface of
carrier roller and top of side frame
. - measure X2, distance between chain link and top of
side frame
18 . - calculate chain slack = X1 - X2.
.
. To tighten a track :
. - Remove the access cover (Fig. 19, pos. 4) on the side
frame of the undercarriage.
. - Attach a special fitting 2 to grease gun 1 (Fig. 20).
. - Connect the grease gun to cylinder 3.,
. - Pump grease into cylinder 3 until the track chain is
properly tensioned.
. To release track tension, carefully release some grease
from the grease cylinder by loosening and turning the
grease fitting counter clockwise.
.
19
DANGER
When adjusting the chain tension, keep your head
clear of the access hole. The grease cylinder is under
high pressure and the chain will sag.
Grease is under high pressure and might squirt out.
20
6.8
To check and clean the magnetic rod and to replace a
filter element :
Remove screws 3 (Fig. 28) and pull off cover 1 with magnetic
rod 2.
Carefully clean magnetic rod 2.
Remove the filter element 5 and insert the new element, with
the LIEBHERR decal on top.
While inserting the new element 5, be sure the O-ring 8 is
not damaged.
Install cover 1 and make sure the seal 6 is seated correctly. 29
Reinstall and regularly tighten the screw 3.
SERVO FILTER
The pressure filter integrated in the control oil unit (fig. 30,
pos. 1) is to be cleaned regularly and the filter cartridge
changed.
For maintenance intervals, see Maintenance Chart.
Cleaning the filter :

Remove the filter, remove the filter element and clean the
filter housing.
To install a new filter element :
Coat with hydraulic oil the O-rings 4 and 5 and the threads
and the sealing faces on the filter head 2 and on the housing
30
1.
Insert with care the new element 3 onto the centring pin 6.
Reattach the filter housing 1, screw it by hand to the stop
and than unscrew it from a quarter turn.
REPAIRING THE HYDRAULIC SYSTEM

Part of the maintenance consists of checking the complete
hydraulic system for leaks, loose connections, frayed, worn
or damaged lines, tubes and hoses and cleaning the
hydraulic cooler as necessary.
DANGER
NEVER CHECK FOR LEAKS WITH YOUR BARE
HANDS.
Fluids escaping from a small hole can have enough
force to penetrate the skin.
Never disconnect lines or hoses before the attachment
is lowered to the ground, the engine is turned off, both
joysticks are moved, with ignition key in contact
position, and the hydraulic pressure in the tank is
relieved by turning the breather filter (Fig. 29, pos. 4).
32
6.11
. High pressure hoses with nominal size NW 20, NW 25, NW
32 and with SAE fittings are installed on your machine (fig.
33).
CAUTION
Any time a high pressure hoses is defective (bubbles,
moisture, damage on the surface, etc...), it must be
replaced. When installing the replacement hose, avoid
any stress and strain on the hose.
Do not turn or twist the hose during installation !
. The following O-rings are needed for hydraulic hoses

33
. NW 20 25×3,53 Id. No. 7367610
. NW 25 32,9×3,53 Id. No. 7367611
. NW 32 37,7×3,5 Id. No 7367612
.
. The mounting screws on the SAE fittings for high pressure
hoses must be tightened to the following torque values:
Torque value in Nm - Quality 10.9
Flange
Screw 4 size Half flange Flange with
without rim
5a rim 5c
5b
M10 62 45 65
M12 108 70 110
M14 172 120 180
M16 264 170 250
.
34 . Notice: tighten the screws 4 evenly and crosswise!
REMOVING THE SUCTION HOSE

. If suction hoses have to be removed, the shut off valve at
the hydraulic tank has to be closed. Turn the valve by 90°
to close (fig.35).
. -A- Open
. -B- Closed
. After the tank pressure is relieved, remove the drain valve
on the suction hose fitting on the side of the pump and
drain the hydraulic oil from the pump into a suitable
container.
. After repair, be certain to return the valve to its original
position, push it in its notch and retighten the bleeder filter
of the hydraulic tank and bleed the hydraulic pumps.
35
BLEEDING THE HYDRAULIC PUMPS
. Bleed the hydraulic pumps after any repairs on the pumps
and/or after every oil change.
. To bleed the left working pump or the swing pump, loosen
the union at the leak oil hose (fig. 36, pos. 2) and let the air
escape. As soon as hydraulic oil flows out of the hose,
reconnect the leak oil hose.
. To bleed the right working pump, loosen the union 3, let the
air escape and retighten the nuts as soon as hydraulic oil
flows out.
. Fill the pumps with hydraulic oil through the same
connection or plug before initial start up, or after repairs or
replacement.
36
6.12
REPLENISHING OIL FILTER IN SWING CIRCUIT
The element of the replenishing oil filter (fig. 41, pos. 1) mounted
to the swing pump must be changed regularly.
For maintenance intervals, see Maintenance Chart
41
LEAKAGE OIL FILTER
The filter collecting the leakage oil of various hydraulic
components is mounted to the rear side of the hydraulic tank (fig.
42, pos. 2), and must be maintained at regular intervals.
During maintenance, the filter element must be replaced or
cleaned .
For maintenance intervals, see Maintenance Chart
Notice: The filter element can be cleaned up to maximum 3
times. After 3 cleanings it must be replaced.
Cleaning the filter:

Remove the filter housing 1, pull out the filter element 3 and
clean both the filter element and housing.
42
To install the new or cleaned filter element: (see also fig. 32)
Coat with hydraulic oil the O-rings 4 and 5 and the threads and
the sealing faces on the filter head 2 and on the housing 1.
Reattach the filter housing 1, screw it by hand to the stop and
than tighten it with a wrench using the hexagon head at the
+10
bottom of the housing 1 (tightening torque: 40 N.m).
Cleaning the filter :

Remove the filter housing 1, pull out the filter element 3 and clean
both the filter element and housing.
To install the new or cleaned filter element :
Coat with hydraulic oil the O-rings 4 and 5 and the threads and the
sealing faces on the filter head 2 and on the housing 1.
Reattach the filter housing 1, screw it by hand to the stop and than
tighten it with a wrench using the hexagon head at the bottom of
the housing 1 (tightening torque: N.m).
THE SWING AND TRAVEL BRAKES

The travel as well as the swing brakes are wet disk brakes, they
are hydraulically vented and fully sealed and integrated into the
travel and swing gear.
They are used as a parking brake and are wear resistant and
maintenance free.
6.14
CHECKING MOUNTING SCREWS
FOR TIGHTNESS
The mounting screws listed below must regularly be checked

and retightened if necessary. See maintenance chart for
check intervals.
MOUNTING SCREWS OF THE COUNTERWEIGHT

This mounting screws M36 10.9 (fig. 45, pos. 1) must be
tightened to 2350 Nm (1730 ft.lbs.).
45
MOUNTING SCREWS OF THE SWING RING

The mounting screws M27 10.9 swing ring to undercarriage
(fig. 46, pos. 3) and upper carriage to swing ring (pos. 4)
must be tightened to 1400 Nm (1030 ft.lbs.).
46
MOUNTING SCREWS OF THE HYDRAULIC OIL AND FUEL

TANK
This mounting screws M20 10.9 (fig. 47, pos. 5) must be
tightened to 560 Nm (413 ft.lbs.).
47
MOUNTING SCREWS OF THE SWING GEAR AND MOTOR

The mounting screws M24 10.9 of the swing gear (fig. 48,
pos. 6) must be tightened to 960 Nm (708 ft.lbs.).
The mounting screws M20 10.9 of the swing motor (pos. 7)
must be tightened to 560 Nm (413 ft.lbs.).
48
6.15
THE DRY AIR FILTER
For maximum engine protection, the air intake system must

be checked and serviced at regular intervals (fig.50).
The air cleaner is designed to give maximum protection at

longest maintenance intervals.
Maintenance consists of replacing the filter elements 3 and

6. We do not recommend to clean the filter elements.
The maintenance indicator (fig. 50, pos. 12) monitors the

depression occurring at the filter outlet, during the Diesel
engine operation.
The coming out of a red stripe in the window 10 shows that

the maximum permissible vacuum of 5 kPa (50 mbar) has
been reached.
This status remains memorized even after the engine has
been shut down (the red strip remains visible in the window
10).
At that time, the corresponding primary filter element must

be replaced.
To reset the vacuum indicator, press the "Reset" button 11

(fig. 51).
50 We recommend that the primary filter element 3 is only

removed and replaced after the maximum permissible
depression has been reached. However, it should be
replaced at least once a year.
Seals between filter elements and the housing 9 can be

damaged if the filters elements are removed too often.
The safety element 6 should be replaced after the primary

element has been changed 3 times, or at least once a year.
Before the new element is installed, carefully clean the seal

and the sealing surface of the filter housing 9.
Manually press to open the dust discharge valve 2 (fig. 50)

once a week so it does not stick together because of dust or
humidity.
51
6.16
CHANGING THE PRIMARY FILTER ELEMENT
Turn the engine off, remove the cover 1 and pull out the
primary element 3 (fig. 53).
Clean the inside of the filter housing and the sealing surface
with a damp rag.
Do not direct compressed air into the housing.
Insert a new element, make sure it is seated correctly and
replace and lock the cover 1.
53
REPLACING THE SAFETY ELEMENT (fig. 55)
The safety element 6 should be replaced at least once a year

or after the main element has been replaced 3 times.
Visually check the safety element. It should be replaced if it

looks dirty.
This safety element should only be replaced by a

LIEBHERR mechanic!
Remove the main element as described before.

Pull out the safety element 6.
Carefully clean the inside of the filter housing with a damp
rag.
Clean the sealing surfaces and check for damage.
Carefully insert the new safety element 6 making sure it is

seated correctly.
Install the main filter element 3 as described previously and

close filter housing.
55
CHECKING THE AIR INLET HOSE (fig. 56)
The air hose between filter and engine air intake pipe 7 must
be checked for damage and leaks whenever the filter
element is replaced.
If necessary, retighten the clamps 8.
56
6.17
THE ELECTRICAL SYSTEM
To insure trouble free operation of your machine, the electrical
system must be in good condition. The gauges, indicators and
components of the electrical system should be checked daily for
proper function.
Always replace burnt out fuses and bulbs. DO NOT repair fuses.
Check for bare and damaged wires which could cause damage
to the electrical system or a fire. Check for loose, dirty or
corroded connections.
IMPORTANT:
When performing repairs on the electrical system, or before
using an arc welder on the machine, tilt the battery switch 2
57
to position B (fig. 57 and 58) to disconnect the batteries
(grounding connection opened).
Cover the electrical components (especially the alternator)
when washing the excavator to protect it from water.
BATTERY MAINTENANCE
In order for the batteries to function properly, it is important to
keep them clean at all times.
The battery poles and cable clamps in particular should be
cleaned regularly and then coated with acid resistant grease (fig.
58).
To check the electrolyte level, open battery compartment door,
lift up rubber cover and remove caps.
The electrolyte level should be 1/2 (10 - 15 mm) above the
plates.
58 If the electrolyte level is low, add distilled water.
Regularly check the specific gravity with a hydrometer. A fully
charged battery should have a value of 1.28 kg/l (31.5°).
Batteries with a lower value should be recharged. Reinstall caps,
check mounting security of batteries and close the battery
compartment door.
DANGER
Wear protective gloves and safety glasses when handling
batteries!
Keep sparks and open flame away from battery.
Battery fumes are highly flammable and explosive.
Batteries contain acid which should not be touched. In
case of contact, flush with water and get medical attention.
ARRANGEMENT OF THE CIRCUIT BREAKERS AND FUSES

The fuses F1 to F15 are located on the printed circuit in the
electrical box of the left control console (fig. 64). Lift off the cover
to get to the box.
All other fuses and circuit breakers are located in the junction box
E50 (fig. 60, pos. 1) near the hydraulic pumps.
To rearm the circuit breakers F19, F20, F21, F109 and F110,
push the corresponding button.
CAUTION
Use only original replacement fuses. If fuses blow
frequently, the defect in the affected circuit must be
checked and corrected. Never repair a blown fuse!
60
6.18
LOCATION OF FUSES AND CIRCUIT BREAKERS
F1.....................................................................Reserve F19 .................................................. Flame glow plug 1
F2........ Reserve, Control circuit additional floodlights* F19-2 ............................................... Flame glow plug 2
F3................................... Reserve, Central lubrication*, F20 ............................................................. Main circuit
.......................................... Swing ring teeth lubrication' F109 ............................. Options, additional floodlights*
................... windshield wiper and washer for cab roof* F110 .................... Diesel engine regulator box, Control
F4............ Windshield washer, beacon*, rotating grab*, .............. circuits for starters and preglow, fuel injection
.......... 24V stabilized supply for sensors and detectors
F5.............................................Windshield wiper motor F31 .................Heater and air conditioner (terminal 15)
F6............................. Regulation engine RPM / manual F33 ................................................................. Reserve
F7............................................ Control unit and Display F34 ............................. Additional floodlights / cab front
F8...........Safety lever, Control circuits for servo circuit, F35 ........................... Additional attachment floodlights
.....................................Swing brake & pressure cut in* F35-2 ........................ Additional attachment floodlights
F9... Regulation circuit for hydraulic pumps (U16 - Bst) F36 .............................. Additional floodlights / cab rear
F10.......... Floodlights on upper carriage and cab deck, F37 .................Heater and air conditioner (terminal 30)
...................... Solenoid valve for travel speed increase F115 .......... Engine speed adjustment in manual mode
F11................................................................... Reserve F116 ..................................... Diesel engine control unit
F12................................................................... Reserve F117 ..................................... Diesel engine control unit
F13................................... Ignition key / Starting circuit, F122 ...................................................... Preglow signal
F14.......................Dome light, Cigarettes lighter, Horn, F123 ....................................................Preglow signal *
......................................Additional floodlights*, reserve
F15..............................................Reserve (terminal 30) * Optional Installation
F5 to F7, F13, F31, F115 to F123 ..Fuses.............7,5 A F10 .......................................... Fuse....................25 A

F1 to F4, F8, F9, F11, F12, F14, F 19, F19-2 .............................. Circuit breaker ....100A
F15, F33 to F37 ..............................Fuses.............15 A F 20, F 109, F110 .................... Circuit breakers ..50 A
6. 19
THE HEATER AND AIR CONDITIONER
. Heater and air conditioner unit
. Remove and clean the re-circulated air filter 4 and the

fresh air filter 5 of the air conditioner unit every 500
working hours and more often in very dusty conditions.
. If the filters are contaminated, the air flow through the

exchangers is reduced, this causing frequent icing and
stop of the air co plant.
. Blow out the filter elements with pressure air, or clean

them in cold or lukewarm water. Never wash the
65 elements with warm water or using a steam jet. Filter
elements which are damaged or in bad condition must be
replaced at once.
. Never operate the machine, even for a short time when

the filters are removed, this would cause a very quick
clogging of the heat exchangers of the unit.
. To remove the re circulated air filter 4, tilt the backrest of

the driver's seat forward and turn both quick locks (pos.2,
fig. 65) by 90 degrees.
. The fresh air filter 5 is accessible from the outside of the

cab, after removal of the deflector 6 (fig. 66).
. Once a year check for damage the lamellas of the heat

66 exchanger 9 (evaporator and heater unit) and in case of
clogging blow the exchanger out with pressure air .
. If necessary put the lamellas straight.
.
. Heater circuit
. The following maintenance should be performed annually
before the beginning of the cold season:
. - check the heater water circuit for leaks,
. - check and if necessary retighten all connections, hose
clamps and the seals on the water valves,
. The heater should only be used with a DCA4 antifreeze

and anticorrosive mixture. When changing the engine
coolant, close the heater valves on the engine (fig. 67).
67 Otherwise the heater core must be vented correctly after
refilling the circuit.
. To vent the circuit, remove the red cap at bleeder valve

through the opening A (fig.65), press the valve to let the
air escape.
. In addition, annually before the beginning of the cold

season, and at least if insufficient heating is noticed,
remove and clean the solenoid valve Y46 (fig. 68) which
controls the warm water flow.
. Clean the membrane of the solenoid valve with clear
water and check that the compensation orifice at the
membrane is not clogged.
68
6.20
The air conditioner plant
Operate the air conditioner every second week for about
10 minutes regardless of the season.
During the warm season, perform following checks or
maintenance works every 500 operating hours :
- check the condenser heat exchanger for clogging, if
necessary swing the exchanger out and blow it out from
inside (fan side) using pressure air or steam jet until the
cooler core is clean. A chocked exchanger core would
cause the pressure to increase in the coolant circuit and
the air conditioner to be automatically turned off.
- check and retighten the mounting screws of the 69
compressor and its support to the Diesel engine,
- check for tension and good condition of the compressor
driving belt (fig. 69),
- check the refrigerating agent level at the sight glass 3 of
the drier / receiver unit 7 (fig. 70), with Diesel engine
running and turned on air conditioner: if the white float
ball 4 (fig. 71) is in the bottom of the sight glass it
indicates a lack of refrigerating agent. If in this case a
drop of the refrigerating efficiency is noticed, get the
installation refilled by an air conditioner specialist.
- determine the degree of moisture in the drying substance
inside the drier while checking the colour of the indicator
pearl 5 (fig. 71) in the sight glass: the degree of
moisture is correct as long as the pearl is blue, at the 70
contrary if the pearl is rose coloured, the drier / receiver
unit is saturated with humidity and must be replaced
immediately.
- visually check the condition of the refrigerating agent drier
/ receiver unit 7. If mechanical damage or rust formation
is noticed (also at mounting console or hose
connections) the receiver must be replaced (Pressure
reservoir).
In the both last cases and at least once a year, the drier /
receiver unit 7 must be replaced by a qualified air
conditioner mechanic.
The air conditioner circuit must then be drained, checked for
leaks and then refilled with refrigerating agent and
refrigerating oil for the air co compressor
71
On the occasion also check the hoses of the air conditioner
circuit for externally visible damage and if necessary
retighten the hose fittings .
In addition, the following maintenance works must be
performed at least once a year by an air conditioner
specialist:
- check the function of the motor M13 for the evaporator
fan and of air dispatching flaps,
- check the air co electrical circuit for good connections and
the electrical wires for external damage,
- check the thermostat B43 inside the evaporator unit (for
function, correct fixing and damage),
- check the correct function of the pressure switches B44 at
the drier / receiver unit 7. 72
6.21
REPLACING WEAR AND TEAR ITEMS
In addition to regulator maintenance, which is to be performed at given intervals, the following repairs
may be performed by the operator or maintenance personnel:
Replacing the worn teeth on the bucket, see page 6.22.
Replacing the defective seals on hoses and pipes and connections to the hydraulic
components.(However, the operator may not work on the pressure relief valves, which are
secured with lead seals.)
Replacing hydraulic hoses, lines, and fittings in the hydraulic circuit.
Use only genuine LIEBHERR parts (i.e. hoses, hydraulic lines).

All other repairs should only be done by trained LIEBHERR service personnel.
Always consult your LIEBHERR dealer, especially when removing counterweight.
WELDING
Any welding on structural parts may only be done by LIEBHERR service personnel. If this rule is
neglected, the warranty is voided.
Before welding repairs on other parts, always disconnect the battery. Always remove the negative
terminal first and reconnect it last.
CAUTION
Before welding, connect the ground cable as close as possible to the welding point, so the
welding current will not run through the swing ring, joints, gears, bushings, rubber parts
and seals.
Should welding repairs be done on components which may contain inflammable gases
(welded counterweights, hydraulic tanks, fuel tanks, ), these components must be
previously and sufficiently ventilated with pressurized air to avoid all fire or explosion
hazard.
6.23
Check / Maintenance
at Operating Hours Works to be performed
R 954C LITRONIC
by maintenance personnel By authorized trained personnel Notes,
performance
(Operator) guidelines
First and only interval Repeat interval For fill quantities,

see lubrication
chart
DIESEL ENGINE & SPLITTERBOX

Check engine oil level
Check oil pressure and coolant temperature during operation
Check clogging of air filter at maintenance indicator
Check coolant level
Drain fuel tank
Check oil level in splitter box
Empty dust discharge valve at air filter
Replace oil in the splitter box
Check and clean cooler, ventilator check coolant system for leaks
Check condition and tension of ribbed V-belt
Replace lube oil filter cartridge
Change engine oil 1)
Check the concentration of anticorrosion additive DCA4 in the coolant
Check and adjust valve play
Check mounting of engine control unit for good condition
Check detectors, transmitters and cable connectors for good condition
Check the flap of the Diesel engine brake
Check mounting screws of engine consoles, oil pan and splitter box
Check intake and exhaust system for condition and tightness
Grease flywheel teeth
Replace fuel pre filter cartridge (or if power loss)
Replace fuel fine filter cartridge (or if power loss)
Replace oil separator filter element
Check as necessary adjust or replace fuel injectors (or if power loss)
Have this works performed by an authorized LIEBHERR representative
Replace antifreeze and anticorrosive coolant mixture (every 3000 hours)
Empty water separator at fuel filter (as necess, at least every 500 hours)
Replace main element on air filter (as necessary, at least once a year)
Replace safety element on air filter (as necessary, at least once a year)!
Check air hoses between air filter and engine ( at filter maintenance )
Check heater flange at intake manifold (yearly at begin of cold season)
6.25
Check / Maintenance
performance
For fill quantities,

First and only interval Repeat interval
see lubrication
chart
HYDRAULIC SYSTEM
Check oil level in hydraulic tank
Clean magnetic rods in return filters (daily during the first 300 hrs.)
Replace servo oil filter on servo oil unit
Replace replenishing oil filter on swing pump
Check mounting of components
Drain condensation water at hydraulic tank
( When using environmentally friendly hydraulic fluids keep water
percentage below 0,1%, if necessary install a bypass oil filter)
If mounted check return filter for hydraulic hammer for cleanliness,
replace element if necessary
Replace return filter cartridges (first at 500 hours.) 2)
Clean or replace the filter element of leakage oil filter (first at 500
hours.).Replacement necessary after maximum 3 cleanings
If mounted, replace bypass oil filter element ( first 500 hours. and at
2)
least every 6 months )
Check cleanliness of hydraulic oil cooler, clean it as necessary
Check hydraulic system for function and leaks
Check and adjust primary and secondary pressure relief valves
Bleed servo system and hydraulic pumps
Replace hydraulic oil ( or optimize intervals according to oil sample
2) 3)
analysis reports )
Replace breather filter on hydraulic tank 2)
ELECTRICAL SYSTEM
Check indicator lights and gauges on control panel when starting
Check head and floodlights
Check level and specific gravity of electrolyte in the batteries
Check and clean battery terminals
Check system and components for function
SWING GEAR
Check oil level and for leaks
Replace gear oil (first at 500 hrs.)
Check function and operation of swing brake
Check mounting of gear and oil motor
6. 26
Check / Maintenance
Notes,
by maintenance personnel By authorized trained personnel
performance

First and only interval Repeat interval see lubrication
chart
SWING RING
Lube swing ring bearing
Check, if necessary tighten mounting screws
Check pinion gear mesh
TRAVEL GEARS
Check oil level and for leaks
Check function and operation of travel brakes
Check mounting screws of gears, sprocket wheels and oil motors
SAE 90 oder SAE
Replace gear oil (first at 500 hrs.) 80W90
TRACKS
Check track chain tension visually, retighten if necessary
Clean track chains (after working hours)
Check and tighten mounting screws of track pads and sprocket wheels
Clean and lubricate sliding surfaces of chain tensioners
Check idlers, carrier and track rollers for leaks
CAB & HEATER

Check level in reservoir for windshield washer, refill if necessary
Check function of heater, (before start of cold season)
Check heater system for leaks
Check and grease locks and hinges on doors and windows
Check the warm water solenoid valve for function and chocking, clean it
as necessary
6.27
Check / Maintenance
performance

First and only interval Repeat interval see lubrication
char
AIR CONDITIONER
Operate the air conditioner (at least once every second week)
Check the condition of condenser, blow it out if necessary
Clean, if necessary replace both air filters in air co unit.
Reduce maintenance interval in very dusty conditions
Check the mounting screws and the drive belt of air co compressor
Check the drier / receiver unit for moisture degree, coolant level and good
condition (no rust), replace it if necessary
Check the condition of evaporator unit, clean as necessary
Check electrical wires for damage and for loose connections
Check pressure switch for function
Check efficiency of air conditioner after opening the circuit, repairs or as
necessary
Yearly replace the drier receiver unit, for the occasion check the whole
circuit for leaks and replace refrigerating agent and refrigerator oil
Yearly have the function of the air flaps and of the defrosting thermostat
checked by a refrigeration specialist.
UNDER / UPPERCARRIAGE, & ATTACHMENTS

Check bucket teeth visually for wear
Lubricate all grease and lubrication points
Check all parts for cracks
Check mounting screws of counterweight and tanks for tightness
Check and lubricate cover hinges and locks, check mounting and
efficiency of cover lifting cylinders
Check the lowering speed of the attachment 5 Sec
Explain proper use and maintenance to the operator
Ask the operator to lubricate the machine using the lube chart, explain
defects and deficiencies.
The daily maintenance work of the driver include the check of the proper
function of hydraulic, electric and brakes systems before starting
operation. He must also perform daily a visual check of engine, hydraulic
system, gears, and track parts for leaks.
1) Depending on temperature, fuel and oil qualities, the intervals for engine lube oil changes may be reduced,
see page 5.4
2) If very dusty working atmosphere, the intervals for replacing the filters may be reduced, see specials
instructions on page 5.9
3) When using environmentally friendly hydraulic fluids, maintenance interval must be determined through oil
sample analysis reports
) For industrial attachment perform check every 250 hrs
6. 28
CONTROLS ON JOYSTICK HANDLES
FOR US - VERSION
FUNCTIONS CONTROLLED VIA THE SWITCHES IN THE
HANDLE OF LEFT JOYSTICK 4 (fig. 1)
S55 = Lifting magnet ON / OFF

S5L = Unlocking of end position of a cylinder
S5M = Horn
S5R = Travel alarm cut-off
Operation of lifting magnet 1

Rocker switch S55 DOWN = Magnet OFF
Rocker switch S55 UP = Magnet ON
Travel alarm cut-off

Each time the travel pedal is pushed, the travel alarm will
sound automatically.
This sound can be silenced earliest 10 seconds after travel
start with push button S5R
The travel alarm will be reactivated with every new travel
operation.
Unlocking of end position of a cylinder

Press S5L to unlock a cylinder end position that has previously
been preselected via switch S54, also see switch S54.
FUNCTIONS CONTROLLED VIA THE SWITCHES IN THE

HANDLE OF RIGHT JOYSTICK 3 (fig. 3)
S6L = Rotating device left (grapple, scrap shear, ...)

S6M = Float position boom
S6R = Rotating device right
S57 = Swing brake semi automatic mode
(standart function on R 934 and above, see page
4.12).
7.1
GUIDELINES FOR HYDRAULIC EXCAVATORS
WHEN THEY ARE USED FOR LIFTING LOADS SUCH AS PIPES, GIRDERS, ETC. .
GENERAL
On April 1, 1976, the German trade unions for below grade and earthmoving construction put safety
guidelines in force for excavators, loaders, dozers, etc. , VBG 40, governing hydraulic excavator use,
especially when they are used for lifting and transporting loads overhead. These new safety guidelines must
be observed.
Overhead lifting, handling and transporting of loads such as pipes, girders, etc.(lifting operation), requires
different safety guidelines than just removing, loading and unloading dirt, stone, minerals etc. (digging or
excavating operation), because another person (or persons) is required to enter the swing range of the
excavator in order to attach or remove the load on boom or stick.
To protect these persons attaching or removing the loads during lifting operation, certain requirements have
to be met by excavators, which are used for lifting loads overhead.
Hydraulic excavators, when they are used for lifting operation, must have all the following mentioned special
safety devices installed :
A load hooking system which must ensure safe attaching and removing of the loads and be designed
such that accidental unhooking or uncontrolled movement is minimized.
An overload warning device must be installed, which alerts the operator optically via a warning symbol
and acoustically via a buzzer that the weight of the load is heavier than the load permitted by the rated
lift capacity chart.
A boom lowering control device (such as load check valves) must be installed according to the
international standard ISO 8643 to prevent unintentional lowering or dropping of the boom because of
the weight of the load, which could happen if a line in this hydraulic circuit suddenly develops a leak (for
example, should a hydraulic line break or a hose burst,...).
These valves are installed between the boom cylinders, see fig. 12 (or the stick cylinder) and the control
valve block, directly on hydraulic pressure connections of cylinders.
With a rated lift capacity chart attached inside the cab and within the view of the operator.
Every LIEBHERR hydraulic excavator can be fitted with an overload warning device and/or with
load check valves.
DANGER
Never use your machine for lifting operation without it is fitted with all the above mentioned devices.
Never lift loads over people.
No person may fasten or unfasten a load without approval of the operator and this person may only
approach the load from one side. The operator may only approve this action when the excavator has
stopped and the attachment is not moving.
Only employ sling ropes and accessories which are permitted for lifting operation, regularly checked
and in good condition.
7.3
THE OVERLOAD WARNING DEVICE
An overload warning device does not stop a machine when the permissible load range is
exceeded.
The operator and nearby personnel are only informed and alerted about the fact that the
authorized lift capacity has been reached.
The overload warning device may only be used for lifting operation. For digging operation, the
overload warning device must be turned off.
FUNCTION
The overload warning device warns the operator optically via a warning symbol on the display
(fig. 24A) and acoustically via a buzzer when the maximum lift capacity (per ISO 10567) has
been reached. The device does not turn the excavator off.
The signal is given by a pressure switch 1, which is connected with the piston bottom side of the
boom cylinders.
Every reach has a corresponding lift capacity. When a load corresponding to this weight is
attached, pressure is created in the boom cylinders and the overload warning device is
actuated at a certain pressure.
This capacity can be changed and set by adjusting the pressure setting on the switch
depending on the boom position via cam plate 2 and lever 3.
The cam plate is designed to adjust the pressure setting of the switch in relation to the boom
position.
Depending on the machine type (with or without outriggers, different track or wheel base width
or different types of attachments), appropriate cam plates can be installed on the overload
warning device to the right of the swing ring bearing mount.
As per ISO 10567 the rated lift capacity chart indicates either 75% of the static tipping load or
87% of the hydraulic lift capacity (smaller of both).
The stability margin of 25% is valid with the machine on firm, flat ground and for full
uppercarriage swing.
OPERATION OF OVERLOAD WARNING DEVICE

For lifting operation
Adjust the overload warning device before using it for the first time.
To put the overload warning device in operation:
Move lever 3 on switch 1 into working position,
Open shut off valve 5 (move it to position A),
Turn the overload warning device on via switch S18.
CAUTION
Make sure to observe all accident prevention regulations when lifting loads with an
Only lift loads of known weight, check your attachment data sheets for load limits, which
differ by machine type.
For digging operation

The overload warning device may only be used for lifting operation
For excavating work, turn the overload warning device off as follows:
Turn the overload warning device off on switch S18,
Close the shut off valve 5,
Turn the lever 3 on switch 1 to off position and lock it.
Function Tests
Check all moving parts regularly for easy movement and lubricate them.
Check the function of the system daily by extending the boom cylinder all the way to build
up maximum operating pressure. The overload device must then actuate the warning
buzzer and indicator light.
7.5
21
22
23 24
7.6
If an excavator is used for lifting operation, it must be tested once a year for stability:
Choose any combination of lift capacity / reach in the rated lift capacity chart which is
valid for the attachment, which is installed on your machine,
multiply the weight by 1,25 and attach this test load to the attachment, at the chosen
reach,
slightly lift the load,
the machine may not tilt, the overload warning device must give and optical and
acoustical warning signal.
Important ! This test is - besides a stability test - only a function test for the warning system
(qualitative test), it does not mean that the adjustment is correct.
For this reason, the warning device must be checked once a year and adjusted, if necessary, as
described below (quantitative test).
TEST AND ADJUSTMENT
Adjustment with boom up (point A)

Remove the cap on test point 6, mount a 0-400 bar pressure gauge 7 so the gauge is visible
from the cab.
Move the boom up all the way and, if necessary, adjust bracket 8 via the eccentric plate 10 until
roller 4 is exactly on the mark for point A on cam plate 2.
Turn on the warning device on the instrument panel (fig. 24, pos. S18) and open the shut off
valve 5 between the warning device and the boom cylinder connection (Position A).
Move the joystick slightly, extend the boom all the way to build up the pressure set on point A
on cam plate 2.
This must actuate the warning device.
If the warning device does not turn on (warning symbol and acoustical signal), the shifting point
on switch 1 must be reduced.
Remove side cap and adjust screw SA (fig. 23) :
turn clockwise to increase pressure,
turn counter clockwise to decrease pressure.
A lower shifting point is permissible.
Adjustment with boom down (point B)

Lower the boom until point B on the cam plate is reached.
Build up pressure as set on point B, as follows:
turn off shut off valve 5, and via an additional L-fitting 11 between pressure gauge and L-fitting 9
(fig. 21), build up pressure on the switch 1,
either with a separate hand pump
or via a mini test hose, connected to a pressure test point of the main control valve block
for high pressure. The pressure is increased through this hose as soon as any movement
is selected.
When the set pressure is reached, the overload warning device must actuate.
If this is not the case, take off the upper cap and adjust the screw SB on the switch1 (fig. 23) :
turn clockwise to increase pressure,
turn counter clockwise to decrease pressure.
A lower shifting point is permissible.
Reinstall caps for screws SA and SB, remove pump, mini test hose and pressure gauge,
check all moving parts of the overload warning device for easy movement.
7.7
HYDRAULIC QUICK CHANGE ADAPTER (SWH)
SAFETY RECOMMENDATIONS
The operator must make sure every time any tool is changed that the locking
pins of the quick change coupler are inserted into the bore holes provided on
the tool and that the tool is attached properly.
Make a direct visual check that the tool is fitted securely.
In addition, the operator must perform a cycle with the tool where the tool
may only be raised far enough that the secure fitting, e.g. if the pins are in the
pin holes, can be checked by tilting the tool in and out.
Check fitting of locking pins visually on a daily basis.
Check for proper function of warning devices visually and acoustically by

actuating the SWH coupler.
If a buzzer sounds or a warning symbol lights up and no locking or unlocking

procedure was initiated, shut down operation immediately.
This may be due to the locking pins changing their fitting position unchecked,
e.g. because of leakage.
If buzzer/warning light are not actuated during any procedure, shut down
operation immediately. This may be due to breaks in the cable, a defective
plug connection or a defective proximity switch.
Operation may only be reinitiated after defective parts have been repaired or
replaced.
The load capacity of the hydraulic quick change coupler (SWH) and/or the
integrated load hook can be less than or greater than the load capacity of the
basic machine.
During operation, make sure that the values found on the load capacity chart
and in the Technical Data of the basic machine are maintained when
checking the authorized load capacity of the SWH and/or the integrated load
hook.
8.2.1
HYDRAULIC QUICK CHANGE COUPLER
(SWH)
a coupler
b locking pins (extended)
c attachment hook for tool
d stop
g load hook
3 right joystick
4 left joystick with push-buttons left / right 1
S47 push-button quick change coupler

(S47 was a key switch up to approx. 12-2004)
S19 push button for grapple rotation drive
symbol locking pins inserted on the screen
TECHNICAL DATA
Maximum operating pressure 100 bar.
PUSH BUTTON S19 (fig. 3)

2
The hydraulic additional attachment function "rotating
device" is actuated via push button S19 (indicator light in
the button lights up).
SYMBOL Locking pins inserted (fig. 3)

If this symbol appears on the screen, the pins are
retracted (tool unlocked)
DANGER
The working tool is only connected to the attachment hook
of the quick change coupler
PUSH-BUTTON SWITCH S47 (fig. 4)

POSITION "0"
In zero position the locking pins of the quick change
coupler SWH cannot be retracted.
POSITION "I"
When, The locking pins can be retracted if push button S19
is on and if at the same time the switch S47 is maintained
in position "I", this means:
- with the key switch S47: turn the key clockwise to
position " I " and then depress and keep the key
depressed.
- with the push button S47: press down and hold the 4
button depressed.
8.2.3
JOYSTICK RIGHT 3 (fig. 5)
TOWARD e = extend bucket cylinder.
TOWARD f = retract bucket cylinder.
JOYSTICK LEFT 4 (fig. 6)

PUSH-BUTTON LEFT S5L = extend locking pins
(locking the working tool).
PUSH-BUTTON RIGHT S5R = retract the locking pins
(unlocking the working tool).
BOTH HANDS CONTROL

The quick change coupler SWH is controlled by using both
hands. The locking pins may only be retracted when push
button S19 is actuated and at the same time push-button
6 switch S47 and the push-button S5R on the left joystick are
depressed.
Notice:
At the opposite, when extending the locking pins via the
touch S5L (locking of the quick change coupler), it is not
necessary to depress the push button S47 at the same
time.
INSTALLATION OF A WORKING TOOL

Position stick and tool as in figure 7.
CAUTION
7
The tool must be lying freely on level ground.
Deflect right joystick 3 (fig. 5) toward f and retract the bucket
cylinder fully.
Switch on the additional attachment function rotating device
by actuating push button S19 (fig. 3) (indicator light on the
button lights up).
Depress the push-button switch S47 (fig. 4) and keep it
depressed.
With switch S47 depressed, press right push-button S5R on
left joystick 4 (fig. 6) until the locking pins (fig. 1, pos. B) are
fully retracted.
The symbol locking pins retracted appears on the screen
and the buzzer sounds.
Release switch S47.
8.2.4
ATTACHING THE WORKING TOOL
Position the quick change coupler in such a way that the tool
can be mounted on the attachment hook (fig. 9 and 10) .
Backhoe buckets can alternatively be used as front buckets
after changing the attachment pins.
Raise the tool from the ground and extend the bucket cylinder
until the bearing plates of the tool (fig. 11) are resting at the
stops of the quick change coupler SWH (fig. 1, pos. d).
The attachment bore holes of the tool must be flush with the
locking pins (fig. 11 and 12).
CAUTION 9
Keep tools near the ground.
LOCKING THE COUPLER

With the push button S19 activated, press left push-button
S5L (fig. 6) on left joystick 4 until the locking pins are
completely out.
The symbol locking pins on the screen should extinguish
and the buzzer should stop sounding.
Deactivate push button S19 (indicator light extinguishes).
If properly attached, the tool is now locked in place.
Check visually if the tool is fitted firmly.
In addition, the operator must perform a cycle with the tool
where the tool may only be raised far enough that the secure 10
fitting, e.g. if the pins are in the pin holes, can be checked by
tilting the tool in and out.
No one is permitted in the danger zone during a test run!
DANGER
If a buzzer sounds or a warning symbol lights up and no

locking or unlocking procedure was initiated, shut down
operation immediately.
This may be due to the locking pins changing their fitting

position unchecked, e.g. because of leakage.
If buzzer/warning light are not actuated during any

procedure, shut down operation immediately. This may be 11
due to breaks in the cable, a defective plug connection or a
defective proximity switch.
Operation may only be reinitiated after defective parts have

been repaired or replaced.
Notice:
Before starting operation with tools, e.g. grapple, ditch
cleaning bucket, observe all special instructions for
mounting and dismantling.
12
8.2.5
REMOVING THE WORKING TOOL
CAUTION
Always keep the tool at a minimum distance from the

ground during any unlocking procedure to avoid
dangerous movements.
Deflect right joystick 3 (fig. 5) toward e and extend the

bucket cylinder fully (fig. 13 and 14).
Switch on the additional attachment function rotating device
by actuating push button S19 (fig. 3) (indicator light on the
13
button lights up).
Depress the push-button switch S47 (fig. 4) and keep it
depressed.
When switch S47 is depressed, press right push-button S5R
on left joystick 4 (fig. 6) until the locking pins (fig. 1, pos. b)
are fully inserted.
The symbol locking pins retracted appears on the screen
and the buzzer sounds.
Release switch S47.
DANGER
14 There is no rigid connection between the coupler and

the tool present.
The tool can be released.
To avoid dangerous movements, keep the tool at a
minimum distance from the ground.
Slowly retract bucket cylinder and lay the tool on the ground
(fig.15 and 16).
Deactivate push button S19.
15
16
8.2.6
LIFTING TACKLE INSERT
The standard hydraulic quick change coupler comes
equipped with two integrated load hooks (fig. 17, pos. g).
The hydraulic excavator may only be operated with lifting
tackle when the additional safety devices described in
chapter 4 lifting tackle are present and operational.
DANGER
Never use attachment hook pos. c to fix loads because the
attachment hooks do not provide any secure hold for load
attachment items such as cables or chains. 17
The maximum load capacity of each individual load hook can

be found on the quick change coupler. The load capacity of
the quick change coupler and/or the integrated load hook
can be less than or greater than the load capacity of the
basic machine. During operation, make sure that the values
found on the load capacity chart and in the Technical Data of
the basic machine are maintained when checking the
authorized load capacity of the coupler and/or the integrated
load hook.
Any load lifting work can only be performed when the tool is
attached or dismantled. When the tool is dismantled, it is
recommended to fully retract the locking pins on the lifting
tackle insert. This prevents the load attachment items
(cables, chains) from being routed over the locking pins and
thus protects them from being damaged.
If the overload warning device is switched on, the warning
buzzer for the retracted locking pins can be turned off via
switch S349 (fig. 19) to prevent any constant noise pollution.
The symbol locking retracted remains visible/lit up on the
instrument panel. The warning buzzer is reactivated
automatically when the locking pins are actuated again.
19
8.2.7
CHECKING AND MAINTENANCE OF QUICK CHANGE COUPLER
Yes No
Functional check out of quick change coupler

Daily, at machines operating start, check out the quick change
coupler functions as well as its warning light and buzzer in the
cab.
This verification can also be done at the first daily tool change.
Proceed as below :
Start the Diesel engine and let it run on low idle.
Opening the quick change coupler:

Move the equipment so that the tool is lying on the ground, with
the bucket cylinder fully extended.
Press touch S19,
Warning light integrated in the touch must light up
Depress the push button switch S47 (or turn the key switch S47
into position 1 (to the right), and push down the key).
Keep switch S47 depressed, press right push button S5R. The
quick change coupler locking pins must retract .
Simultaneously :
The symbol "Locking pins retracted" appears on the screen ..
The buzzer in the cab must sound ...............................................
Release the key and turn the switch S47 back to position 0.
Closing the quick change coupler:

Depress the push button switch S47 (or turn the key switch S47
into position 1 (to the right), and press the key).
Keep switch S47 depressed, press left button S5L. The quick
change coupler locking pins must come out ................................
When the locking pins are fully out :
Symbol "Locking pins retracted" must light off at the display ......
The buzzer in the cab must stop
Press touch S19,
The warning light integrated in the touch must light off.
Stop the Diesel engine
Daily visual check out

Daily, after above described function verification, control if
locking pins a are in fully extended position, that means the
tool's attachment bore holes must be flush with locking pins.......
Check also the good condition of the hydraulic hoses b and of
the electrical supply bundle between end of stick and quick
change coupler. .
Check that the safety latches c on the load hooks are in good
working order. ...........
Lubrication of locking pins.

Once a week, give some stroke of grease into each of 4 lube
nipples d located in the area of the locking pins .........................
Screen filters inside supply hoses

Every 1000 operating hours, check out and clean the screen
filters mounted inside the fittings between the hoses b and the
hydraulic cylinder of the quick change coupler.............................
8.2.8
FULLY HYDRAULIC ACTUATED TRACK
GAUGE ADJUSTMENT
(Only for machine type VH)
MODIFICATION OF UNDERCARRIAGE WIDTH
CAUTION 25
If necessary, loosen and remove the mechanic locking

in end position of the width modification device on the
undercarriage.
Only perform the track gauge adjustment on flat and
solid ground and without travelling during adjustment.
The adjustment of the undercarriage width is controlled by

the left travel pedal 5 when the button S104 (fig. 25) is kept
depressed at the same time (control light inside the button
must be on)
Pushing the left pedal forward (fig. 26, 5a) causes the
side frames to move in (reduction of undercarriage width,
fig. 27)
26
Pushing the left pedal backward (fig. 26, 5b) causes the
side frames to move out (increase of undercarriage width)
Should a side frame not move in or out, so the travel

movement must be actuated briefly foreword and backward
on the same side (actuate travel pedal while button S104 is
released)
CAUTION
Always modify the track gauge so to bring both side

frames to the same end position, either fully in or out.
Operating or travelling the machine with the side
frames in intermediate position is not allowed. 27
LUBRICATION OF THE COULISSES

Check the gliding surfaces on the coulisses (fig. 28, pos. S)
at each modification of the undercarriage width.
After a working time with the side frames in extended
position the gliding surfaces S must be cleaned from any dirt
or dust and then coated with grease before the side frames
are retracted.
After extension of the side frames, and before starting to
work with the excavator, check the condition of the gliding
surfaces S, as necessary clean and coat them with grease
Grease quality: employ the grease recommended in this
manual for the lubrication of working attachment of the
28
excavator.
8.5.7

8 Liebherr R954C Litronic Operation and Maintenance

Uploaded by

Copyright:

Available Formats

8 Liebherr R954C Litronic Operation and Maintenance

Uploaded by

Document Information

Copyright

Available Formats

Share this document

Share or Embed Document

Sharing Options

Did you find this document useful?

Is this content inappropriate?

Copyright:

Available Formats

8 Liebherr R954C Litronic Operation and Maintenance

Uploaded by

Copyright:

Available Formats

Litronic

All maintenance personnel should follow the operating and maintenance

In addition to the operating and maintenance guidelines is this manual, additional

This Operation and Maintenance manual contains all necessary information to

1/ MACHINE DESCRIPTION, TECHNICAL DATA

3/ CONTROLS AND INSTRUMENTATION

Valid from Serial

Product Id. No. (PIN No.) :

Manufacturing Date : CE 2006

 7XMGOPIRKXLW Q   

  4EH[MHXL QQ   

8LIPSEHZEPYIWEVIUYSXIHMRXSRW X SRXLIFEGOLSIFYGOIX¬WPSEHLSSOERHQE]FIW[YRK SRJMVQERHIZIRKVSYRH:EPYIWUYSXIHMR

8LIPSEHZEPYIWEVIUYSXIHMRXSRW X SRXLIFEGOLSIFYGOIX¬WPSEHLSSOERHQE]FIW[YRK SRJMVQERHIZIRKVSYRH:EPYIWUYSXIHMR

In this manual, DANGER, CAUTION or NOTE are defined as follows :

FIRE AND EXPLOSION PREVENTION

2 Notice Sound Power Level L WA 7 Warning Sign Danger Zone

Sign 3 External start

Sign 5 Latch points

Sign 7 Danger zone

Sign 10 Prohibition sign

Sign 20 Information about Control Symbols

Sign 22 Accident Prevention

Sign 27 Safety Lever

Sign 29 Latch Points and Lifting Points

Sign 31 Seat Belt

Your hydraulic excavator comes equipped with a standard 1

Push button S6L * See on page 4.17.

Push button S6R *

Rocker switch S55 *

Rocker switch S57 for swing brake control

P4 LED indicator for engine

(M) The function of the push

S11 - Windshield washer

S14 - Windshield wiper

S17 - Preselection of swing brake operating mode

S18 - Overload warning device

S19 - Rotating device

S20 - Low idle automatic (see page 4.5)

S22 - Auxiliary floodlights (Optional installation)

S36 - Special function (not used)

S41 - Beacon (Optional installation)

S56 - Pressure increase

S85 - Grapple operation

S228 - Engine RPM increase

S229 - Engine RPM reduce

S354  Special function (not used)

P4 - LED indicator for engine RPM

LED INDICATOR RANGE

Engine coolant temperature gauge P2

Adjust the background lighting on the LCD screen

LCD screen control keys

Control of the screen at error recognition:

Symbol PLD Origin of

Engine coolant overheating Buzzer H10 starts to sound.

E 505 Hydraulic oil overheating BST B8

E 506 Pumps splitterbox overheating BST B15

E 511 Over voltage in electrical system BBT

Low batteries voltage

High batteries voltage

E 517 Injectors default PLD Diesel engine stops automatically

7XMGOPIRKXLW Q

4EH[MHXL QQ

8LIPSEHZEPYIWEVIUYSXIHMRXSRWX SRXLIFEGOLSIFYGOIX¬WPSEHLSSOERHQE]FIW[YRK SRJMVQERHIZIRKVSYRH:EPYIWUYSXIHMR

8LIPSEHZEPYIWEVIUYSXIHMRXSRWX SRXLIFEGOLSIFYGOIX¬WPSEHLSSOERHQE]FIW[YRK SRJMVQERHIZIRKVSYRH:EPYIWUYSXIHMR

S354 Special function (not used)

The sign means "Input not active".