vs6 Installation and Operation Manual - 2015

VS6 Series
/ŶƐƚĂůůĂƟŽŶ͕KƉĞƌĂƟŽŶĂŶĚ
DĂŝŶƚĞŶĂŶĐĞDĂŶƵĂů
Model VS6, API 610 11th ĚŝƟŽŶ͕/^KϭϯϳϬϵ
ARYA SEPEHR KAYHAN

ARYA SEPEHR KAYHAN
Table of Contents Page

1 General Information 2
2 Safety 2
3 Transport, Temporary Storage, Long Term Storage, Disposal 5
3.1 Consignment receipt and unpacking 5
3.2 Transport 5
3.3 Storage and preservation 6
3.4 Return to supplier 7
3.5 Disposal 7
4 Description of the Pump 7
4.1 General description 7
4.2 Designation 8
4.3 Main Parts 8
4.4 Performance and operating limits 9
5 Installation at Site 9
5.1 Safety regulations 9
5.2 Location 10
5.3 Foundation 10
5.4 Initial alignment 11
5.5 Piping 12
5.6 Electrical connections 13
5.7 Final shaft alignment check 13
5.8 Protection Systems 13
6 Commissioning, Startup, Operation and Shutdown 13
6.1 Pre-commissioning Procedure 14
6.2 Pump lubricants 14
6.3 Direction of rotation 15
6.4 Priming and auxiliary supplies 15
6.5 Starting the pump 16
6.6 Operation 16
6.7 Stopping and Shutdown 17
6.8 Hydraulic, mechanical and electrical duty 17
7 Maintenance 18
7.1 General 18
7.2 Maintenance schedule 18
7.3 Spare parts 19
7.4 Recommended spare parts 20
7.5 Dismantling the pump set 20
7.6 Examination of parts 22
7.7 Assembly 22
8 Troubleshooting 22
Model VS6, API 610 11th edition, ISO 13709 Installation, Operation, and Maintenance Manual
P a g e |1
ARYA SEPEHR KAYHAN
1 General Information
1.1 Principles
This manual is supplied as an integral part of the type series and variants indicated on the
front cover. This manual describes the proper and safe use of this equipment in all phases
of operation.
The name plate indicates the type series and size, the main operating data, the order
number and the order item number. The order number and order item number clearly
identify the pump set and serve as identi¿cation for all further business processes. ,n the
event of damage, immediately contact your nearest ASK Service centre to maintain the
right to claim under warranty.
1.2 Installation of partly completed machinery
To install partly completed machinery supplied by ASK, please refer to the subsections
under Servicing/Maintenance.
1.3 Target group
This manual is aimed at the target group of trained and quali¿ed specialist technical
personnel.
2 Safety
All the information contained in this section refers to hazardous situations.
DANGER
2.1 Key to safety symbols/markings

Table 'e¿nition of safety symbols/marNings
Symbol Description
Danger
This signal word indicates a highrisN hazard which, if not avoided,
DANGER will result in death or serious injury.
WARNING
This signal word indicates a mediumrisN hazard which, if not
WARNING avoided, could result in death or serious injury.
CAUTION
This signal word indicates a hazard which, if not avoided, could
CAUTION result in damage to the machine and its functions.
Explosion protection
This symbol identi¿es information about avoiding e[plosions in
potentially e[plosive atmospheres in accordance with (& 'irective
//(& AT(;.
General hazard
,n conjunction with one of the signal words this symbol indicates
a hazard which will or could result in death or serious injury.
Electrical hazard
,n conjunction with one of the signal words this symbol indicates
a hazard involving electrical voltage and identi¿es information
about protection against electrical voltage.
Machine damage
,n conjunction with the signal word &A8T,21 this symbol indicates
a hazard for the machine and its functions.
P a g e |2
ARYA SEPEHR KAYHAN
2.2 General
This manual contains general installation, operating and maintenance instructions that
must be observed to ensure safe pump operation and prevent injury and damage to proper-
ty.
The safety instructions in all sections of this manual must be complied with.
This manual must be read and completely understood by the responsible specialist person-
nel/operators prior to installation and commissioning.
The contents of this manual must be available to the specialist personnel at the site at all
times.
Instructions attached directly to the pump must always be complied with and be kept in a
perfectly legible condition at all times. This applies to, for example:
ŀ Arrow indicating the direction of rotation
ŀ Markings for connections
ŀ 1ame plate
The operator is responsible for meeting all local regulations which are not taken into
account in this manual.
2.3 Intended use
2nly operate the pump set within the application limits speci¿ed in the other applicable
documents.
ŀ 2nly operate pump sets which are in perfect technical condition.
ŀ 'o not operate partially assembled pump sets.
ŀ 2nly use the pump to handle the Àuids described in the data sheet or product literature
of the pump model.
ŀ 1ever operate the system without the Àuid to be handled.
ŀ 2bserve the limits for continuous operation speci¿ed in the data sheet or product litera-
ture (Qmin and Qmax) (prevention of damage such as shaft fracture, bearing failure, dam-
aged mechanical seal, etc).
ŀ :hen handling untreated waste water the duty points in continuous operation lie within
0.7 to 1.2 x Qopt to minimize the risk of clogging/hardening.
ŀ Avoid duty points for continuous operation at very low speeds and small Àow rates (0.7
x Qopt).
ŀ 2bserve the information on the maximum Àow rates provided in the data sheet or techni-
cal product literature (prevention of overheating damage, cavitation damage, bearing
damage, etc).
ŀ 'o not throttle the Àow rate on the suction side of the system (prevention of cavitation
damage).
ŀ )or any operating modes which are not speci¿ed in the data sheet or product literature,
contact the manufacturer.
Prevention of foreseeable misuse
ŀ 2EVHUYH WKH PLQLPXP ÀRZ YHORFLWLHV IRU IXOO\ RSHQ VZLQJ FKHFN YDOYHV WR SUHYHQW WKH
UHGXFWLRQRISUHVVXUHDQGULVNRIFORJJLQJ
&RQWDFWWKHPDQXIDFWXUHUIRUWKHUHTXLUHGPLQLPXPÀRZYHORFLWLHVORVVFRHI¿FLHQWV
ŀ1HYHUH[FHHGWKHSHUPLVVLEOHDSSOLFDWLRQOLPLWVVSHFL¿HGLQWKHGDWDVKHHWDQGLQWKHSURG
XFWOLWHUDWXUHUHJDUGLQJSUHVVXUHWHPSHUDWXUHHWF
ŀ2EVHUYHDOOVDIHW\QRWHVDQGLQVWUXFWLRQVLQWKLVPDQXDO
3HUVRQQHOTXDOL¿FDWLRQDQGWUDLQLQJ
All personnel involved must be fully quali¿ed to install, operate, maintain and inspect the
machinery this manual refers to. The responsibilities, competence and supervision of all
personnel involved in installation, operation, maintenance and inspection must be clearly
de¿ned by the operator.
'e¿cits in knowledge must be recti¿ed by suf¿ciently trained specialist personnel training
and instructing the personnel who will carry out the respective tasks.
P a g e |3
ARYA SEPEHR KAYHAN
If required, the operator can commission the manufacturer/supplier to train the personnel.
Training on the pump (set) must always be supervised by technical specialist personnel.
2.5 Consequences and risks caused by non-compliance with these operating
instructions
ŀ 1on-compliance with these operating instructions will lead to forfeiture of warranty cover
and of any and all rights to claims for damages.
ŀ 1on-compliance can, for example, have the following consequences:
± +azards to persons due to electrical, thermal, mechanical and chemical effects and explo-
sions
– Failure of important product functions
– Failure of prescribed maintenance and servicing practices
– Hazard to the environment due to leakage of hazardous substances
2.6 Safety awareness
In addition to the safety information contained in this manual and the intended use, the
following safety regulations shall be complied with:
ŀ Accident prevention, health and safety regulations
ŀ (xplosion protection regulations
ŀ Safety regulations for handling hazardous substances
ŀ Applicable standards and laws
2.7 Safety instructions for the operator/user
ŀ The operator shall ¿t contact guards for hot, cold and moving parts, and check that the
guards function properly.
ŀ 1ever remove the contact guard when the pump is in operation.
ŀ 3rovide the personnel with protective equipment and make sure it is used.
ŀ &ontain leakages (e.g at the shaft seal) of hazardous Àuids handled (e.g. explosive, toxic,
hot) so as to avoid any danger to persons and the environment. Adhere to all relevant
laws.
ŀ (liminate all electrical hazards. (In this respect refer to the applicable national safety regu-
lations and/or regulations issued by the local energy supply companies.)
2.8 Safety information for maintenance, inspection and installation work
ŀ Modi¿cations or alterations of the pump are only permitted with the manufacturer
s prior
consent.
ŀ 8se only original spare parts or parts authorized by the manufacturer. The use of other
parts can invalidate any liability of the manufacturer for consequential damage.
ŀ The operator ensures that all maintenance, inspection and installation work is performed
by authorized, quali¿ed specialist personnel who are thoroughly familiar with the manual.
ŀ &arry out work on the pump (set) during standstill only.
ŀ The pump casing must have cooled down to ambient temperature.
ŀ 3ump pressure must have been released and the pump must have been drained.
ŀ :hen taking the pump set out of service always adhere to the procedure described in the
manual.
ŀ 'econtaminate pumps which handle Àuids posing a health hazard.
ŀ As soon as the work is complete, re-install and/or re-activate any safety-relevant and
protective devices. Before returning the product to service, observe all instructions on
commissioning.
2.9 Unauthorized modes of operation
1ever operate the pump (set) outside the limits stated in the data sheet and in this
manual.
The warranty relating to the operating reliability and safety of the supplied pump (set) is
only valid if the equipment is used in accordance with its intended use.
P a g e |4
ARYA SEPEHR KAYHAN
2.10 Explosion protection

Always observe the information on explosion protection given in this section when operat-
DANGER
ing an explosion-proof pump set.
Sections of the manual marked by the Ex symbol apply to explosion-proof pump sets also
when temporarily operated outside potentially explosive atmospheres.
2nly pumps/pump sets marked as explosion-proof and identi¿ed as such in the datasheet
must be used in potentially explosive atmospheres.
Special conditions apply to the operation of explosion-proof pump sets in accordance with
EC Directive 94/9/EC (ATEX).
When operating explosion-proof pump sets, especially adhere to the additional require-
ments marked by the Ex symbol.
The explosion-proof status of the pump set is only assured if the pump set is used in accor-
dance with its intended use. Never operate the pump (set) outside the limits stated in the
data sheet and on the nameplate.
Prevent impermissible modes of operation at all times.
2.10.1 Repair
Special regulations apply to repair work on explosion-proof pumps. Modi¿cations or alter-
ation of the pump set may affect explosion protection and are only permitted after consulta-
tion with the manufacturer.
5epair work at the Àameproof joints must only be performed in accordance with the
manufacturer's instructions. Repair to the values in tables 1 and 2 of EN 60079-1 is
not permitted.
3 Transport/Temporary Storage/Long-Term Storage/Disposal

3.1 Consignment receipt and unpacking
Immediately upon receipt, check that the number of boxes and pieces received is the same
as shown on the freight bills. Each product has a unique serial number. Check that this
number corresponds with that advised and always quote this number in correspondence as
well as when ordering spare parts or further accessories. Check for shipping damage. Note
any shortages or damages on the carrier’s copy of the freight bill prior to signing. Report
these damages or shortages to the factory or your local factory representative immediate-
ly.
Boxes, crates, pallets or cartons may be unloaded using fork lift vehicles or slings depen-
dent on their size and construction. If facilities are not available for lifting the materials off
the carrier’s vehicle, use skids for unloading rather than allowing the parts to drop to the
ground. Even though a pump is made up of heavy steel parts, it is a piece of machinery
and it is essential that its parts be handled with care. It is extremely easy to damage shaft-
ing, threaded parts, and mating surfaces of parts which must ¿t together. Even a minor
bend in one piece of shafting can cause a pump to vibrate excessively; thus shortening the
life of the pump drastically.
Also check that the parts received are all of the parts required for the installation. Report
any shortages or errors to the factory or your local factory representative immediately.
Follow the Manufacturer’s instructions for handling and storing the driver and any other
special equipment.
3.2 Transport
The pump (set) could slip out of the suspension arrangement Danger to life from falling
DANGER parts!
- Always transport the pump (set) in horizontal position.
- Never attach the suspension arrangement to the free shaft end or the motor eyebolt.
- Refer to the weights given in the general arrangement drawing.
P a g e |5
ARYA SEPEHR KAYHAN
- Observe the local accident prevention regulations.

- Use suitable permitted lifting tackle, e.g. self-tightening lifting tongs.
Incorrect transport of the pump Damage to the shaft seal!
For transport, lock the pump shaft with a suitable transport lock to prevent any movement
of the shaft.
To transport the pump/pump set suspend it from the lifting tackle as shown below:
For lifting the driver Depending on the pump size the

refer to the dimension pump unit is packed separately
drawing of driver. from the Can, or is put partially
into the Can.
Use suction & discharge

nozzles for lifting the
pump without can and
driver.
4 pieces lifting screw A crane must be used for

only for CAN lifting all pump sets in excess of
25 kg (55 lb).
Fully trained personnel must
carry out lifting, in accordance
with local regulations. The driver
and pump weights are recorded
on their respective nameplates.
Note:
In some cases the pumps are not complete assembled. If Can and supporting Àange are
delivered separately, lifting shall be performed as follows:
Suction barrel (also referred as µCan’) is supplied together with supporting Àange and has
to be installed into the sump ¿rst. Suction barrel and supporting Àange are delivered
assembled together. Install 4 lifting screws (also referred as ‘Eye Bolts’) on the supporting
Àange and attach slings and straps to bring the suction barrel to a vertical position. Move
the barrel for installation. Provide hand support to prevent the suction barrel from swaying
during movement.
3.3 Storage and preservation
3.3.1 Temporary Storage
Normal packaging is designed to protect the pump during shipment and for dry, indoor
storage. To avoid any damage during the storage period, the inÀuence of any low or high
frequency vibration must be totally inhibited. If the pump is delivered sealed in a
plastic-wrapper, it is of max. importance to avoid any damage of that wrapper, because
this will protect the pump against humidity. Therefore it must be checked if this wrapper
has become cracked and if so, the wrapper must be renewed.
P a g e |6
ARYA SEPEHR KAYHAN
If a vertical pump will be stored in horizontal position, be sure to support the pump
suf¿ciently to avoid any deformation or bending of the pump.
To avoid the presence of dust and humidity on the driver, it shall also be wrapped in the
same way.
3.3.2 Long term storage
If a situation arises for a long-term storage, ( more than 6 months) please contact ASK for
special storage instructions and warranty related information.
3.4 Return to supplier

1. Drain the pump as per operating instructions.
2. Always Àush and clean the pump, particularly if it has been used for handling noxious,
explosive, hot or other hazardous Àuids.
. If the Àuids handled by the pump leave residues which might lead to corrosion damage
when coming into contact with atmospheric humidity, or which might Ignite when coming
into contact with oxygen, the pump set must also be neutralized, and anhydrous inert gas
must be blown through the pump for drying purposes.
4. Always complete and enclose a certi¿cate of decontamination when returning the pump
set. It is imperative to indicate any safety and decontamination measures taken.
3.5 Disposal
Fluids posing a health hazard!
Hazardous to persons and the environment!
WARNING
- Collect and properly dispose of Àushing liquid and any Àuid residues.
- Wear safety clothing and a protective mask, if required.
- Observe all legal regulations on the disposal of Àuids posing a health hazard.
1. Dismantle the pump (set).
Collect greases and other lubricants during dismantling.
2. Separate and sort the pump materials, e.g. by:
- Metals
- Plastics
- Electronic waste
- *reases and other lubricants
. Dispose of materials in accordance with local regulations or in another controlled
manner.
4 Description of the Pump (Set)

4.1 General description
9ertical Barrel Pumps are single suction, multi stages, radially split, diffuser, vertical can
pumps, primarily designed for plants handling liquids with low suction heads.
This pumps are according to API 610 type 9S6. The wide range of available according to
special condition. The inline design allows single pipe connection and requires minimal
space. Altogether, this makes the 9S6 the pump of choice for the most critical applications
where space considerations or marginal NPSHA values preclude the use of a horizontal
multistage pump.
/iquid is Àowing through the suction Àange of the headstock and through the Can to the
impellers. The last stage impeller is discharging the liquid via the column pipes, to the
discharge Àange. The thrust is balanced by back wearing rings and balancing holes.
The headstock is equipped with a drain connection, which allows to Àush the Can with Nitro-
gen before disassembly. A vent connection for the suction is standard.
P a g e |7
ARYA SEPEHR KAYHAN
4.2 Designation
VS6 150 L - 5stg / 160 2 S6 D 115261 300 CD / EXT4
Area
Pump type classification
Discharge Pump
nominal dia. Options
in millimeters
Impeller code Can Length
Seal plan
No. of stages code acc. to
API682
Nominal
power of Seal type
driver in kW
No. of elctric Material class

motor poles acc. to table
H1 of API610
4.3 Main Parts

4.3.1 Motor support
The motor support connects the motor to
the bearing housing, also it acts as
coupling guard.
4.3.2 Bearing housing

The bearing housing supports the thrust
bearings.
4.3.3 Bearing housing support

This part supports the bearing housing on
top of pump head and connects them
together, also it contains shaft sealing.
4.3.4 Pump head

Pump head has inline suction and
discharge nozzle, including all the neces-
sary vent and drain connections. It is a
major part of the pump unit, which
supports the column pipes with the hydrau-
lics as well as the motor support and
driver.
P a g e |8
ARYA SEPEHR KAYHAN
4.3.4 Suction can

The Can is subjected to suction pressure
and guides the Àuid to the ¿rst stage impel-
ler.
4.3.5 Hydraulics parts
5DGLDOÀRZK\GUDXOLFV
This are ring section type hydraulics.
Suction, stage and discharge casing are
hold together by strong tie bolts, which
allows a very compact and short design.
The radial impellers are hydraulically
balanced by back wear rings and balancing
holes. The diffusers are designed with 7 to
11 vanes to minimize the radial forces at
part load operation. All impellers are
slipped on the shaft and axially ¿xed by the
impeller nut. The shaft is supported in the
suction casing, in every diffuser and in the
discharge casing.
0L[HGÀRZK\GUDXOLFV
The hydraulics consists of Àanged bowls
and a suction casing. The impellers are
hydraulically balanced by back wear rings
and balancing holes.
The diffusers are designed with 7 to 11
vanes to minimize the radial forces at part
load operation. All impellers are slipped on
the shaft and axially ¿xed by the impeller
nut. The shaft is supported in the suction
casing and in each bowl.
4.4 Performance and operating limits

In the interest of operator safety the unit must not be operated above the nameplate condi-
tions. Such operation could result in unit failure causing injury to operating personnel.
Consult instruction book for correct operation and maintenance of the pump and its supporting
components.
5 Installation at Site
5.1 Safety regulations
Installing electric equipment (motors) in potentially explosive atmospheres
Risk of explosion!
- Comply with the applicable local explosion protection regulations.
P a g e |9
ARYA SEPEHR KAYHAN
- Verify the test certi¿cate of the motor.

- Keep the test certi¿cate close to the location of operation (e.g. in the foreman's of¿ce).
5.2 Location
When equipment has been in storage for greater than 6 months, a complete inspection
should be conducted in accordance with section 3.3.2. The pump should be located to allow
room for access, ventilation, maintenance and inspection with ample headroom for lifting
and should be as close as practicable to the supply of liquid to be pumped.
Refer to the general arrangement drawing for the pump dimensions and details.
5.2.1 Inspection prior to installation
Six months prior to the scheduled installation date, a ASK representative is to be employed
to conduct an inspection of the equipment and the facility. If any deterioration of
equipment is noticed, the ASK representative may require a partial or complete
dismantling of the equipment including restoration and replacement of some components.
5.2.1 Part Assemblies
With exception of the Can the pumps are delivered completely mounted and adjusted; also
the shaft seal is in the correct position. So no further axial alignment of the rotor is
necessary. If drivers and/or seal systems are delivered separately, refer to corresponding
sectional drawing.
Axial alignment and rotor setting axial adjustment need to be distinguished. For correct
axial adjustment of the rotor refer to section 5.4 and consult ASK.
5.2.2 General installation check-list
The following checks should be made before starting actual installation.
a) Make sure that motor nameplate ratings and the power supply system match correctly.
b) Check the sump depth and pump length matchup.
c) Check the installation equipment to be sure that it will safely handle the pump weight
and size.
d) Check all pump connections (bolts, nuts etc.) for any shipping and handling related
problems.
Always support shafting in at least three places when lifting or installing. No installation
should be attempted without adequate equipment necessary for a successful installation.
CAUTION
Always check motor rotation before connecting driver to pump. Reserve rotation due to
improper motor direction can cause extensive damage to the pump.
5.3 Foundation
The foundation shall be located on a place that allows a minimum of pipe work and that is
easily accessible for inspection during operation. According to the environment the
foundation may consist of concrete or of steel. It must be rigid and heavy enough to absorb
normal vibrations and shocks. The Àange of the Can must be supported on the whole
surface. It should be at least 20–30 mm (0. – 1.2 in) higher than the surrounding to avoid
the deposit of dust and humidity.
5.3.1 Vertical alignment
Vertical alignment is done with leveling screws. Use a spirit level for correct horizontal
alignment of the baseplate.
The max. vertical misalignment is 0.5 mm/m pump length.
5.3.2 Steel foundation
When the pump unit is mounted directly on structural steel frame, it shall be well
supported by structural beams. It is recommended to check the natural frequency of the
steel frame, because it shall not coincide with the pump speed. The Àange of the Can has
to be ¿xed on a Àat surface with studs or hex screws, the exact horizontal alignment is very
important!
P a g e | 10
ARYA SEPEHR KAYHAN
5.3.3 Concrete foundation

3/4” TO 1-1/2”
A concrete foundation must have an exact ALLOWANCE
horizontal alignment and must be placed FOR *ROUT
on solid ground. First a basic foundation LEVELIN* SHIMS FINISH *ROUTIN*
shall be built with square shaped holes for
embedding the foundation bolts. After
putting the Can in the foundation the
proper alignment can be obtained by
adjusting it with shims under the Àange.
Now insert the foundation bolts and
grout the space between the basic founda-
tion and the Can with grouting cement
(refer to illustration) It is very helpful to
use a properly made and stable wooden DAM
frame around the Can. So the grouting

cement will not Àow a side. When the grout-
ing is totally set and hardened the founda-
tion bolts shall be tightened in a ¿rm and TOP OF FOUNDATION LEFT
symmetrical way.
5.3.4 Final assembly for not complete assembled pumps
Pumps exceeding a total length of approximately 6 m (19.7 ft) are delivered in various
components and must be assembled on site. The main parts are: hydraulic bowls section
- various line shafts and column pipes - Pump head and bush bearings.
To install the pump in the Can, refer to the corresponding assembling drawing where the
different lengths of column pipes and the position of the various column pipes are indicated
and contact with our head of¿ce for more instructions.
5.4 Initial alignment

The adjustment of motor and pump must
be checked (if necessary, make a new
adjustment) before ¿rst start up of the
unit. The motor Àange is equipped with
adjustment-screws on the motor support.
Ensure pump and driver are isolated electri-
cally and the half couplings are disconnect-
ed. Align the motor to the pump, not the
pump to the motor. Alignment of the motor
is achieved by using the adjustment
screws.
5.4.1 Permissible misalignment limits at working temperature
When checking parallel alignment, the total indicator read-out (TIR) shown is twice the
value of the actual shaft displacement.
The pump is only pre-aligned! Carefully check and readjust alignment before start of the
unit. Take out the spacer of the coupling and check the alignment of shafts end of pump
CAUTION
and driver. The maximum parallel offset should not exceed 0.05 mm (0.002 in.) and the
axially offset can be ± 2.5 mm (0.10 in.). The coupling spacer gap length shall be ± 0.25
mm (0.01 in.).
For more details refer to the manufacturer’s procedure of alignment.
P a g e | 11
5.5 Piping
3URWHFWLYHFRYHUVDUH¿WWHGWRWKHSLSHFRQQHFWLRQVWRSUHYHQWIRUHLJQSDUWLFOHVRUREMHFWV
HQWHULQJ WKH SXPS GXULQJ WUDQVSRUWDWLRQ DQG LQVWDOODWLRQ (QVXUH WKDW WKHVH FRYHUV DUH
CAUTION UHPRYHGIURPWKHSXPSEHIRUHFRQQHFWLQJSLSHV
5.5.1 Pipe work velocities
,QRUGHUWRPLQLPL]HIULFWLRQORVVHVDQGK\GUDXOLFQRLVHLQWKHSLSHZRUNLWLVJRRGSUDFWLFH
WRFKRRVHSLSHZRUNWKDWLVRQHRUWZRVL]HVODUJHUWKDQWKHSXPSVXFWLRQDQGGLVFKDUJH
7\SLFDOO\PDLQSLSHYHORFLWLHVVKRXOGQRWH[FHHGPVIWVHFRQWKHVXFWLRQDQGPV
IWVHFRQGLVFKDUJH
7DNHLQWRDFFRXQWWKHDYDLODEOH136+WKDWPXVWEHKLJKHUWKDQWKHUHTXLUHG136+RIWKH
SXPS
1HYHUXVHWKHSXPSDVDVXSSRUWIRUSLSLQJ
WARNING
0D[LPXPIRUFHVDQGPRPHQWVDOORZHGRQSXPSÀDQJHV
(see corresponding general arrangement drawing)
0D[LPXPIRUFHVDQGPRPHQWVDOORZHGRQWKHSXPSÀDQJHVYDU\ZLWKWKHSXPSVL]HDQG
W\SH7RPLQLPL]HWKHVHIRUFHVDQGPRPHQWVWKDWPD\LIH[FHVVLYHFDXVHPLVDOLJQPHQW
KRWEHDULQJVZRUQFRXSOLQJVYLEUDWLRQDQGSRVVLEOHIDLOXUHRIWKHSXPS
FDVLQJ7KHIROORZLQJSRLQWVVKRXOGEHVWULFWO\IROORZHG
D3UHYHQWH[FHVVLYHH[WHUQDOSLSHORDG
E1HYHUGUDZSLSLQJLQWRSODFHE\DSSO\LQJIRUFHWRSXPSÀDQJHFRQQHFWLRQV
F'RQRWPRXQWH[SDQVLRQMRLQWVVRWKDWWKHLUIRUFHGXHWRLQWHUQDOSUHVVXUHDFWVRQWKH
SXPSÀDQJH
(QVXUHSLSLQJDQG¿WWLQJVDUHÀXVKHGEHIRUHXVH
CAUTION
(QVXUHWKDWWKHSLSLQJDUUDQJHPHQWKDVEHHQSURYLGHGWRÀXVKWKHSXPSEHIRUHUHPRYDO
LQFDVHVRIKD]DUGRXVOLTXLGSXPSV
5.5.3 Auxiliary piping

5.5.3.1 Vent
7KH H[WHQW RI YHQWLQJ UHTXLUHPHQWV GHSHQGV RQ WKH DSSOLFDWLRQ DQG LQVWDOODWLRQ UHTXLUH
PHQWV7KH IROORZLQJ LQVWUXFWLRQV PD\ EH XVHG DV D JXLGH LQ VR IDU DV WKH\ DSSO\ WR WKH
SXPSDVGHOLYHUHG)RUW\SHSRVLWLRQDQGGLPHQVLRQVRIWKHYHQWFRQQHFWLRQVSOHDVHVHH
*$GUDZLQJ
5.5.3.2 Drain
1RUPDOSXPSOHDNVDQGJODQGOHDNDJHWREHGUDLQHGWKURXJKDVHSDUDWHSLSLQJDUUDQJH
PHQWRUEDFNLQWRWKHVXFWLRQ
3XPSV¿WWHGZLWKJODQGSDFNLQJ
7KHSXPSHGOLTXLGLVDOORZHGWRÀRZWKURXJKWKHJODQGSDFNLQJDWGLVFKDUJHSUHVVXUHDQG
GUDLQHGRXWRIWKHSXPSRUUHFLUFXODWHGEDFNLQWRWKHVXFWLRQ$VHSDUDWHÀXVKVXSSO\PD\
EHUHTXLUHGLQVRPHFDVHV7KHSLSLQJSODQVDQGÀXVKVXSSO\DUHWREHVHOHFWHGEDVHGRQ
WKHDSSOLFDWLRQDQGRSHUDWLQJSDUDPHWHUV,QVRPHVSHFLDOFDVHVZKHUHWKHGLVFKDUJHSUHV
VXUHH[FHHGVEDUSVLDVSHFLDOÀXVKLQJSODQLVUHFRPPHQGHG
3XPSV¿WWHGZLWKPHFKDQLFDOVHDOV
$X[LOLDU\SLSLQJWRFLUFXODWHWKHÀXVKLQJOLTXLGEDFNLQWRWKHVXFWLRQLVUHTXLUHG,QFDVHRI
H[WHUQDO FOHDQ VRXUFH UHTXLUHPHQWV IRU SXPS DSSOLFDWLRQV VXFK DV KLJK WHPSHUDWXUH
VHUYLFHFRQWDPLQDWHGÀXLGVR[LGL]LQJÀXLGVDVSHFLDOSLSLQJSODQWRFDUU\WKHFOHDQOLTXLG
LQWRWKHVHDOFKDPEHUZLWKDGHTXDWHSUHVVXUHLVUHTXLUHGDQGVHYHUDOSLSLQJSODQVDUHDYDLO
DEOHWRVXLWWKHVSHFL¿FSXPSDSSOLFDWLRQ
P a g e | 12
ARYA SEPEHR KAYHAN
5.5.4 Final check

After connecting the piping to the pump, rotate the shaft several times by hand to ensure
no pipe strain.
If pipe strain exists, correct piping.
5.6 Electrical connections
Electrical connections must be made by a quali¿ed Electrician in accordance with relevant

DANGER local national and international regulations.
It is important to be aware of the EUROPEAN DIRECTIVE on potentially explosive areas

where compliance with IEC60079-14 is an additional requirement for making electrical
connections.
It is important to be aware of the EUROPEAN DIRECTIVE on electromagnetic compatibility

when wiring up and installing equipment on site. Attention must be paid to ensure that the
techniques used during wiring/installation do not increase electromagnetic emissions or
decrease the electromagnetic immunity of the equipment, wiring or any connected devic-
es. If in any doubt contact ASK for advice.
The motor must be wired up in accordance with the motor manufacturer's instructions
(normally supplied within the terminal box) including any temperature, earth leakage,
current and other protective devices as appropriate. The identi¿cation nameplate should
DANGER
be checked to ensure the power supply is appropriate.
A device to provide emergency stopping must be ¿tted.

If not supplied pre-wired to the pump unit, the controller/starter electrical details will also
be supplied within the controller/starter.
See section 6.3, Direction of rotation before connecting the motor to the electrical supply.
CAUTION
5.7 Final shaft alignment check

After connecting piping to the pump, rotate the shaft several times by hand to ensure there
is no binding and all parts are free. Recheck the coupling alignment, as previously
described, to ensure no pipe strain. If pipe strain exists, correct piping.
5.8 Protection Systems

The following protection systems are recommended particularly if the pump is installed in
a potentially explosive area or is handling a hazardous liquid. If in doubt, consult ASK.
If there is any possibility of the system allowing the pump to run against a closed valve or
below minimum continuous safe Àow a protection device should be installed to ensure the
temperature of the liquid does not rise to an unsafe level.
If there are any circumstances in which the system can allow the pump to run dry, or start
up empty, a power monitor should be ¿tted to stop the pump or prevent it from being start-
ed. This is particularly relevant if the pump is handling a Àammable liquid.
If leakage of product from the pump or its associated sealing system can cause a hazard it
is recommended that an appropriate leakage detection system is installed.
To prevent excessive surface temperatures at the bearings, it is recommended that
temperature and/or vibration monitoring is done on a regular basis.
P a g e | 13
ARYA SEPEHR KAYHAN
6 Commissioning, Startup, Operation and Shutdown
These operations must be carried out by fully quali¿ed personnel. Turn off power supply
CAUTION
for safety while pump commissioning is in progress.
6.1 Pre-commissioning Procedure

The gland Àush supply to be in place. Flush piping to be checked for leaks. Mechanical seals
to be checked for leaks, Àush Àow and pressure.
a) The bearing housing must be ¿lled with the indicated oil. Check also the oil level.
b) Check all vent connections for complete ¿lling of the pump. The venting procedure can
take from 10 minutes up to 2 hours, depending on the kind of Àuid.
c) Check the direction of rotation of the pump (Coupling spacer dismantled). Should be
counter clockwise when viewed from the driver end.
d) The pump rotor and the shaft seal must be in correct axial position.
e) Check the readiness of all auxiliary systems (seal sys., lubrication system etc.,) for start-
up.
f) All pipe work, including the internal and the auxiliary pipe work, must be connected
correctly and must be absolutely tight. Check the tightness of all connections of the auxilia-
ry pipe work. The suction valve must be open, the discharge valve shall be closed or partial-
ly open as required.
g) Turn the pump by hand, if required with the help of a lever, to check the free rotation
of the rotor. The rotor must turn uniformly and noiselessly. Some resistance may be felt
due to the friction in the bearings and seals.
h) Check the readiness of the driver for startup. Refer to the manual for the driver to be
sure that all precautions are in place to energize the motor.
6.2 Pump lubricants
6.2.1 Lubrication
The bearing housing shall be ¿lled with proper lubricating oil prior to start up. If the pump
will be started after a longer storage period, the bearing housing should be ¿rst Àushed
and cleaned with gasoline. It is not necessary to remove the preservation oil as this will
mix up thoroughly with the lubrication oil. Lubrication is provided by the pumping effect of
the rotating ball bearings. Maintaining the correct oil level (middle of the oil sight glass)
ensures that the lower ball bearing is covered with oil.
6.2.2 Oil change
After ¿rst start up, the oil shall be changed after 200 service hours.
Every further oil change shall take place after about 2000 service hours or at least every 6
month.
6.2.3 Oil level
The correct oil level is in the middle of the oil sight glass and shall be checked when pump
is not in operation.
Periodically check if the lubricating oil is mixed with any condensed water. Careful opening
of the oil drain during a stop of the pump will show any water.
Note:
During operation the level will decrease due to circulation of the oil through the bearings.
A too high oil level will result in higher bearing temperatures and therefore poorer lubrica-
tion.
P a g e | 14
6.2.4 Oil quality
Oil used for lubrication should only be of high quality. The viscosity of the oil at working
temperature must be at least 10 cSt. The pouring point of the oil must be in accordance
with the lowest expected temperature of the bearing housing during a stop of the pump.
For recommended lubricating oils refer to the lubrication table.
Having selected the corresponding oil quality the actual oil temperature at the bearing
housing must be checked after two service hours of the pump.
Considering this measured oil temperature the actual viscosity must be determined by
using the data sheet of the oil, to verify the minimum required viscosity of 10 cSt. Do not
IRUJHWWKHRLOWHPSHUDWXUHLQWKHEHDULQJLWVHOILVDERXW&Ʃ)KLJKHUWKDQWKH
oil temperature at the bearing housing. On the following table the oil viscosity is given at
&)'HWHUPLQLQJWKHFRUUHFWOXEULFDWLQJRLORQHPXVWWDNHLQWRFRQVLGHUDWLRQWKDW
DOOEHDULQJVZLOOKDYHKLJKHUWHPSHUDWXUHVGXULQJWKH¿UVWVHUYLFHKRXUV
,QFRQVWDQWRSHUDWLRQWKHEHDULQJWHPSHUDWXUHZLOOGHFUHDVHDERXW&)7KHRLO
WHPSHUDWXUHVKDOOEHORZHUWKDQ&)DIWHUWKLVUXQQLQJWLPH7KHEHDULQJRXWHU
UDFH WHPSHUDWXUH VKRXOG QRW H[FHHG & ) ,I WKH WHPSHUDWXUH LV KLJKHU WKH
reason may be a wrong oil quality, wrong oil level or overload of the pump because of
excessive wear.
If the humidity at the site is high, the bearings become easily rusty during stand still
periods. To avoid that, we recommend to mix the lubricating oil with a corrosion inhibitor
contact your lubrication oil supplier for proper additives inhibitors.
6.2.5 Lubrication Table
Pure Oil Mist
Oil Oil Bath and Purge Oil Mist Lubrication
Lubrication
Lubrication service Ball bearing
Mineral Oil Mineral Oil
Centrifugal Pump Lubrication
Type
(Petroleum Based (Petroleum Based
Ambient temperature -0 to 5 5 to 60 -5 to 60
°C (°F) (-4 to 95 (95 to 140 ( to 140
Oil temperature range -5 to 65 up to 5 up to 100 15 and above
°C (°F) ( to 149 (up to 5 (up to (59 and above
Viscosity
46 6 100
mm²/s 40°C [cSt]
First Oil Change hours 00 hours 0 hours 00 hours
000 hours or at least 000 hours or at least 000 hours or at least 000 hours or at least
Further Oil Changes
every 6 months every 6 months every 6 months every 6 months
Designation according to
46 6 100
DIN51502 ISO VG
6.3 Direction of rotation

7KHVHQVHRIURWDWLRQRIWKHSXPSLVFRXQWHUFORFNZLVH&&:ORRNLQJIURPWKHFRXSOLQJ
to the shaft end of the pump.
CAUTION The rotation of the driver shall be checked!
6.4 Priming and auxiliary supplies
The pump must be completely primed prior to start up by using the vent connections as
shown in the general arrangement drawing.
7KHYHQWLQJSURFHGXUHGHSHQGVRQWKHNLQGRIÀXLG7RYHULI\LIWKHSXPSLV¿OOHGZLWKOLTXLG
check:
D)RUQRQKD]DUGRXVOLTXLGVFORVHWKHYHQWYDOYHDIWHUPLQXWHVDQGUHRSHQLWVORZO\WR
proof if liquid escapes.
E )RU KD]DUGRXV OLTXLGV &KHPLFDOV QRQ ÀDVKLQJ K\GURFDUERQV YHQW OLQHV DUH XVXDOO\
SLSHGEDFNWRWKHVXFWLRQWDQNRUWRWKHÀDUH.HHSYHQWOLQHVRSHQDWOHDVWIRUPLQXWHV
DQGFKHFNVXFWLRQSUHVVXUHXQGVXFWLRQWHPSHUDWXUHDJDLQVWWKHVSHFL¿FDWLRQ
P a g e | 15
ARYA SEPEHR KAYHAN
c) For Àashing hydrocarbons vent lines are usually piped back to the suction tank or to the
Àare. Keep vent lines open at least for 30 minutes before starting the pump and check
suction pressure und suction temperature against the speci¿cation. For Àashing hydrocar-
bons, the vent line shall remain continuously open during operation in order to prevent
build up of vapour bubble or gas in the inlet area of the pump. Otherwise we recommend
to start the pump with vent lines slightly open. If a constant bypass line with a 3 mm (0.12
in.) ori¿ce is installed, it must be open at any time.
d) Auxiliary systems, e.g. barrier /buffer Àuid systems, cooling circuits, shall be ¿lled
according to the user instructions.
6.5 Starting the pump
a) Start the driver according to the speci¿cation. (Refer to driver IOM)
Note:
Pumps are usually started against closed discharge valve
b) Check the discharge and suction pressure gauge to verify the pumps delivered head.
Open the discharge valve slowly, until the pump reaches the speci¿ed operation point.
The pump must operate smoothly, and the vibration must be below 5 mm/s (0.2
in./sec) (API 610 vibration limits).
The discharge valve must be opened within 30 sec. after start up. Longer operation
against closed discharge valve will damage the pump. If a minimum Àow valve is
installed, take pressure gauge readings to verify the correct operation.
Note:
If the backpressure of the discharge pipe is suf¿cient, pumps can be started against
open valve.
Ensure that your driver is capable deliver the higher torque required by starting against
open valve.
To prevent the pump from reverse rotation after shut down, the installation of a check
valve is recommended. Although the pump is not affected by reverse rotation because
of special coupling design, it can be an issue with the driver.
Check the discharge and suction pressure gauge to verify the pumps delivered head.
The pump must operate smoothly, and the vibration must be below 5 mm/s (0.2
in./sec) (API 610 vibration limits). If a minimum Àow valve is installed, take pressure
gauge readings to verify the correct operation.
c) Check the pipe system against any leakage.
d) Check the mechanical seal against any leakage.
Note:
Right after start up a minor leakage of the mechanical seal is quite normal. Normally
this leakage disappears after few minutes of operation.
6.6 Operation
a) Verify that the pump is operating within the speci¿ed limits, min/max Àow, pressure,
temperature, vibration, power
b) The bearing housing temperature shall not exceed 0 C (176 F). If higher bearing
temperature are observed, check the viscosity grade of the used lubrication oil.
Note:
If the pump is equipped with hydrodynamic thrust bearing refer to bearing manufactur-
er’s IOM and to recommendation for maximum bearing temperature.
The minimum viscosity is 10 cSt at the expected oil temperature. (Oil temperature
CAUTION bearing gland temperature 10 C (50 F))
P a g e | 16
ARYA SEPEHR KAYHAN
c) From time to time check the pump shaft seal. Leakage of 5ml/hour is also with a mechan-
ical shaft seal unavoidable.
d) Check the correct venting of the Can and the headstock by opening the valve in the vent
line for short time. When the condition of service is near the boiling point, a permanent
vent line with a 3 mm ( 0.12 in.) ori¿ce (to inhibit the exit of too much liquid) must be
installed back to the suction tank. This will ensure that any suction and NPSH problems
can be avoided during normal service.
e) Observe the power consumption of the pump to detect excessive wear.
6.7 Stopping and Shutdown
a) Close the outlet valve, but ensure that the pump runs in this condition for no more than
a few seconds.
b) Stop the pump.
c) Switch off Àushing and/or cooling/ heating liquid supplies at a time appropriate to the
process.
d) For prolonged shutdowns and especially when ambient temperatures are likely to drop
below freezing point, the pump and any cooling and Àushing arrangements must be
drained or otherwise protected.
Note:
For automatic start/stop operation of the pump, ensure that all steps described in
section 6.4, 6.5 and 6.6 are implemented in the control logic.
6.8 Hydraulic, mechanical and electrical duty
This product has been supplied to meet the performance speci¿cations of your purchase
order, however it is understood that during the life of the product these may change. The
following notes will help the user to decide how to evaluate the implications of any change.
If in doubt contact ASK.
6SHFL¿FJUDYLW\6*
Pump capacity and total head in meters (feet) do not change with SG, however pressure
displayed on a pressure gauge is directly proportional to SG. Power absorbed is also
directly proportional to SG. It is therefore important to check that any change in SG will
not overload the pump driver or overpressurize the pump.
6.8.2 Viscosity
For a given Àow rate the total head reduces with increased viscosity and increases with
reduced viscosity. Also for a given Àow rate the power absorbed increases with increased
viscosity, and reduces with reduced viscosity. It is important that checks are made with
ASK if changes in viscosity are planned.
6.8.3 Pump speed
Changing pump speed effects Àow, total head, power absorbed, NPSHR, noise and
vibration. Flow varies in direct proportion to pump speed. Head varies as speed ratio
squared. Power varies as speed ratio cubed. If increasing speed it is important therefore to
ensure the maximum pump working pressure is not exceeded, the driver is not overload-
ed, NPSHA!NPSHR, and that noise and vibration are within local requirements and
regulations.
1HWSRVLWLYHVXFWLRQKHDG136+$
NPSH available (NPSHA.) is a measure of the energy available in the pumped liquid, above
its vapour pressure, at the pump suction branch. NPSH required (NPSHR.) is a measure of
the energy required in the pumped liquid, above its vapour pressure, to prevent the pump
from cavitating. It is important that NPSHA !NPSHR. The margin between NPSHA !NPSHR
should be as large as possible. If any change in NPSHA is proposed, ensure these margins
are not signi¿cantly eroded.
P a g e | 17
ARYA SEPEHR KAYHAN
Refer to the pump performance curve to determine exact requirements particularly if Àow
has changed. If in doubt please consult ASK for advise and details of the minimum allow-
able margin for your application.
3XPSHGÀRZ
Flow must not fall outside the minimum and maximum continuous safe Àow shown on the
pump performance curve and/or data sheet.
7 Maintenance
7.1 General
It is the plant operator's responsibility to ensure that all maintenance, inspection and
assembly work is carried out by authorized and quali¿ed personnel who have adequately
familiarized themselves with the subject matter by studying this manual in detail.
Any work on the machine must be performed when it is at a standstill. It is imperative that
the procedure for shutting down the machine is followed, as described in section 6..
On completion of work all guards and safety devices must be re-installed and made opera-
tive again.
Before restarting the machine, the relevant instructions listed in section 6, Commissioning,
start up, operation and shut down must be observed.
Oil and grease leaks may make the ground slippery. Machine maintenance must always
begin and ¿nish by cleaning the ground and the exterior of the machine.
If platforms, stairs and guard rails are required for maintenance, they must be placed for
easy access to areas where maintenance and inspection are to be carried out. The position-
ing of these accessories must not limit access or hinder the lifting of the part to be
serviced.
When air or compressed inert gas is used in the maintenance process, the operator and
anyone in the vicinity must be careful and have the appropriate
protection.
Do not spray air or compressed inert gas on skin.
Do not direct an air or gas jet towards other people.
Never use air or compressed inert gas to clean clothes.
Before working on the pump, take measures to prevent an uncontrolled start. Put a warn-
ing board on the starting device with the words:
Machine under repair: do not start.
With electric drive equipment, lock the main switch open and withdraw any fuses. Put a
warning board on the fuse box or main switch with the words:
Machine under repair: do not connect.
Never clean equipment with inÀammable solvents or carbon tetrachloride. Protect yourself
against toxic fumes when using cleaning agents.
7.2 Maintenance schedule
It is recommended that a maintenance plan and schedule is adopted, in line with these
User Instructions, to include the following:
a) Any auxiliary systems installed must be monitored, if necessary, to ensure they function
correctly.
b) Gland packings must be adjusted correctly to give visible leakage and concentric align-
ment of the gland follower to prevent excessive temperature of the packing or follower.
c) Check for any leaks from gaskets and seals. The correct functioning of the shaft seal
must be checked regularly.
P a g e | 18
ARYA SEPEHR KAYHAN
d) Check bearing lubricant level, and if the hours run show a lubricant change is required.
e) Check that the duty condition is in the safe operating range for the pump.
f) Check vibration, noise level and surface temperature at the bearings to con¿rm
satisfactory operation.
g) Check dirt and dust is removed from areas around close clearances, bearing housings
and motors.
h) Check coupling alignment and re-align if necessary.
If any problems are found the following sequence of actions should take place:
a) Refer to section 9, Faults; causes and remedies, for fault diagnosis.
b) Ensure equipment complies with the recommendations in this manual.
c) Contact ASK if the problem persists.
7.2.1 Routine Inspection (daily/weekly)
The following checks should be made and the appropriate action taken to remedy any
deviations.
a) Check operating behavior; ensure noise, vibration and bearing temperatures are
normal.
b) Check that there are no abnormal Àuid or lubricant leaks (static and dynamic seals) and
that any sealant systems (if ¿tted) are full and operating normally.
c) Check that shaft seal leaks are within acceptable limits.
d) Check the level and condition of lubrication oil. On grease lubricated pumps, check
running hours since last recharge of grease or complete grease change.
e) Check any auxiliary supplies eg. heating/cooling (if ¿tted) are operating correctly.
f) Refer to the manuals of any associated equipment if routine checks needed.
7.2.2 Periodic Inspection (every 6 Month)
a) Check foundation bolts for security of attachment and corrosion.
b) Check pump operation hours to determine if bearing lubricant shall be changed.
c) The coupling should be checked for correct alignment and worn driving elements.
7.3 Spare parts

7.3.1 Ordering of spares
When ordering spare parts we need the following information:
1. pump type and pump size
2. serial number of the pump
3. number of the required spare parts
4. reference number and name of the part as listed in the part list or in the sectional
drawing.
The serial number of each pump is indicated on the name plate. If the material should be
changed from the original delivered one, additionally indicate the exact material
speci¿cation. If ordered impellers shall have smaller or larger outer diameter, indicate also
with your order. Without a special remark the spare impellers will be delivered with the
diameter of the original impellers.
If you need the wear rings oversized or undersized, please indicate, otherwise the wear
rings will be delivered with standard size.
To ensure continuous satisfactory operation, replacement parts to the original design
speci¿cation should be obtained from ASK.
P a g e | 19
ARYA SEPEHR KAYHAN
7.3.2 Storage of spares

Spares should be stored in a clean dry area away from vibration. Inspection and
retreatment of metallic surfaces (if necessary) with preservative is recommended at a 6
monthly interval.
7.4 Recommended spare parts
Spares Recommended
Part Start up Normal Maintenance
No.of identical pumps 1-3 4-6 7+ 1-3 4-6 7-9 10+
Element (if unspared) (*) 1 1 1 1

Rotor 1 1 1 1
Can 1
Pump Head 1
Motor support 1
Shaft (with key) 1 1 2 1
Impeller 1 1 2 3
Wear rings (set) 1 1 1 1 1 2 3
Bearings complete (antifriction,radial) 1 2 3 1 2 3 3
Bearings complete (antifriction,thrust) 1 2 3 1 2 3 3
Bush bearing (hydrodynamic,thrust) (set) 1 1 1 1 1 1 5
Mechanical seal complete (Cartridge) 1 2 3 1 2 3 3
Shaft sleeve 1 2 3 1 2 3 3
Gaskets, O-rings (set) 1 2 3 1 2 3 3
Bearing bushings and sleeves (set) 1 1 2 1 1 3 3
Stage bushings and sleeves (set) 1 1 2 1 1 3 3
(*) Vital service pumps are generally unspared, partially spared or multistage. When a vital machine is down,
production loss or violation of environmental permits results. Element consist of assembled rotor plus stationary
hydraulic parts (diffuser(s) or volute(s)).
7.5 Dismantling the pump set

7.5.1 General notes/Safety regulations
- Always have repair and maintenance work performed by specially trained, quali¿ed
WARNING
personnel.
- Allow the pump set to cool down to ambient temperature.

WARNING
- For any work on the motor, observe the instructions of the relevant motor manufacturer.
- For dismantling and reassembly observe the exploded view and the general assembly
drawing.
- Properly shut down the pump set.

- Close the shut-off elements in the suction and discharge line.
- Drain the pump and release the pump pressure.
DANGER
- Close any auxiliary connections.

DANGER - Allow the pump set to cool down to ambient temperature.
P a g e | 20
ARYA SEPEHR KAYHAN
Note:
After a prolonged period of operation the individual parts may be hard to pull off the shaft.
If this is the case, use a brand name penetrating agent and/or - if possible – an appropriate
pull-off device.
7.5.2 Preparing the pump set
a) Disconnect the power supply (e.g. at the motor).
b) Disconnect and remove all auxiliary pipe work.
c) Unbolt the discharge and suction nozzles from the pipeline.
Before dismantling the pump for overhaul, ensure genuine Flowserve replacement parts
are available.
CAUTION Refer to sectional drawings for part numbers and identi¿cation.
'LVPDQWOLQJRIUDGLDOÀRZLPSHOOHUSXPSW\SHV
1) Completely drain the pump by using the drain connection. By pumping explosive or
toxic media, Àush it with Nitrogen.
2) remove the motor.
3) remove the motor support [815].
4) Pull off the coupling hub from the pump shaft [210.01] and take out the key.
Note:
If the pump is equipped with a rigid spacer coupling open the socket head cap screws
and remove the spacer.
5) Loose hex head screws [901.03] and pull out the pump from its can.
6) Drain the oil from the bearing housing using the oil drain plug, Loose the socket head
cap screws [912.01] & remove the bearing housing cover. Loose the chuck-nut [919]
and remove the chuck-nut washer from the pump shaft. Loose the hex head screws
[901.01], Pull off the bearing housing [330] in parallel with the shaft & take out the
keys.
7) Remove the cover plate of bearing housing support.
8) Loose the set screws [915.01] and remove the tightening bush [925] from the pump
shaft.
9) Loose the hex head screws [901.04], pull off the mechanical seal cartridge and remove
the O-rings [412].
10) Loose the hex head screws [901.02], Pull off the bearing housing support [733] in a
secure way in parallel with the shaft.
11) Open the hex head screws [901.5], disconnect the ¿rst column pipe from the Pump-
head [635.02] and pull of the bush bearing assembly.
Note:
If the pump equipped with external Àushing, remove the related pipes after step 11.
12) Pull out the complete bowl assembly together with shafts and column pipes.
Disconnect the ¿rst column pipe.
13) Open the socket head cap screws [912.02] and slip upwards the intermediate coupling
[D]. Remove the coupling split [122.01]. Now the shafts are uncoupled and you can
proceed the same way with the next column pipe until the bowl assembly can be discon-
nected from the intermediate or top shaft.
14) Open the tie bolt and hex nuts and remove the suction piece [182].
15) Pull off the ¿rst impeller [230] from the pump shaft and remove the impeller key.
16) Pull off the ¿rst bowl [145], including the diffuser [102]. Now you can take off the inter-
stage sleeve [220.05] and the next stage impeller.
17) Proceed with the next stage by repeating step 15 and 16, until the hydraulic section is
completely dismantled.
Note:
For disassembly of column sections proceed with step 11-13.
P a g e | 21
ARYA SEPEHR KAYHAN
7.6 Examination of parts

1) Check the intermediate bearing sleeves and bushings against any wear. The diametrical
clearance between sleeves and bushings must not exceed twice the value in new
condition.
2) Check the wear rings against any wear. The diametrical clearance between the ring and
the impeller suction must not exceed twice the value in new condition.
3) Check all parts against corrosion and erosion.
4) Carefully check the coupling against any wear.
5) Rotate the angular contact bearing by hand, to check against abnormal sound. Check
the bearing cages against any wear and the outer and inner race against running marks.
Check the runout of the shafts. TIR (Total Indicated Runout) shall not exceed 0.04
mm/m (0.0005 in./ft) of length. TIR shall not exceed 0.08 mm (0.003 in.) over total
shaft length.
7.7 Assembly
To assemble the pump consult the sectional drawing.
Note:
Ensure threads, gasket and O-ring mating faces are clean. Apply thread sealant to
non-face sealing pipe thread ¿ttings.
Note:
After complete assembly with pump head and bearing housing the rotor must be lifted!
8 Troubleshooting
FAULT SYMPTOM
Pump overheats and seizes
Bearings have short life
Pump vibrates or is noisy
Mechanical seal has short life
Mechanical seal leaks excessively
Pump requires excessive power
Pump loses prime after starting
Insufficient pressure developed
Insufficient capacity delivered
Pump does not deliver liquid
PROBABLE CAUSES POSSIBLE REMEDIES
A. SYSTEM TROUBLES
Pump not primed. %JGEMEQORNGVGſNNKPI
Pump or suction pipe not completely filled with
%JGEMCPFEQORNGVGHKNNKPI
liquid.
'ZEGUUKXGCOQWPVQHCKTQTICUKPNKSWKF %JGEMCPFRWTIGHTQORKRGU
Air or vapor pocket in suction line. %JGEMUWEVKQPNKPGFGUKIPHQTRQEMGVU
Air leaks into suction line. %JGEMCKTVKIJVRKRGVJGPLQKPVUCPFICUMGVU
#KTNGCMUKPVQRWORVJTQWIJOGEJCPKECNUGCN %JGEMCKTVKIJVCUUGODN[VJGPLQKPVUCPF
UNGGXGLQKPVUECUKPILQKPVQTRKRGNWIU ICUMGVU
Check pump-head and head losses in
6QVCNJGCFQHU[UVGOJKIJGTVJCPFKHHGTGPVKCN
FKUEJCTIGRKRGCVVJGXCNXGUGVVKPIU%JGEM
head of pump.
DCEMRTGUUWTGKUPQVVQQJKIJ
6QVCNJGCFQHU[UVGONQYGTVJCPRWORFGUKIP 6JTQVVNGCVFKUEJCTIGXCNXGQTCUM(NQYUGTXGKH
head. VJGKORGNNGTECPDGVTKOOGF
5RGEKHKEITCXKV[QHNKSWKFFKHHGTGPVHTQOFGUKIP Consult ASK
P a g e | 22
ARYA SEPEHR KAYHAN
FAULT SYMPTOM
Viscosity of liquid differs from that for which
Consult ASK
designed.
Operation at very low capacity. Measure value and check minimum permitted
Measure value and check maximum
Operation at high capacity.
permitted
B. MECHANICAL TROUBLES
Check the flange connections and eliminate
Misalignment due to pipe strain. strains using elastic couplings or a method
permitted
Check setting of baseplate: tighten, adjust,
Improperly designed foundation.
grout base as required
Shaft bent. Check shaft runouts within acceptable values
Rotating part rubbing on stationary part Check for signs of this and consult ASK
internally. if necessary
Bearings worn Replace bearings
Wearing ring surfaces worn. Replace worn wear ring/ surfaces
Impeller damaged or eroded. Replace impeller and check reason
Leakage under sleeve due to joint failure. Replace joint and check for damage
Check alignment of faces or damaged parts
Mechanical seal improperly installed.
and assembly method used
Incorrect type of mechanical seal for operating
Consult ASK
conditions.
Check misalignment and correct if necessary.
Shaft running off centre because of worn
If alignment satisfactory check bearings for
bearings or misalignment.
excessive wear
Impeller out of balance resulting in vibration. Check and consult ASK
Abrasive solids in liquid pumped. Check and consult ASK
Check mechanical seal condition and source
Mechanical seal was run dry.
of dry running and repair
Internal misalignment due to improper repairs Check method of assembly, possible damage
causing impeller to rub. or state of cleanliness during assembly
Excessive thrust caused by a mechanical Check wear condition of Impeller, its
failure inside the pump. clearances and liquid passages
Excessive grease in ball bearings. Check method of regreasing
Check hours run since last change of
Lack of lubrication for bearings.
lubricant, the schedule and its basis
Check method of assembly, possible damage
Improper installation of bearings or state of cleanliness during assembly and
type of bearing used
P a g e | 23
ARYA SEPEHR KAYHAN
FAULT SYMPTOM
Check contamination source and replace
Damaged bearings due to contamination.
damaged bearings
C. ELECTRICAL TROUBLES
Wrong direction of rotation. Reverse 2 phases on motor terminal box
Motor running too slow, Check motor terminal box connections
P a g e | 24
ARYA SEPEHR KAYHAN
How did we measure up?

It is our sincere intention to exceed our customer’s expectations on every order. Tell us
if we achieved our goal on your order.
We appreciate you taking the time to provide your feedback. Thank you for buying ASK
pumps, parts, and Electro-power systems.
Visit our Web site for the latest version of this document and more information
www.aryask.com
P a g e | 25
Arya Sepehr Kayhan Co.
ARYA SEPEHR KAYHAN
Pump & Electro Power System
www.aryask.com info@aryask.com

vs6 Installation and Operation Manual - 2015

Uploaded by

Copyright:

Available Formats

vs6 Installation and Operation Manual - 2015

Uploaded by

Document Information

Original Title

Copyright

Available Formats

Share this document

Share or Embed Document

Sharing Options

Did you find this document useful?

Is this content inappropriate?

Copyright:

Available Formats

vs6 Installation and Operation Manual - 2015

Uploaded by

Copyright:

Available Formats

VS6 Series

ARYA SEPEHR KAYHAN

Table of Contents Page

2.1 Key to safety symbols/markings

2.10 Explosion protection

3 Transport/Temporary Storage/Long-Term Storage/Disposal

- Observe the local accident prevention regulations.

For lifting the driver Depending on the pump size the

Use suction & discharge

4 pieces lifting screw A crane must be used for

3.4 Return to supplier

4 Description of the Pump (Set)

Impeller code Can Length

No. of elctric Material class

4.3 Main Parts

4.3.2 Bearing housing

4.3.3 Bearing housing support

4.3.4 Pump head

4.3.4 Suction can

4.3.5 Hydraulics parts

4.4 Performance and operating limits

- Verify the test certi¿cate of the motor.

5.3.3 Concrete foundation

frame around the Can. So the grouting

5.4 Initial alignment

For more details refer to the manufacturer’s procedure of alignment.

5.5.3 Auxiliary piping

5.5.4 Final check

5.6 Electrical connections

Electrical connections must be made by a quali¿ed Electrician in accordance with relevant

It is important to be aware of the EUROPEAN DIRECTIVE on potentially explosive areas

It is important to be aware of the EUROPEAN DIRECTIVE on electromagnetic compatibility

A device to provide emergency stopping must be ¿tted.

5.7 Final shaft alignment check

5.8 Protection Systems

6 Commissioning, Startup, Operation and Shutdown

6.1 Pre-commissioning Procedure

6.3 Direction of rotation

7.3 Spare parts

7.3.2 Storage of spares

Element (if unspared) (*) 1 1 1 1

7.5 Dismantling the pump set

- Allow the pump set to cool down to ambient temperature.

- Properly shut down the pump set.

- Close any auxiliary connections.

7.6 Examination of parts

How did we measure up?

ARYA SEPEHR KAYHAN

Pump & Electro Power System

You might also like