Sinamics DCM Control Module En-Us

Edition 06/2023
OPERATING INSTRUCTIONS
SINAMICS
SINAMICS DCM
Control Module
www.siemens.com/drives
Preface
Safety instructions 1
Ordering information 2
SINAMICS
Description 3
SINAMICS DCM Control Module 4
Technical data
Transport, unpacking,
installation 5
Operating Instructions
Connecting 6
Additional system
components 7
Commissioning 8
Operation 9
Descriptions of functions 10
Maintenance 11
Applications 12
Functional safety 13
Firmware Version V1.5.1
Appendix A A
Appendix B B
06/2023
A5E34888669A
Appendix C C
Legal information
Warning notice system
This manual contains notices you have to observe in order to ensure your personal safety, as well as to prevent
damage to property. The notices referring to your personal safety are highlighted in the manual by a safety alert
symbol, notices referring only to property damage have no safety alert symbol. These notices shown below are
graded according to the degree of danger.
DANGER
indicates that death or severe personal injury will result if proper precautions are not taken.
WARNING
indicates that death or severe personal injury may result if proper precautions are not taken.
CAUTION
indicates that minor personal injury can result if proper precautions are not taken.
NOTICE
indicates that property damage can result if proper precautions are not taken.
If more than one degree of danger is present, the warning notice representing the highest degree of danger will
be used. A notice warning of injury to persons with a safety alert symbol may also include a warning relating to
property damage.
Qualified Personnel
The product/system described in this documentation may be operated only by personnel qualified for the specific
task in accordance with the relevant documentation, in particular its warning notices and safety instructions.
Qualified personnel are those who, based on their training and experience, are capable of identifying risks and
avoiding potential hazards when working with these products/systems.
Proper use of Siemens products
Note the following:
WARNING
Siemens products may only be used for the applications described in the catalog and in the relevant technical
documentation. If products and components from other manufacturers are used, these must be recommended or
approved by Siemens. Proper transport, storage, installation, assembly, commissioning, operation and maintenance
are required to ensure that the products operate safely and without any problems. The permissible ambient
conditions must be complied with. The information in the relevant documentation must be observed.
Trademarks
All names identified by ® are registered trademarks of Siemens AG. The remaining trademarks in this publication
may be trademarks whose use by third parties for their own purposes could violate the rights of the owner.
Disclaimer of Liability
We have reviewed the contents of this publication to ensure consistency with the hardware and software
described. Since variance cannot be precluded entirely, we cannot guarantee full consistency. However, the
information in this publication is reviewed regularly and any necessary corrections are included in subsequent
editions.
Siemens AG A5E34888669A Copyright © Siemens AG 2009 - 2023.

Digital Industries Ⓟ 08/2023 Subject to change All rights reserved
Postfach 48 48
90026 NÜRNBERG
GERMANY
Preface
Product name
The SINAMICS DCM product name is used in the documentation for SINAMICS DCM Control
Modules.
This designation is often (frequently in circuit diagrams and topology arrangements) used
in these instructions as an alternative designation for the combination of SINAMICS DCM
Control Module and external converter power unit.
Intended use
The products described in this manual, together with software, accessories and options, form an
electric drive to supply low-voltage DC motors or other DC loads for non-motor applications
referenced in this manual. The products are intended for use in industrial environments. The
products must be installed and maintained by professionals with sufficient knowledge to
implement the safety and EMC measures in accordance with the specifications described in this
manual and the recognized state-of-the-art engineering practices.
You may only use the products in compliance with the following requirements:
• All regulations and directives that are applicable at the place of final use, especially with
regard to electrical safety, functional safety and electromagnetic compatibility.
• All instructions, notes, technical data and safety information contained in this manual and
other supporting documentation.
Before using the products, you must perform a risk assessment of the entire application and
implement appropriate system design measures to ensure the safety of persons, property
and electromagnetic compatibility.
Open type products (IP00 / IP20) are intended for installation in control cabinets or housings,
which offer the necessary protection.
Any use other than that expressly permitted is prohibited, and can result in unforeseen
dangers.
Note
For non-motor applications, compliance with the limits for electromagnetic emissions specified
in the IEC 61800-3 has not been verified. The system integrator or operator is responsible for
EMC planning.
Device firmware version

As these Operating Instructions went to print, SINAMICS DCM Control Modules were being
supplied from the factory with firmware version specified on the inside front page.
SINAMICS DCM Control Module

Operating Instructions, 06/2023, A5E34888669A 3
Preface
However, these Operating Instructions can, in principle, also apply to other firmware versions.
• Older firmware versions:
It is possible that not all of the functions described here are actually available.
• Newer firmware versions:
It is possible that SINAMICS DCM Control Modules may feature additional functions that are
not described in these Operating Instructions. Do not change any parameters that you
cannot find in the List Manual from their factory setting, and do not give parameters any
values that are not specified in the List Manual.
The firmware version is displayed using r50060[6].
Example:
01050101 displayed on the BOP20 means 01.05.01.01 → Version 1.5, Service Pack 1, Hotfix
1
When required, you can obtain the current firmware from your local Siemens sales office.
Download of the current firmware version for registered users (https://
support.industry.siemens.com/cs/ww/en/view/44029688)
Note
Hardware/firmware compatibility
The hardware version of the Control Unit (CUD) must be taken into account when updating the
device firmware, see the following table.
The hardware version can be read from the label on the right-hand side of the CUD.
CUD (print on label) Executable firmware versions

C98043-A7100-L1-... 1.1, 1.2, 1.3
C98043-A7100-L2-...
C98043-A7100-L100-...
C98043-A7100-L200-...
C98043-A7100-L3-... All versions
C98043-A7100-L4-...
C98043-A7100-L103-...
C98043-A7100-L204-...
A5E... All versions

4 Operating Instructions, 06/2023, A5E34888669A
Preface
Getting information about the product

There is a QR code on the product and on the product packaging. You can recognize the ID link
by the frame with a black frame corner at the bottom right.
*%-JOL
Scan the QR code using either a standard code scanner or the "Industry Online Support" app.
When using a standard code scanner, you open the scanned ID link in an Internet browser
that is provided on your device.
You can use the ID link to get product data, manuals, declarations of conformity, certificates
and other information about your product.
SINAMICS DCM documentation available
SINAMICS DCM DC Converters Operating Instructions

contains all information on
ordering, installation, connecting, commissioning, maintaining, description of functions,
and service
SINAMICS DCM Control Modules Operating Instructions
contains all information on
ordering, installation, connecting, commissioning, maintaining, description of functions,
and service
SINAMICS DCM List Manual (for DC converters and control modules)
Contains
parameter list, function diagrams, list of faults and alarms
SINAMICS free function blocks, function description
Includes a general description, list of parameters, the function block diagrams as well as the
list of faults and alarms.
Manuals and application notes on the Internet

The manuals and application documents are also available in the Internet:
Manuals and application notes (https://support.industry.siemens.com/cs/ww/en/ps/13298)
The list of general conditions available there include current supplements to the manuals.
The notes included in the general condition lists have a higher priority than the statements
made in the manuals.
FAQ in the Internet

FAQ (https://support.industry.siemens.com/cs/ww/en/ps/13298/faq)

Preface
Service
You can find information on our services and regional contact persons in the Internet - (https://
support.industry.siemens.com/sc/ww/en/sc)
Technical Support
Our technical support can provide you with technical assistance for products, systems, and
solutions:
Service (https://support.industry.siemens.com/sc/ww/en/sc)
Spare parts
You can find information on spare parts
• In catalog D23.1
• Via the electronic spare parts catalog Spares On Web, after entering the serial number and
article number of your SINAMICS DCM in the Internet (registration required).
Spares on Web (https://www.sow.siemens.com/)
Use of third-party products in this documentation

This documentation contains recommendations relating to third-party products. Siemens
accepts the fundamental suitability of these third-party products. You can use equivalent
products from other manufacturers.
Siemens does not accept any warranty for the use of third-party products.
Websites of third parties

This publication contains hyperlinks to websites of third parties. Siemens does not take any
responsibility for the contents of these websites or adopt any of these websites or their contents
as their own, because Siemens does not control the information on these websites and is also
not responsible for the contents and information provided there. Use of these websites is at the
risk of the person doing so.
Use of OpenSSL
This product contains software (https://www.openssl.org/) that has been developed by the
OpenSSL project for use in the OpenSSL toolkit.
This product contains cryptographic software (mailto:eay@cryptsoft.com) created by Eric
Young.
This product contains software (mailto:eay@cryptsoft.com) developed by Eric Young.
Compliance with the General Data Protection Regulation

Siemens respects the principles of data protection, in particular the data minimization rules
(privacy by design).

Preface
For this product, this means:

The product does not process neither store any person-related data, only technical function
data (e.g. time stamps). If the user links these data with other data (e.g. shift plans) or if
he stores person-related data on the same data medium (e.g. hard disk), thus personalizing
these data, he has to ensure compliance with the applicable data protection stipulations.
Further Internet links

Generic station description file (GSD) for
PROFIBUS (https://support.industry.siemens.com/cs/ww/en/view/98206128)
PROFINET (https://support.industry.siemens.com/cs/ww/en/view/98207877)

Preface

Table of contents
Preface ................................................................................................................................................... 3
1 Safety instructions ............................................................................................................................... 21
1.1 General safety instructions................................................................................................. 21
1.2 Fundamental safety instructions for functional safety ......................................................... 26
1.3 Hearing protection ............................................................................................................. 27
1.4 Warning note relating to the off button of the AOP30 ......................................................... 27
1.5 ESD-sensitive components ................................................................................................. 27
1.6 Security information .......................................................................................................... 28
1.7 Industrial security .............................................................................................................. 28
1.8 Residual risks of power drive systems ................................................................................. 29
2 Ordering information........................................................................................................................... 31
2.1 Device article numbers....................................................................................................... 31
2.2 Rating plates, packaging label ............................................................................................ 31
2.3 Ordering information for options and accessories ............................................................... 32
3 Description........................................................................................................................................... 39
4 Technical data...................................................................................................................................... 43
4.1 Environmental conditions .................................................................................................. 43
4.2 Unit data ........................................................................................................................... 44
5 Transport, unpacking, installation....................................................................................................... 47
5.1 Transport, unpacking ......................................................................................................... 47
5.2 Installation ........................................................................................................................ 47
5.2.1 Dimension drawings .......................................................................................................... 47
5.2.2 Dividing the unit ................................................................................................................ 55
5.2.3 Removal/Installation and division of modules ..................................................................... 57
5.2.3.1 Removing modules ............................................................................................................ 57
5.2.3.2 Firing pulse transformer module ........................................................................................ 59
5.2.3.3 Fuse monitoring and voltage measurement ....................................................................... 62
5.2.4 Installing options and accessories....................................................................................... 63
5.2.4.1 AOP30 operator panel........................................................................................................ 63
5.2.4.2 Fuse monitoring distributor................................................................................................ 63
5.2.4.3 Installing a second CUD...................................................................................................... 64
6 Connecting .......................................................................................................................................... 67
6.1 Instructions for EMC-compliant drive installation ................................................................ 68
6.1.1 Basic information about EMC ............................................................................................. 68
6.1.2 EMC-compliant drive installation (installation instructions) ................................................. 72

Table of contents
6.1.3 Arranging components for converter units ......................................................................... 77

6.1.4 Radio interference suppression filter ................................................................................... 78
6.1.5 Information on line-side harmonics produced by converter units in a fully-controlled two-
pulse bridge circuit configuration (B6C and (B6)A(B6)C) ..................................................... 79
6.1.6 Data on the line-side harmonics from converter units in a fully-controlled AC bridge circuit
B2C ................................................................................................................................... 81
6.1.7 Electromagnetic fields at the workplace.............................................................................. 81
6.2 Cable routing in the device................................................................................................. 82
6.3 Block diagram with connection suggestion......................................................................... 87
6.4 Connecting the external power unit ................................................................................... 90
6.5 Division options ................................................................................................................. 96
6.6 Measurement of the armature current.............................................................................. 109
6.6.1 General information......................................................................................................... 109
6.6.2 Current measurement with two current transformers on the line side ............................... 110
6.6.3 Current measurement via terminal block XB-1 to XB-4 with external measuring circuit ...... 112
6.6.3.1 External current transformers in V-circuit with +1 V at rated armature DC current.............. 112
6.6.3.2 External current transformers in V-circuit with +10 V at rated armature DC current............ 113
6.6.3.3 Differential input for +/-10 V at rated armature DC current ................................................ 114
6.6.3.4 Input for +/-1 V at rated armature DC current.................................................................... 114
6.6.4 External current measurement via X21A or X_I_IST........................................................... 115
6.6.5 Offset correction via XN1.................................................................................................. 116
6.6.6 Information on the differential input, control limits, and grounding .................................. 116
6.7 Connecting the firing pulse transformers .......................................................................... 118
6.7.1 General information......................................................................................................... 118
6.7.2 Normal use (individual).................................................................................................... 118
6.7.3 Parallel connection of firing pulses ................................................................................... 119
6.7.4 External amplification of firing pulses ............................................................................... 119
6.8 Connecting voltage measurement equipment .................................................................. 120
6.9 Connecting fuse monitoring equipment ........................................................................... 120
6.10 Parallel connection of power units.................................................................................... 121
6.11 Field supply ..................................................................................................................... 123
6.12 Commutating reactors ..................................................................................................... 123
6.13 Fuses ............................................................................................................................... 127
6.14 Arrangement of printed circuit boards .............................................................................. 128
6.15 Arrangement of customer connections (connector terminals, Faston mounting tabs)........ 129
6.16 Connector assignment (terminals, Faston mounting tabs, ribbon cables) .......................... 137
6.16.1 Connecting the protective conductor................................................................................ 138
6.16.2 Field circuit ...................................................................................................................... 139
6.16.3 Electronic power supply ................................................................................................... 139
6.16.4 Open-loop and closed-loop control section....................................................................... 139
6.16.4.1 Terminals on the Connector Board.................................................................................... 140
6.16.4.2 Using a pulse encoder with SINAMICS DCM ...................................................................... 143
6.16.4.3 Assignment of electronics terminals at the Power Interface............................................... 146
6.16.4.4 Serial interface to AOP30/USS interface ............................................................................ 148
6.16.4.5 PROFIBUS connection....................................................................................................... 149

Table of contents
6.16.4.6 DRIVE-CLiQ connection .................................................................................................... 149

6.16.4.7 Parallel interface .............................................................................................................. 150
6.16.4.8 Terminal assignment for option G63................................................................................. 150
6.16.4.9 Connectors at the power interface ................................................................................... 152
6.16.4.10 CompactFlash Card slot.................................................................................................... 152
6.16.5 Voltage measurement equipment .................................................................................... 154
6.16.6 Fuse monitoring equipment ............................................................................................. 155
6.16.7 Firing pulse transformers ................................................................................................. 156
6.16.8 Firing pulse...................................................................................................................... 159
6.16.9 Ribbon cables .................................................................................................................. 162
6.16.10 Assignment of the RS485 cable to the AOP30 ................................................................... 167
6.16.11 Terminal assignment functional safety.............................................................................. 168
7 Additional system components ......................................................................................................... 169
7.1 Option Board: CBE20 Communication Board Ethernet....................................................... 170
7.1.1 Description ...................................................................................................................... 170
7.1.2 Safety instructions ........................................................................................................... 170
7.1.3 Interface description ........................................................................................................ 171
7.1.3.1 Overview ......................................................................................................................... 171
7.1.3.2 X1400 Ethernet interface ................................................................................................. 171
7.1.4 Meaning of the LEDs ........................................................................................................ 172
7.1.5 Installation ...................................................................................................................... 174
7.1.6 Technical data.................................................................................................................. 174
7.2 Sensor Module Cabinet-Mounted SMC10.......................................................................... 175
7.2.1 Description ...................................................................................................................... 175
7.2.3.1 Overview ......................................................................................................................... 177
7.2.3.2 X500 DRIVE-CLiQ interface ............................................................................................... 178
7.2.3.3 X524 Electronics power supply......................................................................................... 178
7.2.3.4 X520 Encoder system interface ........................................................................................ 179
7.2.4 Connection example ........................................................................................................ 180
7.2.5 Meaning of the LED ......................................................................................................... 180
7.2.6 Dimension drawing.......................................................................................................... 181
7.2.7 Installation ...................................................................................................................... 181
7.2.8 Technical data.................................................................................................................. 182
7.3 Sensor Module Cabinet-Mounted SMC30.......................................................................... 184
7.3.1 Description ...................................................................................................................... 184
7.3.3.1 Overview ......................................................................................................................... 187
7.3.3.2 X500 DRIVE-CLiQ interface ............................................................................................... 188
7.3.3.4 X520 Encoder system interface ........................................................................................ 189
7.3.3.5 X521/X531 Alternative encoder system interface.............................................................. 190
7.3.4 Connection examples....................................................................................................... 191
7.3.5 Meaning of the LEDs ........................................................................................................ 193
7.3.7 Installation ...................................................................................................................... 194
7.3.8 Protective conductor connection and shield support ......................................................... 196
7.3.9 Technical data.................................................................................................................. 196

Table of contents
7.4 Terminal Module TM15 .................................................................................................... 200

7.4.1 Description ...................................................................................................................... 200
7.4.3.1 Overview ......................................................................................................................... 202
7.4.3.2 X500/X501 DRIVE-CLiQ interfaces .................................................................................... 203
7.4.3.4 X520 Bidirectional digital inputs/outputs .......................................................................... 204
7.4.7 Installation ...................................................................................................................... 208
7.4.9 Connector coding ............................................................................................................ 210
7.4.10 Technical data.................................................................................................................. 212
7.5 Terminal Module TM31 .................................................................................................... 213
7.5.1 Description ...................................................................................................................... 213
7.5.3.1 Overview ......................................................................................................................... 216
7.5.3.4 X520, X530 Digital inputs ................................................................................................ 218
7.5.3.5 X521 Analog inputs ......................................................................................................... 220
7.5.3.6 Analog inputs current/voltage switch ............................................................................... 220
7.5.3.7 X522 Analog outputs/temperature sensor ........................................................................ 221
7.5.3.8 X540 Auxiliary voltage for the digital inputs ..................................................................... 222
7.5.3.10 X542 Relay outputs.......................................................................................................... 224
7.5.7 Installation ...................................................................................................................... 227
7.5.9 Connector coding ............................................................................................................ 230
7.5.10 Technical data.................................................................................................................. 230
7.6 Terminal Module TM150 .................................................................................................. 231
7.6.1 Description ...................................................................................................................... 231
7.6.3.1 Overview ......................................................................................................................... 233
7.6.3.4 X531-X536 Temperature sensor inputs............................................................................. 235
7.6.4 Connection examples....................................................................................................... 237
7.6.7 Installation ...................................................................................................................... 240

Table of contents
7.6.9 Technical data.................................................................................................................. 242

8 Commissioning .................................................................................................................................. 243
8.1 Commissioning checklist .................................................................................................. 243
8.2 Switching on ................................................................................................................... 245
8.3 Commissioning using the BOP20 Operator Panel .............................................................. 246
8.3.1 Requirements .................................................................................................................. 246
8.3.2 Commissioning steps ....................................................................................................... 247
8.4 Commissioning using the AOP30 Operator Panel .............................................................. 253
8.4.1 First commissioning ......................................................................................................... 253
8.4.1.1 Running-up for the first time ............................................................................................ 254
8.4.1.2 Full drive commissioning.................................................................................................. 255
8.4.2 Status after commissioning .............................................................................................. 259
8.4.3 Parameter reset to factory settings ................................................................................... 259
8.5 Commissioning with the STARTER commissioning tool ...................................................... 259
8.5.1 STARTER commissioning tool............................................................................................ 259
8.5.1.1 Installing the STARTER commissioning tool ....................................................................... 260
8.5.1.2 Layout of the STARTER user interface................................................................................ 260
8.5.2 Procedure for commissioning with STARTER...................................................................... 261
8.5.2.1 Creating the project ......................................................................................................... 261
8.5.2.2 Configuring a drive unit.................................................................................................... 269
8.5.2.3 Starting the drive project.................................................................................................. 290
8.6 Activating function modules ............................................................................................ 294
8.6.1 Offline activation via STARTER........................................................................................... 295
8.6.2 Online activation via parameters ...................................................................................... 296
8.7 Commissioning optional additional modules .................................................................... 297
8.7.1 Terminal Modules (TM31, TM15, TM150) ......................................................................... 298
8.7.1.1 Commissioning with STARTER .......................................................................................... 298
8.7.1.2 Commissioning via parameter assignment........................................................................ 300
8.7.2 Encoder evaluation (SMC10, SMC30) ............................................................................... 301
8.7.2.1 Add/commissioning (with STARTER) ................................................................................. 302
8.7.2.2 Removal (with STARTER) .................................................................................................. 306
8.7.3 CBE20 Communication Board Ethernet............................................................................. 306
8.7.3.1 Adding online into the drive ............................................................................................. 306
8.7.3.2 Adding offline in STARTER................................................................................................. 307
8.7.3.3 Deleting from the drive online.......................................................................................... 308
8.7.3.4 Deleting offline with STARTER ........................................................................................... 308
8.8 Drive optimization ........................................................................................................... 308
8.9 Manual optimization ........................................................................................................ 315
8.9.1 Optimization of closed-loop armature current control ....................................................... 316
8.9.2 Optimization of closed-loop field-current control .............................................................. 318
8.9.3 Optimizing the speed controller ....................................................................................... 319
9 Operation........................................................................................................................................... 321
9.1 Basic information............................................................................................................. 321
9.1.1 Parameter........................................................................................................................ 321
9.1.2 Data sets.......................................................................................................................... 324
9.1.2.1 Function diagrams and parameters .................................................................................. 326

Table of contents
9.1.2.2 Handling data sets ........................................................................................................... 327

9.1.3 Drive objects.................................................................................................................... 328
9.1.4 Memory card functions .................................................................................................... 329
9.1.5 BICO technology: Interconnecting signals ......................................................................... 335
9.1.5.1 Binectors, connectors....................................................................................................... 335
9.1.5.2 Interconnecting signals using BICO technology................................................................. 336
9.1.5.3 Internal encoding of the binector/connector output parameters........................................ 337
9.1.5.4 Example: Interconnecting digital signals........................................................................... 338
9.1.5.5 Notes on BICO technology................................................................................................ 338
9.2 Parameterizing using the BOP20 (Basic Operator Panel 20) ............................................... 339
9.2.1 General information on BOP20......................................................................................... 339
9.2.2 Displays and operation with the BOP20 ............................................................................ 342
9.2.3 Displaying faults and alarms............................................................................................. 347
9.2.4 Controlling the drive using the BOP20 .............................................................................. 348
9.3 Controlling via the AOP30 operator panel ......................................................................... 348
9.3.1 Overview and menu structure .......................................................................................... 349
9.3.2 Operation screen menu.................................................................................................... 352
9.3.3 Parameterization menu.................................................................................................... 353
9.3.4 Fault/alarm memory menu............................................................................................... 354
9.3.5 Commissioning/service menu........................................................................................... 355
9.3.5.1 Drive commissioning........................................................................................................ 355
9.3.5.2 Device commissioning ..................................................................................................... 356
9.3.5.3 AOP settings .................................................................................................................... 356
9.3.5.4 AOP30 diagnostics ........................................................................................................... 360
9.3.6 Sprachauswahl / Language Selection ................................................................................ 361
9.3.7 Operation via the operator panel (LOCAL mode)............................................................... 362
9.3.7.1 LOCAL/REMOTE key.......................................................................................................... 362
9.3.7.2 ON key / OFF key.............................................................................................................. 363
9.3.7.3 CCW/CW changeover........................................................................................................ 363
9.3.7.4 Jogging ........................................................................................................................... 363
9.3.7.5 Increase setpoint / decrease setpoint ................................................................................ 364
9.3.7.6 AOP setpoint.................................................................................................................... 364
9.3.7.7 Inhibiting AOP Local mode ............................................................................................... 365
9.3.7.8 Acknowledging errors at the AOP ..................................................................................... 365
9.3.7.9 Timeout monitoring......................................................................................................... 365
9.3.7.10 Operating lock / Parameterization inhibit .......................................................................... 365
9.3.8 Faults and alarms............................................................................................................. 367
9.3.9 Saving the parameters permanently ................................................................................. 368
9.3.10 Parameterization error ..................................................................................................... 369
9.3.11 Assigning parameters to make AOP30 time-of-day master................................................. 369
10 Descriptions of functions................................................................................................................... 371
10.1 Inputs/outputs ................................................................................................................. 371
10.1.1 Overview of inputs/outputs .............................................................................................. 371
10.1.2 Digital inputs/outputs....................................................................................................... 372
10.1.3 Analog inputs .................................................................................................................. 372
10.1.4 Analog outputs ................................................................................................................ 373
10.2 Communication, IT security.............................................................................................. 373
10.2.1 SINAMICS network settings .............................................................................................. 374
10.2.2 Time synchronization....................................................................................................... 376
10.2.2.1 Overview ......................................................................................................................... 376

Table of contents
10.2.2.2 Setting SINAMICS time synchronization ............................................................................ 378

10.2.2.3 Messages and parameters ................................................................................................ 379
10.3 Communication according to PROFIdrive .......................................................................... 379
10.3.1 Application classes........................................................................................................... 381
10.3.2 Cyclic communication ...................................................................................................... 384
10.3.2.1 Telegrams and process data ............................................................................................. 384
10.3.2.2 Description of control words and setpoints ....................................................................... 389
10.3.2.3 Description of status words and actual values .................................................................. 393
10.3.2.4 Control and status words for encoders.............................................................................. 398
10.3.2.5 Extended encoder evaluation ........................................................................................... 406
10.3.2.6 Central control and status words ...................................................................................... 407
10.3.2.7 Diagnostics channels for cyclic communication ................................................................ 409
10.3.3 Parallel operation of communication interfaces ................................................................ 410
10.3.4 Acyclic communication .................................................................................................... 413
10.3.4.1 General information about acyclic communication ........................................................... 413
10.3.4.2 Structure of requests and responses ................................................................................. 415
10.3.4.3 Determining the drive object numbers ............................................................................. 421
10.3.4.4 Example 1: Read parameter.............................................................................................. 421
10.3.4.5 Example 2: Writing to parameters (multi-parameter request) ............................................ 423
10.4 Communication via PROFIBUS DP ..................................................................................... 427
10.4.1 PROFIBUS connection....................................................................................................... 427
10.4.2 General information about PROFIBUS ............................................................................... 428
10.4.2.1 General information about PROFIBUS for SINAMICS .......................................................... 428
10.4.2.2 Example of a telegram structure for cyclic data acquisition................................................ 431
10.4.3 Commissioning PROFIBUS ................................................................................................ 432
10.4.3.1 Setting the PROFIBUS interface......................................................................................... 432
10.4.3.2 PROFIBUS interface during operation................................................................................ 433
10.4.3.3 Commissioning PROFIBUS ................................................................................................ 435
10.4.3.4 Diagnostics options.......................................................................................................... 435
10.4.3.5 SIMATIC HMI addressing................................................................................................... 436
10.4.3.6 Monitoring telegram failure ............................................................................................. 438
10.4.4 Direct data exchange ....................................................................................................... 439
10.4.4.1 Setpoint assignment in the subscriber .............................................................................. 441
10.4.4.2 Activating/parameterizing direct data exchange................................................................ 441
10.4.4.3 Commissioning of the PROFIBUS direct data exchange...................................................... 442
10.4.4.4 GSD in operation.............................................................................................................. 453
10.4.4.5 Diagnostics of the PROFIBUS direct data exchange in STARTER .......................................... 454
10.4.5 Messages via diagnostics channels ................................................................................... 455
10.5 Communication via PROFINET IO...................................................................................... 458
10.5.1 Activating online mode: STARTER via PROFINET IO ............................................................ 458
10.5.2 General information about PROFINET IO ........................................................................... 464
10.5.2.1 Real-time (RT) and isochronous real-time (IRT) communication ......................................... 465
10.5.2.2 Addresses ........................................................................................................................ 466
10.5.2.3 Data transfer.................................................................................................................... 468
10.5.2.4 Communication channels for PROFINET............................................................................ 469
10.5.3 Drive control with PROFINET............................................................................................. 470
10.5.3.1 Media redundancy ........................................................................................................... 472
10.5.4 RT classes for PROFINET IO ............................................................................................... 472
10.5.5 PROFINET GSDML............................................................................................................. 477
10.5.6 Communication with CBE20............................................................................................. 478
10.5.7 Messages via diagnostics channels ................................................................................... 479

Table of contents
10.5.8 Support of I&M data sets 1...4 .......................................................................................... 482

10.6 Communication via SINAMICS Link................................................................................... 484
10.6.1 Basic principles of SINAMICS Link ..................................................................................... 484
10.6.2 Topology ......................................................................................................................... 486
10.6.3 Configuring and commissioning ....................................................................................... 488
10.6.4 Example .......................................................................................................................... 492
10.6.5 Communication failure when booting or in cyclic operation.............................................. 494
10.6.6 Examples: Transmission times for SINAMICS Link .............................................................. 495
10.6.7 Function diagrams and parameters .................................................................................. 495
10.7 Communication via EtherNet/IP (EIP) ................................................................................ 496
10.7.1 Components to connect SINAMICS DCM to EtherNet/IP ..................................................... 496
10.7.2 Configuration of SINAMICS DCM for EtherNet/IP................................................................ 497
10.7.3 EtherNet/IP communication with the SINAMICS DCM ........................................................ 498
10.7.3.1 “Implicit messaging” – cyclic communication as I/O slave .................................................. 499
10.7.3.2 “Explicit messaging” – acyclic or event-driven communication........................................... 502
10.7.4 Examples when using a Rockwell PLC ............................................................................... 511
10.7.4.1 Configuration of a Rockwell PLC for the communication with SINAMICS DCM .................... 511
10.7.4.2 Reading and writing parameters using the Parameter Object (Class code 4xx hex)............. 514
10.7.5 Messages and parameters ................................................................................................ 516
10.8 Communication via MODBUS TCP..................................................................................... 517
10.8.1 Overview ......................................................................................................................... 517
10.8.2 Configuring Modbus TCP via interface X1400 ................................................................... 519
10.8.3 Mapping tables ................................................................................................................ 520
10.8.4 Read and write access using function codes...................................................................... 523
10.8.5 Communication via data set 47 ........................................................................................ 525
10.8.5.1 Communication details .................................................................................................... 526
10.8.5.2 Examples: Read parameter ............................................................................................... 527
10.8.5.3 Examples: Write parameter............................................................................................... 528
10.8.6 Communication sequence................................................................................................ 529
10.8.7 Messages and parameters ................................................................................................ 530
10.9 Serial interface with USS protocol..................................................................................... 531
10.10 Switch on, switch off, enable............................................................................................ 533
10.10.1 Switch on/Switch off (ON/OFF1) - control word bit 0 ......................................................... 533
10.10.2 OFF2 (disconnection) - control word bit 1......................................................................... 535
10.10.3 OFF3 (quick stop) - control word bit 2............................................................................... 535
10.10.4 Operation enable (enable) - control word bit 3 ................................................................. 537
10.11 Safety shutdown (E-STOP)................................................................................................ 538
10.12 Setpoint channel.............................................................................................................. 539
10.12.1 Ramp-function generator ................................................................................................. 539
10.12.2 Jogging ........................................................................................................................... 544
10.12.3 Creep............................................................................................................................... 545
10.12.4 Fixed setpoint .................................................................................................................. 546
10.13 Encoder evaluation .......................................................................................................... 546
10.13.1 Actual speed values ......................................................................................................... 547
10.13.2 Control and status words for encoders.............................................................................. 548
10.14 Speed controller .............................................................................................................. 548
10.15 Adaptation of the armature and field current controller..................................................... 551

Table of contents
10.16 Technology controller ...................................................................................................... 554

10.17 Switch-on command for holding or operational brake....................................................... 557
10.18 Switching on auxiliary circuits .......................................................................................... 560
10.19 Operating hours counter, unit fan .................................................................................... 561
10.20 Thermal overload protection for the DC motor (I2t monitoring of the motor)..................... 562
10.21 Measuring the motor temperature ................................................................................... 565
10.22 Speed-dependent current limiting .................................................................................... 567
10.23 Thyristor blocking voltage calculation............................................................................... 569
10.24 Automatic restart............................................................................................................. 571
10.25 Operation on a single-phase line supply ........................................................................... 571
10.26 Connecting units in parallel and in series.......................................................................... 573
10.26.1 6-pulse parallel connection .............................................................................................. 576
10.26.1.1 Basic topology ................................................................................................................. 576
10.26.1.2 Extended topology........................................................................................................... 576
10.26.1.3 Operating modes ............................................................................................................. 577
10.26.1.4 Parameterization.............................................................................................................. 579
10.26.2 12-pulse parallel connection ............................................................................................ 581
10.26.3 6-pulse series connection................................................................................................. 584
10.26.4 6-pulse series connection: controlled converter + uncontrolled converter.......................... 587
10.26.5 12-pulse series connection............................................................................................... 588
10.26.6 12-pulse series connection: controlled converter + uncontrolled converter........................ 591
10.26.7 Switchover of the power unit topology - option S50 ......................................................... 592
10.27 Field reversal ................................................................................................................... 592
10.27.1 Direction of rotation reversal using field reversal ............................................................... 593
10.27.2 Braking using field reversal............................................................................................... 594
10.28 Serial interface with peer-to-peer protocol........................................................................ 597
10.28.1 Examples of peer-to-peer connections .............................................................................. 600
10.29 Expanding the SINAMICS DCM to include a second CUD.................................................... 602
10.30 Terminal Module Cabinet TMC (option G63) ..................................................................... 604
10.31 Runtime (operating hours counter) .................................................................................. 605
10.32 Diagnostics ...................................................................................................................... 605
10.32.1 Diagnostic memory.......................................................................................................... 605
10.32.2 Trend recorder function.................................................................................................... 606
10.32.3 Thyristor diagnostics ........................................................................................................ 607
10.32.4 Description of the LEDs on the CUD .................................................................................. 609
10.32.5 Diagnostics via STARTER ................................................................................................... 611
10.32.5.1 Function generator .......................................................................................................... 612
10.32.5.2 Trace function.................................................................................................................. 614
10.32.6 Faults and alarms............................................................................................................. 621
10.32.6.1 General information......................................................................................................... 621
10.32.6.2 Buffer for faults and alarms .............................................................................................. 623
10.32.6.3 Configuring messages ...................................................................................................... 626
10.32.6.4 Parameters and function diagrams for faults and alarms ................................................... 628
10.32.6.5 Forwarding faults and alarms ........................................................................................... 628

Table of contents
10.32.7 Simulation mode ............................................................................................................. 629

10.33 CPU time load with SINAMICS DCM .................................................................................. 630
10.33.1 Maximum configuration................................................................................................... 632
10.33.2 Computation examples .................................................................................................... 632
10.34 Free function blocks......................................................................................................... 633
10.35 Drive Control Chart (DCC)................................................................................................. 635
10.35.1 Loading the DCC technology option into the drive unit memory........................................ 636
10.35.2 CPU time load through DCC.............................................................................................. 638
10.35.3 Memory load through DCC............................................................................................... 639
10.35.4 Backing up the DCC diagrams........................................................................................... 641
10.36 Write and know-how protection ....................................................................................... 642
10.36.1 Write protection ............................................................................................................... 642
10.36.2 Know-how protection ...................................................................................................... 644
10.36.2.1 Copy protection ............................................................................................................... 646
10.36.2.2 Configuring know-how protection .................................................................................... 647
10.36.2.3 Loading know-how protected data to the file system......................................................... 651
10.36.3 Overview of important parameters................................................................................... 654
11 Maintenance...................................................................................................................................... 655
11.1 Upgrading the device firmware......................................................................................... 655
11.1.1 Upgrading the device firmware......................................................................................... 656
11.1.2 Upgrading the DCC technology option.............................................................................. 659
11.2 Replacing the CUD ........................................................................................................... 662
11.3 Replacing the back-up battery in the AOP30 operator panel .............................................. 665
12 Applications ....................................................................................................................................... 667
12.1 Using SINAMICS DCM in shipbuilding ............................................................................... 667
12.2 Use of the SINAMICS DCM in galvanizing and dip-painting plants...................................... 667
12.3 Using SINAMICS DCM as thyristor controller in heating applications .................................. 669
13 Functional safety ............................................................................................................................... 671
13.1 Emergency Off and Emergency Stop ................................................................................. 672
13.2 Safety functions according to IEC 61800-5-2 .................................................................... 673
13.2.1 Safe Torque Off (STO)....................................................................................................... 674
13.2.2 Safe Stop 1 (SS1-t, time controlled) .................................................................................. 674
13.3 Safety functions of the SINAMICS DCM ............................................................................. 675
13.3.1 Fundamentals and technical specifications ....................................................................... 675
13.3.2 Performance characteristics of SINAMICS DCM for safety-related evaluation ...................... 676
13.3.3 Performance characteristics of functional safety application examples .............................. 676
13.3.4 Standards ........................................................................................................................ 677
13.4 Functional safety: Activation for SINAMICS DCM ............................................................... 678
13.5 Application examples ....................................................................................................... 678
13.5.1 Description of application examples ................................................................................. 679
13.5.2 General information on the application examples ............................................................. 681
13.5.3 Application examples STO ................................................................................................ 684
13.5.3.1 Timing of the shutdown with STO .................................................................................... 684

Table of contents
13.5.3.2 STO with power contactor in the armature circuit, controlled by mechanical switches/
relay outputs ................................................................................................................... 685
13.5.3.3 STO with circuit breaker in the armature circuit, controlled by mechanical switches/relay
outputs............................................................................................................................ 686
13.5.3.4 STO with power contactor in the armature circuit, controlled by semiconductor outputs ... 688
13.5.4 Application examples SS1-t .............................................................................................. 689
13.5.4.1 Timing of the shutdown with SS1-t .................................................................................. 689
13.5.4.2 SS1-t with power contactor in the armature circuit, controlled by mechanical switches/
relay outputs ................................................................................................................... 691
13.5.4.3 SS1-t with power contactor in the armature circuit, controlled by semiconductor outputs... 692
13.6 Risk analysis and risk assessment...................................................................................... 693
13.7 Validating/checking the safety functions........................................................................... 693
13.8 Diagnostics test / forced checking procedure .................................................................... 693
13.9 Circuit breakers and power contactors .............................................................................. 694
A Appendix A ........................................................................................................................................ 701
A.1 Certifications and standards ............................................................................................. 701
A.2 List of abbreviations......................................................................................................... 702
A.3 Environmental compatibility ............................................................................................ 710
A.4 Servicing ......................................................................................................................... 710
B Appendix B......................................................................................................................................... 713
B.1 Runtimes of the DCC blocks for SINAMICS DCM ................................................................ 713
B.2 BOP20 status display during power-up.............................................................................. 717
C Appendix C......................................................................................................................................... 719
C.1 Standards and regulations relating to functional safety ..................................................... 719
C.1.1 General information......................................................................................................... 719
C.1.1.1 Aims................................................................................................................................ 719
C.1.1.2 Functional safety ............................................................................................................. 719
C.1.2 Safety of machinery in Europe.......................................................................................... 720
C.1.2.1 Machinery Directive ......................................................................................................... 720
C.1.2.2 Harmonized European Standards...................................................................................... 721
C.1.2.3 Standards for implementing safety-related controllers ...................................................... 722
C.1.2.4 DIN EN ISO 13849-1......................................................................................................... 723
C.1.2.5 IEC 62061........................................................................................................................ 724
C.1.2.6 Series of standards IEC 61508 (VDE 0803)........................................................................ 726
C.1.2.7 Risk analysis/assessment .................................................................................................. 726
C.1.2.8 Risk minimization............................................................................................................. 728
C.1.2.9 Residual risk..................................................................................................................... 728
C.1.2.10 EC declaration of conformity ............................................................................................ 728
C.1.3 Machine safety in the USA................................................................................................ 728
C.1.3.1 Minimum requirements of the OSHA ................................................................................ 729
C.1.3.2 NRTL listing...................................................................................................................... 729
C.1.3.3 NFPA 79........................................................................................................................... 730
C.1.3.4 ANSI B11 ......................................................................................................................... 730
C.1.4 Machine safety in Japan ................................................................................................... 731
C.1.5 Equipment regulations..................................................................................................... 731

Table of contents
C.1.6 Other safety-related issues ............................................................................................... 731

C.1.6.1 Information sheets from the various regulatory bodies ..................................................... 731
C.1.6.2 Additional references ....................................................................................................... 732
Index .................................................................................................................................................. 733

Safety instructions 1
1.1 General safety instructions
WARNING
Electric shock and danger to life due to other energy sources
Touching live components can result in death or serious injury.
• Only work on electrical equipment if you are appropriately qualified.
• Always observe the country-specific safety rules for all work.
Generally, the following steps apply when establishing safety:
1. Prepare for disconnection. Notify all those who will be affected by the procedure.
2. Isolate the drive system from the power supply and take measures to prevent it being
switched back on again.
3. Wait until the discharge time specified on the warning labels has elapsed.
4. Check that there is no voltage between any of the power connections, and between any of
the power connections and the protective conductor connection.
5. Check whether the existing auxiliary supply circuits are in a no-voltage state.
6. Ensure that the motors cannot move.
7. Identify all other dangerous energy sources, e.g. compressed air, hydraulic systems, or
water. Switch the energy sources to a safe state.
8. Check that the correct drive system is completely locked.
After you have completed the work, restore the operational readiness by following the above
steps in the reverse order.
WARNING
Electric shock due to connection to an unsuitable power supply
When equipment is connected to an unsuitable power supply, exposed components may carry
a hazardous voltage that might result in serious injury or death.
• Only use power supplies that provide SELV (Safety Extra Low Voltage) or PELV (Protective
Extra Low Voltage) output voltages for all connections and terminals of the electronics
modules.

Safety instructions
WARNING
Electric shock due to equipment damage
Improper handling may cause damage to equipment. For damaged devices, hazardous
voltages can be present at the enclosure or at exposed components; if touched, this can result
in death or severe injury.
• Ensure compliance with the limit values specified in the technical data during transport,
storage and operation.
• Do not use any damaged devices.
WARNING
Electric shock due to unconnected cable shield
Hazardous touch voltages can occur through capacitive cross-coupling due to unconnected
cable shields.
• Connect cable shields and unused conductors of power cables (e.g. brake conductors) at
least on one side to the grounded housing potential.
WARNING
Electric shock if there is no ground connection
For missing or incorrectly implemented protective conductor connection for devices with
protection class I, high voltages can be present at open, exposed parts, which when touched,
can result in death or severe injury.
• Ground the device in compliance with the applicable regulations.
WARNING
Arcing when a plug-in connection is opened during operation
Opening a plug-in connection when a system is in operation can result in arcing that may cause
serious injury or death.
• Only open plug-in connections when the equipment is in a voltage-free state, unless it has
been explicitly stated that they can be opened in operation.
WARNING
Electric shock due to residual charges in power components
Because of the capacitors, a hazardous voltage is present for up to 5 minutes after the power
supply has been switched off. Contact with live parts can result in death or serious injury.
• Wait for 5 minutes before you check that the unit really is in a no-voltage condition and start
work.

Safety instructions
NOTICE
Property damage due to loose power connections
Insufficient tightening torques or vibration can result in loose power connections. This can
result in damage due to fire, device defects, or malfunctions.
• Tighten all power connections to the specified torque.
• Check all power connections at regular intervals, particularly after equipment has been
transported.
WARNING
Spread of fire from built-in devices
In the event of fire outbreak, the enclosures of built-in devices cannot prevent the escape of
fire and smoke. This can result in serious personal injury or property damage.
• Install built-in units in a suitable metal cabinet in such a way that personnel are protected
against fire and smoke, or take other appropriate measures to protect personnel.
• Ensure that smoke can only escape via controlled and monitored paths.
WARNING
Active implant malfunctions due to electromagnetic fields
During operation, converters generate electromagnetic fields (EMF). Electromagnetic fields
may interfere with active implants, e.g. pacemakers. People with active implants in the
immediate vicinity of an converter are at risk.
• As operator of an EMF-emitting installation, carefully assess the individual risks of persons
with active implants.
• Observe the data on EMF emission provided in the product documentation.
WARNING
Unexpected movement of machines caused by radio devices or mobile phones
Using radio devices or mobile telephones in the immediate vicinity of the components can
result in equipment malfunction. Malfunctions may impair the functional safety of machines
and can therefore put people in danger or lead to property damage.
• Therefore, if you move closer than 20 cm to the components, be sure to switch off radio
devices or mobile telephones.
• Use the "SIEMENS Industry Online Support App" only on equipment that has already been
switched off.
WARNING
Motor fire in the event of insulation overload
There is higher stress on the motor insulation through a ground fault in an IT system. If the
insulation fails, it is possible that death or severe injury can occur as a result of smoke and fire.
• Use a monitoring device that signals an insulation fault.
• Correct the fault as quickly as possible so the motor insulation is not overloaded.

Safety instructions
WARNING
Fire due to inadequate ventilation clearances
Inadequate ventilation clearances can cause overheating of components with subsequent fire
and smoke. This can cause severe injury or even death. This can also result in increased
downtime and reduced service lives for devices/systems.
• Ensure compliance with the specified minimum clearance as ventilation clearance for the
respective component.
WARNING
Unrecognized dangers due to missing or illegible warning labels
Dangers might not be recognized if warning labels are missing or illegible. Unrecognized
dangers may cause accidents resulting in serious injury or death.
• Check that the warning labels are complete based on the documentation.
• Attach any missing warning labels to the components, where necessary in the national
language.
• Replace illegible warning labels.
NOTICE
Device damage caused by incorrect voltage/insulation tests
Incorrect voltage/insulation tests can damage the device.
• Before carrying out a voltage/insulation test of the system/machine, disconnect the devices
as all converters and motors have been subject to a high voltage test by the manufacturer,
and therefore it is not necessary to perform an additional test within the system/machine.
CAUTION
Hot component surfaces
Certain components (e.g. the heat sink and reactor) can become very hot during operation.
These components can remain hot for a long time after operation. Contact can result in serious
injury, such as skin burns.
• Do not touch hot components, even after you have switched off the device.

Safety instructions
WARNING
Unexpected movement of machines caused by inactive safety functions
Inactive or non-adapted safety functions can trigger unexpected machine movements that
may result in serious injury or death.
• Observe the information in the appropriate product documentation before commissioning.
• Carry out a safety inspection for functions relevant to safety on the entire system, including
all safety-related components.
• Ensure that the safety functions used in your drives and automation tasks are adapted and
activated using the appropriate parameterizing.
• Carry out a function test.
• Only put your plant into live operation once you have guaranteed that the functions
relevant to safety are running correctly.
WARNING
Malfunctions of the machine as a result of incorrect or changed parameterization
As a result of incorrect or changed parameterization, machines can malfunction, which in turn
can lead to injuries or death.
• Protect the parameterization against unauthorized access.
• Respond to possible malfunctions by taking suitable measures, e.g. EMERGENCY STOP or
EMERGENCY OFF.

Safety instructions
1.2 Fundamental safety instructions for functional safety
1.2 Fundamental safety instructions for functional safety

Additional safety information and residual risks not specified in this chapter are included in the
relevant sections of these operating instructions.
DANGER
Minimizing risks through functional safety
Functional safety can reduce the risk for plants, systems and machines.
However, safe operation of plants, systems and machines with functional safety is only possible
if the machine builder carefully observes the following points:
• He is extremely familiar with this technical user documentation, including the documented
constraints, safety instructions and residual risks - and he complies with all of the
instructions provided.
• He carefully and professionally designs, constructs and configures the system/machine.
This must then be verified through careful and thorough acceptance tests carried out by
qualified personnel and the results documented.
• He implements and validates all the measures required in accordance with the system/
machine risk analysis using the programmed and configured functions of functional safety.
The use of functional safety does not replace the plant or machine risk assessment carried out
by the machine manufacturer as required by the EC machinery directive!
In addition to the use of functional safety, additional risk reduction measures must be
implemented.
WARNING
Danger to life as a result of undesirable motor movement when automatically restarting
The Emergency Stop function must bring the machine to a standstill according to stop category
0 or 1 (STO or SS1) (IEC 60204‑1).
It is not permissible that the motor automatically restarts after an Emergency Stop, as this
represents danger to life as a result of the associated undesirable motor motion.
When individual safety functions are deactivated, an automatic restart is permitted under
certain circumstances depending on the risk analysis (except when Emergency Stop is reset).
An automatic start is permitted when a protective door is closed, for example.
• For the cases listed above, ensure that an automatic restart is absolutely not possible.
WARNING
Danger to life as a result of undesirable motor motion when the system powers up and the
drives are activated after changing or replacing hardware and/or software
After hardware and/or software components have been modified or replaced, it is only
permissible for the system to run up and the drives to be activated with the protective devices
closed. Personnel shall not be present within the danger zone.
• It may be necessary to carry out a partial or complete acceptance test or a simplified
functional test after having made certain changes or replacements.
• Before personnel may re-enter the hazardous area, all of the drives should be tested to
ensure that they exhibit stable control behavior by briefly moving them in both the plus and
minus directions (+/-).

Safety instructions
1.5 ESD-sensitive components
1.3 Hearing protection
WARNING
Damage to hearing due to lack of hearing protection
In general, wearing hearing protection is required or recommended for a sound level of ≥ 80
dB(A).
• Note the regional regulations for the use of hearing protection.
1.4 Warning note relating to the off button of the AOP30
WARNING
No Emergency Stop, Emergency Off or STO function
The OFF button on the AOP30 operator panel does not comply with the requirements relating
to Emergency Stop, Emergency Off or STO function (functional safety)!
• Only use the OFF button of the AOP30 for switching on or switching off in operation.
1.5 ESD-sensitive components

Electrostatic-sensitive devices (ESD) are individual components, integrated circuits, modules or
devices that may be damaged by either electric fields or electrostatic discharge.
NOTICE
Damage caused by electric fields or electrostatic discharge
Electric fields or electrostatic discharge can cause malfunctions through damaged individual
components, integrated circuits, modules or devices.
• Only pack, store, transport and send electronic components, modules or devices in their
original packaging or in other suitable materials, e.g. conductive foam rubber of aluminum
foil.
• Only touch components, modules and devices when you are grounded by one of the
following methods:
– Wearing an ESD wrist strap
– Wearing ESD shoes or ESD grounding straps in ESD areas with conductive flooring
• Only place electronic components, modules or devices on conductive surfaces (table with
ESD surface, conductive ESD foam, ESD packaging, ESD transport container).
The necessary ESD protective measures are elucidated once again in the following illustration:
Seated Standing Seated/standing

Safety instructions
1.7 Industrial security
G
E G E G
H H
I I I I I
J D F F D J F D
a Conductive floor e ESD wrist strap

b ESD Table f Cabinet ground connection
c ESD footwear g Contact with conductive flooring
d ESD overall
1.6 Security information

Siemens provides products and solutions with industrial security functions that support the
secure operation of plants, systems, machines and networks.
In order to protect plants, systems, machines and networks against cyber threats, it is
necessary to implement – and continuously maintain – a holistic, state-of-the-art industrial
security concept. Siemens’ products and solutions constitute one element of such a concept.
Customers are responsible for preventing unauthorized access to their plants, systems,
machines and networks. Such systems, machines and components should only be connected
to an enterprise network or the internet if and to the extent such a connection is necessary
and only when appropriate security measures (e.g. firewalls and/or network segmentation)
are in place.
For additional information on industrial security measures that may be implemented, please
visit
https://www.siemens.com/industrialsecurity.
Siemens’ products and solutions undergo continuous development to make them more
secure. Siemens strongly recommends that product updates are applied as soon as they are
available and that the latest product versions are used. Use of product versions that are no
longer supported, and failure to apply the latest updates may increase customer’s exposure
to cyber threats.
To stay informed about product updates, subscribe to the Siemens Industrial Security RSS
Feed under
https://www.siemens.com/cert.
1.7 Industrial security

Further information is provided on the Internet:

Safety instructions
1.8 Residual risks of power drive systems
Industrial Security Configuration Manual (https://support.industry.siemens.com/cs/ww/en/

view/108862708)
WARNING
Unsafe operating states resulting from software manipulation
Software manipulations, e.g. viruses, Trojans, or worms, can cause unsafe operating states in
your system that may lead to death, serious injury, and property damage.
• Keep the software up to date.
• Incorporate the automation and drive components into a holistic, state-of-the-art industrial
security concept for the installation or machine.
• Make sure that you include all installed products into the holistic industrial security concept.
• Protect files stored on exchangeable storage media from malicious software by with suitable
protection measures, e.g. virus scanners.
• On completion of commissioning, check all security-related settings.

When assessing the machine or system-related risk in accordance with the respective local
regulations (e.g. EC Machinery Directive), the machine manufacturer or system integrator must
take into account the following residual risks emanating from the control and drive components
of a drive system:
1. Unintentional movements of driven machine or system components during commissioning,
operation, maintenance, and repairs caused by, for example,
– Hardware faults and/or software errors in the sensors, control system, actuators, and
connections
– Response times of the control system and of the drive
– Operation and/or environmental conditions outside the specification
– Condensation/conductive contamination
– Parameterization, programming, cabling, and installation errors
– Use of wireless devices/mobile phones in the immediate vicinity of electronic components
– External influences/damage
– X-ray, ionizing radiation and cosmic radiation
2. Unusually high temperatures inside and outside the components, including open flames, as
well as emissions of light, noise, particles, gases, etc. due to fault conditions, e.g.:
– Component failure
– Software errors
– Short circuits or ground faults in the intermediate DC circuit of the converter

Safety instructions
3. Hazardous shock voltages caused by, for example:

– Component failure
– Influence during electrostatic charging
– Induction of voltages in moving motors
– Condensation/conductive contamination
4. Electrical, magnetic and electromagnetic fields generated in operation that can pose a risk to
people with a pacemaker, implants or metal replacement joints, etc., if they are too close
5. Release of environmental pollutants or emissions as a result of improper operation of the
system and/or failure to dispose of components safely and correctly
6. Influence of network-connected and wireless communications systems, e.g. ripple-control
transmitters or data communication via the network or mobile radio, WLAN or Bluetooth.
7. Motors for use in potentially explosive areas:
When moving components such as bearings become worn, this can cause enclosure
components to exhibit unexpectedly high temperatures during operation, creating a hazard
in areas with a potentially explosive atmosphere.
For more information about the residual risks of the drive system components, see the
relevant sections in the technical user documentation.

Ordering information 2
2.1 Device article numbers
Without option: 6RA8000 - 0MV62 - 0AA0

With options: 6RA8000 - 0MV62 - 0AA0 - Z
2.2 Rating plates, packaging label
① QR code
② For options: "Z" after the arti‐
cle number
③ Order codes for options (ac‐
cording to ordering informa‐
tion for options) (order-spe‐
cific)
④ Product version
⑤ Serial number
⑥ Bar code article number
Rating plate on front cover

Rating plate in the device

Ordering information
2.3 Ordering information for options and accessories
① QR code ④ Product version

② For options: "Z" after the article number ⑤ Serial number
③ Order codes for options (according to order‐
ing information for options) (order-specific)
Figure 2-1 Packaging label
Note
You can scan the QR code on the product rating plate or on the product packaging label by using
a standard code scanner or the "Industry Online Support" app to get product data, manuals,
declarations of conformity, certificates and other information about your product.
Ordering information for options with order codes
5$09$$= Article number of SINAMICS DCM Control Module

with Z designation and order codes (multiple or‐

der codes together) and/or plain text, if necessary

Table 2-1 Control Unit CUD options
Option Order codes

Advanced CUD in left slot G00
Standard CUD in right slot (possible with option G00) G10
Advanced CUD in right slot (possible with option G00) G11
CBE20 PROFINET, left (possible with option G00) G20
CBE20 PROFINET, right (possible with option G11) G21
CompactFlash card, left S01
Memory card, right (possible with options G10 and G11) S02
Note: Standard equipment = Standard CUD, left
Table 2-2 Additional options
Option Order codes

Terminal Module Cabinet (TMC) G63
Can be snapped onto a 35 mm mounting rail.
Enables the simple connection of the CUD standard signals (X177) via spring-loaded terminals in
an easily accessible area of the control cabinet.
The CUD is equipped with an adapter board. Terminal Module Cabinet and connecting cable (3 m)
are supplied separately.
Notes:
• In the device version with option G63, the X177 terminal connections are no longer available
directly on the CUD.
• When ordering, please specify which CUD (at the left or right slot) is to be equipped with the
option.
• If two CUDs are to be equipped with option G63, the option must be ordered for each CUD.
Coated modules M08
Coated modules increase the degree of ruggedness with respect to climatic effects:
Relative / absolute humidity 5% to 95% / 1 to 29 g/m3 for ambient temperature or cooling medium
temperature ≤30° C
≤ 60% with the occurrence of SO2 and H2S and/or for ambient temperature or cooling medium
temperature 30° C to 40° C
Oil mist, salt mist, formation of ice, condensation, dropping, spray, splashing and jet-water not
permissible.
Field power unit 2Q L11
Without field power unit L10
Nickel-plated copper bars (in the field power unit) M10
Control for switching over the power unit topology for devices connected in parallel and series S50
This option is described in the application document "12-pulse applications".

Ordering information for accessories
Table 2-3 Articles numbers for accessories
Article Article number

Standard CUD retrofit kit 6RY1803-0AA00-0AA1 +
Combination of spare parts, standard CUD and connector board 6RY1803-0GA00
Standard CUD coated retrofit kit 6RY1803-0AA20-0AA1 +
Combination of the spare parts, standard CUD coated and connector board coated 6RY1803-0GA20
Advanced CUD retrofit kit 6RY1803-0AA05-0AA1 +
Combination of spare parts, Advanced-CUD and connector board 6RY1803-0GA00
Advanced CUD coated retrofit kit 6RY1803-0AA25-0AA1 +
Combination of spare parts, Advanced CUD coated and connector board coated 6RY1803-0GA20
Fuse monitoring module 6RY1803-0CM02
Fuse monitoring distributor 6RY1803-0CM26
incl. 3 m ribbon cable to connect to the SINAMICS DCM Control Module;
can be snapped onto mounting rails according to DIN EN 50022-35x7.5
CBE20 PROFINET 6SL3055-0AA00-2EB0
Memory card (equivalent to spare part for options S01 and S02) 6RX1800-0AS01
Terminal Module TM15 6SL3055-0AA00-3FA0
Terminal Module TM31 6SL3055-0AA00-3AA0
Terminal Module TM150 6SL3055-0AA00-3LA0
Sensor Module Cabinet-Mounted SMC10 6SL3055-0AA00-5AA3
Sensor Module Cabinet-Mounted SMC30 6SL3055-0AA00-5CA2
SICROWBAR overvoltage protection 1)
Fuses, reactors, filters 2)
STARTER commissioning tool 6SL3072-0AA00-0AG0

Drive Control Chart (DCC) for SINAMICS 6AU1810-1HA20-1XA0
Drive Control Chart (DCC) for SINAMICS and SIMOTION 6AU1810-1JA20-1XA0
1)
Please contact your local sales partner
2)
See Chapters "Commutating reactors (Page 123)" and "Fuses (Page 127)" or contact your local Siemens office
Table 2-4 Article numbers for the Advanced Operator Panel AOP30

Advanced Operator Panel AOP30 6SL3055-0AA00-4CA5
RS485 connecting cable for connecting the AOP30 to one CUD; 3 m 6RY1807-0AP00
RS485 connecting cable for connecting the AOP30 to two CUDs; 3 m 6RY1807-0AP10
Additional cable lengths can be ordered as option.
When ordering the RS485 cable with option, the suffix "-Z" must be attached to the article number followed by the order code
for the required option.
Ordering example for a 35 m long cable:
Article number: 6RY1807-0AP00-Z, order code: K35
Cable length Order code
5m K05
10 m K10


15 m K15
20 m K20
25 m K25
30 m K30
35 m K35
40 m K40
45 m K45
50 m K50
Ordering information for cable sets

The SINAMICS DCM Control Module is supplied with front and rear plates mounted one on top
of the other. The correct ribbon cables for this mounting type are already in place.
The cable sets listed below for connecting components (printed circuit boards or their parts)
in the case of other mounting types (see Chapter "Connecting (Page 67)") are available on
request.
Table 2-5 Ordering information for cable sets
Product description Contents For connecting Article no.

Set of loose parts Rear enclosure part including 6RY1805-0CM00
accessories for mounting the fir‐
ing pulse transformer module
and/or fuse monitoring module
with a parallel connection
Set of loose parts Screws, stud bolts, and snap-on 6RY1807-0CM00
parts for the external mounting
of module parts
Prefabricated ribbon cable 2 x 26-pin ribbon cable, shiel‐ from X21A, X22A on PCB "Power in‐ 6RY1807-0CM01
bridge set: for connecting the ded (L = 3 m) terface for the Control Module" to
two plates when mounted at a X21A, X22A on PCB "Firing
distance from each other pulse transformer module"
1 x 10-pin ribbon cable, shiel‐ X23B on PCB "Power interface for the
ded (L = 3 m) Control Module" to X23B on PCB
"Fuse monitoring"
1 x 20-pin ribbon cable, shiel‐ XF1 on PCB "Power interface for the
ded (L = 3 m) Control Module" to XF1 on PCB "Field
supply power unit"
1 x RJ45 patch cable X45 on PCB "Power interface for the
shielded (L = 3 m) Control Module" to X45 on PCB "Volt‐
age measurement"


Prefabricated ribbon cable 2 x 26-pin ribbon cable, shiel‐ from X21A, X22A on PCB "Power in‐ 6RY1807-0CM02
bridge set: for connecting the ded (L = 10 m) terface for the Control Module" to
two plates when mounted at a X21A, X22A on PCB "Firing pulse
distance from each other transformer module"
ded (L = 10 m) Control Module" to X23B on PCB
"Fuse monitoring"
ded (L = 10 m) Control Module" to XF1 on PCB "Field
supply power unit"
age measurement"
Prefabricated bridge set for cur‐ 2x 2-pin twisted cables (L = 2 m) XB on PCB "Power interface for the 6RY1707-0CM03
rent transformer Control Module" to the current trans‐
formers
Prefabricated bridge set for cur‐ 2x 2-pin twisted cables (L = 10 XB on PCB "Power interface for the 6RY1707-0CM04
rent transformer m) Control Module" to the current trans‐
formers
Prefabricated bridge set for re‐ 1x 2-pin twisted cables (L = 10 XT5 or XT6 on PCB "Power interface 6RY1807-0CM05
cording heat sink temperature m) for the Control Module" to tempera‐
ture sensor on heat sink
Prefabricated bridge set for fir‐ Bridge set for 12 x 2-pin twisted XIMP11, XIMP12, XIMP13, XIMP14, 6RY1707-0CM06
ing pulse cables cables (L = 3 m) XIMP15, XIMP16, XIMP21, XIMP22,
XIMP23, XIMP24, XIMP25, XIMP26 to
thyristors
Prefabricated bridge set for fuse 6 x 2-pin twisted cables (L = 10 XS1_5, XS2_5, XS3_5, XS4_5, XS5_5, 6RY1807-0CM07
monitoring m) XS6_5, XS7_5, XS8_5, XS9_5,
XS10_5, XS11_5, XS12_5
or XS1_4, XS2_4, XS3_4, XS4_4,
XS5_4, XS6_4, XS7_4, XS8_4, XS9_4,
XS10_4, XS11_4, XS12_4
or XS1_3, XS2_3, XS3_3, XS4__3,
XS5_3, XS6_3, XS7_3, XS8_3, XS9_3,
XS10_3, XS11_3, XS12_3
or XS1_2, XS2_2, XS3_2, XS4_2,
XS5_2, XS6_2, XS7_2, XS8_2, XS9_2,
XS10_2, XS11_2, XS12_2
or XS1_1, XS2_1, XS3_1, XS4_1,
XS5_1, XS6_1, XS7_1, XS8_1, XS9_1,
XS10_1, XS11_1, XS12_1
depending on the voltage (50 V,
125 V, 250 V, 575 V, or 1,000 V) to
fuses


Prefabricated bridge set for volt‐ 1x 3-pin twisted cables U-V-W XU6, XV6, XW6 6RY1807-0CM08
age measurement (L = 3 m) or XU5, XV5, XW5
or XU4, XV4, XW4
or XU3, XV3, XW3
or XU2, XV2, XW2
or XU1, XV1, XW1
depending on the voltage (5.6 V,
50 V, 125 V, 250 V, 575 V, or 1,000 V)
to the supply
1x 2-pin twisted cables C-D XC6, XD6 or XC5, XD5 or XC4, XD4 or
(L = 3 m) XC3, XD3 or XC2, XD2 or XC1, XD1
depending on the voltage (5.6 V,
50 V, 125 V, 250 V, 575 V, or 1,000 V)
to the supply
Prefabricated bridge set for con‐ 12 x 2-pin twisted cables (L = 1 from XIMP1, XIMP4 or XIMP2, XIMP5 6RY1707-0CM13
trolling firing pulse transformers m) or XIMP3, XIMP6 on PCB "Firing pulse
transformer module" (side sections)
to firing pulse transformer modules
(single boards) with terminals X11,
X12, X13, X14, X15, X16, X21, X22,
X23, X24, X25, X26
Prefabricated bridge set for con‐ 2x 12-pin twisted cables (L = 10 from XIMP1, XIMP4 and/or XIMP2, 6RY1707-0CM10
trolling firing pulse transformers m) XIMP5 and/or XIMP3, XIMP6 on PCB
"Firing pulse transformer module" to
external firing pulse transformers
Prefabricated bridge set for 2 x 26-pin ribbon cable, shiel‐ from X21A, X22A on PCB "Power in‐ 6RY1807-0CM11
mounting plates next to each ded (L = 0.68 m) terface for the Control Module"
other to X21A, X22A on PCB "Firing pulse
transformer module"
ded (L = 0.5 m) Control Module" to X23B on PCB
"Fuse monitoring"
ded (L = 0.76 m) Control Module" to XF1 on PCB "Field
supply power unit"
age measurement"


Description 3
Area of application
The SINAMICS DCM Control Module is mainly used for modifying and modernizing DC drives in
existing systems.
Many DC systems still use analog technology. When such systems are modified or upgraded,
the motor, mechanical parts and power unit are retained, with just the closed-loop control
section being replaced by a SINAMICS DCM Control Module. This is a highly cost-effective
solution for those interested in a modern DC drive with the entire range of functions
associated with the fully digital units in the SINAMICS DCM range.
A simple process of parameter assignment is all that is required in terms of adapting the
product to the configuration of the existing components.
The SINAMICS DCM Control Module contains a power unit for field supply with a rated
current of up to 40 A.
Structure
A striking feature of the SINAMICS DCM Control Module is its compact, space-saving structure.
Its compact design makes it easier to service, as the individual components are readily accessible.
To make the most of the installation options existing systems have to offer, the SINAMICS
DCM Control Module can be divided into smaller parts (from the top down).
The printed circuit board for generating and distributing firing pulses can also be split and,
just the same as the fuse monitoring and voltage measurement equipment, attached to the
power unit directly, either partly or completely outside the device, with a cable providing the
connection to the basic unit.
All connecting terminals can be accessed from the front.
The SINAMICS DCM Control Module has a Basic Operator Panel BOP20 in the front plate.
The BOP20 offers the following options:
• commissioning the drive
• display for all relevant measured values
• display of faults and alarms and acknowledgment of faults
• switching the drive on and off

Description
The electronics (CUD) are available in the following versions:

• Standard CUD
• Advanced CUD (option)
This CUD can be expanded to include a PROFINET module (CBE20) and features 2 DRIVE-CLiQ
connections for connecting additional components from the SINAMICS drive system, as well
as a connector for expansion purposes (to include a second CUD).
• Additional, second CUD (Standard or Advanced) (option)
This additional CUD can be inserted to the right of the first CUD and is used for system-
specific extension of SINAMICS DCM functions.
Additional components
• Advanced Operator Panel AOP30
The optional Advanced Operator Panel AOP30 is installed outside of the unit - in the control
cabinet door, for example - rather than inside it.
The AOP30 ensures the following additional comfort:
– Commissioning is supported by a wizard.
– Measured values are represented by a graphical operation screen.
– Displays a user-friendly parameter list, including text.
– There are several editors for user-friendly setting and changing of parameters.
– As well as help texts on individual faults and alarms, the fault and alarm messages which
have occurred are listed.
– Control of the drive (ON/OFF, setpoint input, jog, direction of rotation reversal) is enabled
"on site".
– Three LEDs display the drive status.
• Additional module CBE20
The additional module CBE20 is inserted in the optional module slot of an Advanced CUD. It
enables the SINAMICS DCM to connect to the PROFINET network as a slave as well as to
establish SINAMICS Link connections.
• DRIVE-CLiQ components
The DRIVE-CLiQ interface enables components from the SINAMICS drive system to be
connected.
The following components are supported:
– TM15 (digital inputs/outputs)
– TM31 (digital inputs/outputs, analog inputs/outputs)
– TM150 (temperature sensor inputs)
– SMC10 (resolver evaluation for speed actual value sensing)
– SMC30 (pulse encoder evaluation for actual speed value acquisition)
An SMC10 or SMC30 and up to three TMx modules can be connected to each CUD.

Description
Extended functions
• Free function blocks (FBLOCKS)
In a wide variety of applications, a logic operation connecting several states (e.g. access
control, system status) to a control signal (e.g. ON command) is required to control the drive
system. However, in addition to logic operations, drive systems require mathematical
operations and memory elements.
These functions are available in the form of the "free function blocks" function module.
A series of elementary function blocks are available that can be freely used:
– Logic function blocks (AND, OR, XOR, inverter)
– Arithmetic function blocks (adder, multiplier, divider, absolute-value generator)
– Time function blocks (pulse generator, pulse contracting block, ON delay, OFF delay,
pulse stretching)
– Memory function blocks (RS flip-flop, D flip-flop)
– Switch function blocks (binary selector switch, numerical selector switch)
– Control function blocks (limiter, smoothing element, integrator, derivative element)
– Complex function blocks (double-sided limit monitor with hysteresis)
• Drive Control Chart (DCC)
DCC is available for applications requiring a more complex method of controlling the drive
system which cannot be accomplished using the free function blocks. DCC makes it possible
to generate a graphic depiction of a function diagram consisting of interconnected
elementary function blocks and load it to the SINAMICS DCM. The function diagram may
contain up to 750 function blocks. The time slices, in which the individual parts of the
function block diagram are processed, can be configured.
Note
A DCC function diagram can be loaded not only onto the CUD in the left-hand slot, but also
to an optional second CUD in the right-hand slot.
The closed-loop drive control is computed on the CUD in the left-hand slot. This means that
only a restricted amount of computing capacity is available for a DCC function block diagram.
In other words, either only a few function blocks can be computed, or computing can only be
carried out in a slow time slice.
The CUD in the right-hand slot is essentially available (in addition to the operating system) for
one DCC function diagram only.
• Technology controller
Simple closed-loop control functions can be implemented with the technology controller,
e.g.:
– Level control
– Temperature control
– Dancer roll position control
– Pressure control
– Flow control
– Simple control without higher-level control
– Tension control

Description

Technical data 4
Note
You can find the technical data for the connectors and terminals in the section titled "Connecting
(Page 67)".
4.1 Environmental conditions
Environmental classes according to IEC 60721-3
Table 4-1 Environmental classes
Use Environmental condition Environmental Remark

class
Operation according to Mechanical stability see remark • Vibratory load (test and measuring procedure
IEC 60721‑3‑1:2002 according to IEC 60068‑2‑6, Fc):
– Constant deflection = 0.075 mm at
10 ... 58 Hz
– Constant acceleration = 10 m/s² at
58 ... 200 Hz
• Shock load (test and measuring procedure ac‐
cording to IEC 60068‑2‑27, Ea):
Acceleration = 150 m/s² at 11 ms
Climatic influences 3K3 No condensation, splash water, or icing allowed.
For air temperature, see "Ambient temperature"
below
Biological influences 3B1 -
Hazardous chemical substan‐ 3C1 -
ces
Mechanically hazardous ma‐ 3S2 -
terials
Shipping according to Mechanical stability 2M2 Tipping is not permitted.
IEC 60721‑3‑1:1997 Climatic influences 2K2 Air temperature of -40 °C to +70 °C is permitted 1)
ces
terials

Technical data
4.2 Unit data
Use Environmental condition Environmental Remark

class
Storage according to Mechanical stability 1M2 Tipping is not permitted.
IEC 60721‑3‑1:1997 Climatic influences 1K3 Air temperature of -40 °C to +70 °C is permitted 1)
ces
terials
1)
Only applies when product is in its original packing
Ambient temperature
Use Tu [°C] Remark

Storage -40 … +70 Only applies when product is in its original packing
according to IEC 60721-3-1:1997
Shipping -40 ... +70 Only applies when product is in its original packing
according to IEC 60721-3-1:1997
Operation 0 ... +55 To ensure adequate cooling of the electronics components,
the supply air temperature must be reduced by 3.5 K / 500 m
from 1000 m above sea level.
4.2 Unit data
Table 4-2 Technical data of the SINAMICS DCM Control Module
Armature rated supply voltage V 5.6 / 50 / 125 / 250 / 575 / 1000

Electronics power supply, V 18 to 30 DC; In = 5 A
rated supply voltage
Rated field supply voltage 1) V 2 AC 400 V (+15 % / -20 %)
2 AC 480 V (+10 % / -20 %)
Rated frequency Hz The units automatically adjust to the frequency of the applied line
voltage in a range from 45 to 65 Hz 3).
Rated field DC voltage 1) V 325 / 390
Rated field DC current A 40
Closed-loop control constancy Δn = 0.006% of the rated motor speed during operation with pulse
encoder and digital setpoint
Δn = 0.1% of rated motor speed during operation with analog
tachometer or analog setpoint 2)
Degree of protection IP00 acc. to IEC 60529
Protection class Class I (with protective conductor system) and Class III (PELV) acc.
to IEC 61800-5-1

Technical data
4.2 Unit data
Dimensions see dimension drawings Chapter "Transport, unpacking, installa‐

tion (Page 47)"
Weight kg 12
1)
The field supply voltage may be below the rated field voltage (setting for p50078.1, input voltages of up to 85 V are
permitted). The output voltage decreases accordingly.
This output voltage can no longer be achieved at voltages below 95% of the rated supply voltage.
2)
Conditions:
The closed-loop control (PI control) stability is referred to the rated motor speed and applies when the SINAMICS DCM is in
the warm operating condition. This is subject to the following preconditions:
- Temperature changes of ± 10 °C
- Line voltage changes of +10 % / -5 % of the rated input voltage
- Temperature coefficient of the tachometer generator with temperature compensation: 0.15 ‰ per 10 °C (for analog
tachometers only)
- Constant setpoint (14-bit resolution)
3)
Operation with an extended frequency range is possible on request.

Technical data
4.2 Unit data

Transport, unpacking, installation 5
5.1 Transport, unpacking
SINAMICS DCM is packaged in the manufacturer's plant in accordance with what is specified in
the order. A product packaging label is located on the carton.
Avoid heavy vibration and severe shocks during transportation, e.g. when lowering into
position.
Follow the instructions on the packaging concerning transportation, storage and proper
handling.
SINAMICS DCM can be installed once it has been unpacked and checked that the delivery is
complete and the device is intact.
The packaging can be disposed of in accordance with local regulations.
If you discover any damage that has occurred in transit, please inform your shipping agent
immediately.
5.2 Installation
WARNING
Failure to observe general safety instructions and residual risks
If the general safety instructions and remaining risks are not observed, accidents can occur
involving severe injuries or death.
• Observe the general safety instructions.
• When assessing the risk, take into account remaining risks.
Note
Restriction regarding disassembly in conjunction with functional safety
If the SINAMICS DCM Control Module is integrated in a functional safety application, it is not
permissible that the firing pulse transformer module or its control is modified in any way, see
Chapter "Functional safety (Page 671)".
5.2.1 Dimension drawings
Device
All dimensions are specified in millimeters.

Transport, unpacking, installation
5.2 Installation
Tolerance for external dimensions is +2 mm

5RWDWLRQSRLQW

IRU0 [

Figure 5-1 Device components after assembly (on delivery)

5.2 Installation

Figure 5-2 Device components arranged alongside each other

5.2 Installation
Firing pulse transformer module

Dimensions of the complete module W × H = 260 × 298 mm

Figure 5-3 Dimension drawing, firing pulse transformers module
Control PCB:

5.2 Installation
PP PP
ෘPP
PP
PP
PP
Figure 5-4 Dimension drawing, control PCB
Side sections:

5.2 Installation

Figure 5-5 Dimension drawing, side sections

5.2 Installation
Voltage measurement equipment


Figure 5-6 Dimension drawing, voltage measurement equipment

5.2 Installation
Fuse monitoring equipment


Figure 5-7 Dimension drawing, fuse monitoring equipment

5.2 Installation
5.2.2 Dividing the unit
1. Loosen the screws ①.

2. Pull the front cover towards you ② and then upwards to remove it ③.
3. Unplug the cable connections between the two plates.
4. Loosen the screws ④.
Figure 5-8 Dividing the unit (1)

5.2 Installation

5. Pull the plate towards you ① and remove it ②.

Figure 5-9 Dividing the unit (2)

5.2 Installation
5.2.3 Removal/Installation and division of modules
5.2.3.1 Removing modules
To remove the firing pulse transformer module, pull the cables out from the module and loosen the
screws ①
To remove other modules, remove the shield ③ by pulling it towards you. You will need to unscrew the
field terminal ④ and then loosen the screws ② before doing this.
Figure 5-10 Removing modules (1)

5.2 Installation
To remove the fuse monitoring equipment, pull the cables out from the module and loosen the
screws ①.
To remove the voltage measurement equipment, pull the cables out from the module and loosen the
screws ②.
Figure 5-11 Removing modules (2)

5.2 Installation
5.2.3.2 Firing pulse transformer module
Dividing the module
1. Use the edge of a table to separate the two terminal parts ①.

2. Use the edge of a table to separate the small control boards ②.
Figure 5-12 Dividing the firing pulse transformer module

5.2 Installation
Installing terminal strips
Leave the two crossbraces ① for supporting the side sections of the modules in the device.
Figure 5-13 Firing pulse transformer module

5.2 Installation
External mounting of module parts

The parts required are not included in the scope of delivery, but are available as a "set of loose
parts" under article no. 6RY1807-0CM00.
The three snap-on parts ① for the DIN rail, which satisfies DIN EN 50022-35x7.5, are mounted on the
terminal strip with spacer rollers ② and M3x16 screws ③.
Figure 5-14 External mounting of the terminal strip
The two snap-on parts ① for the DIN rail, which satisfies DIN EN 50022-35x7.5, are mounted on the
small control boards with M3x8 screws ②.
Figure 5-15 External mounting of the small firing pulse transformer boards

5.2 Installation
5.2.3.3 Fuse monitoring and voltage measurement
External mounting of fuse monitoring equipment

1 1
0 [

2

2

2
2

ุ

Mount the module on the spacing bolts.

① Ferrous fixing elements (x2)
② Insulating fixing elements (x5)
Figure 5-16 External mounting of the fuse monitoring equipment

5.2 Installation
External mounting of voltage measurement equipment

1 1
2 2 ,QWKLVDUHDWKHGDWDFDEOHPXVWKDYHDW
OHDVWDGLVWDQFHRIPPWRWKHFRPSRQHQ

WV H[FHSWIRUWUDQVIRUPHUV
0 [
2 2

ุ

Mount the module on the spacing bolts.

① Ferrous fixing elements (x2)
② Insulating fixing elements (x4)
Figure 5-17 External mounting of the voltage measurement equipment
5.2.4 Installing options and accessories
5.2.4.1 AOP30 operator panel

Installation cut-out required in the cabinet door: 197.5 × 141.5 mm
5.2.4.2 Fuse monitoring distributor

The module can be snapped onto a mounting rail according to DIN EN 50022-35x7.5.

5.2 Installation
5.2.4.3 Installing a second CUD
NOTICE
Electrostatic-sensitive devices (ESD)
Note the information provided on "Electrostatic sensitive devices (ESD)" in Chapter 1.
Note
Use the supplied mounting aid. See Chapter "Replacing the CUD (Page 662)".
1. Unlock and tilt up the BOP support ①.

Figure 5-18 Installing a second CUD (1)

5.2 Installation
2. Mount the CUD and push it into the connectors for the left-hand CUD.
3. Secure the CUD using four screws (screw and washer assembly, M3×6), tightening torque 1 Nm
4. Lock the BOP support again.

CAUTION: Do not clamp the BOP cable

5.2 Installation

Connecting 6
WARNING
WARNING
Electric shock due to the residual charge of the capacitors
Because of the capacitors of the external power unit, a hazardous voltage is still present for a
period of time after the power supply has been switched off.
If live components are touched then this can result in severe injury or death.
• Open the unit only after the time specified on the warning label has elapsed.
• Before starting work, check the absence of voltage by measuring all poles, also to ground.
The devices may be connected to a line supply with residual current operated circuit breaker
if a universal current sensitive device is being used, which in the case of a ground fault,
can also detect a DC component in the fault current. It is recommended to use a residual
current operated circuit breaker with an operating current ≥ 300 mA, which means that it is
not suitable to protect personnel. If you have additional questions, please contact Technical
Support.
The power and control terminals may be live even when the motor is not running.
When handling the device while it is open, remember that live parts are exposed. The device
must only be operated with the front covers provided by the factory fitted. When required,
additional covers should be provided in the control cabinet (for example, in the area around
the busbars).
To operate the SINAMICS DCM, both front cover fixing screws must be tight.
WARNING
Electric shock when connecting a PROFIBUS cable under voltage
When connecting the PROFIBUS cable while voltage is present, there is a danger of coming into
contact with live components behind the terminal.
• Only connect the PROFIBUS cable to connector X126 when the device is in a no-voltage
condition.

Connecting
6.1 Instructions for EMC-compliant drive installation
NOTICE
Surge arresters
Surge arresters must be in compliance with IEC 60364-5-53:2002.
Note
These installation instructions do not claim to contain all details and versions of devices, or to
take into account all conceivable operational cases and applications.
Should you require further information or encounter specific problems which have not been
dealt with in enough detail for your field of application, please contact your sales representative.
6.1.1 Basic information about EMC
What is EMC?
EMC stands for "Electromagnetic compatibility" and describes the capability of a device to
function satisfactorily in an electromagnetic environment without itself causing
electromagnetic interference unacceptable for other devices in the environment. Therefore, the
various devices used should not cause interference to one another.
Within the context of the EMC Directive, the SINAMICS DCM described in this document are
not "devices" at all, but instead "components" that are intended to be installed in an overall
plant or system. For reasons of clarity, however, the generic term "devices" is used in many
cases.
Interference and immunity

EMC is dependent upon two properties demonstrated by the devices involved in the system:
interference and immunity. Electrical devices may be sources of interference (senders) and/or
potentially susceptible equipment (receivers).
Electromagnetic compatibility is ensured when the existing sources of interference do not
impair the function of potentially susceptible equipment.
A device may even be a source of interference and potentially susceptible equipment at the
same time: For example, the power unit of a converter should be viewed as a source of
interference and the control unit as potentially susceptible equipment (interference sink).

Connecting
Product standard IEC 61800-3

Product standard IEC 61800‑3 describes the EMC requirements for "Adjustable-speed electrical
power drive systems". A variable-speed drive system (or Power Drive System PDS) consists of the
drive converter and the electric motor including the connecting cables. The driven machine is
not part of the drive system. IEC 61800‑3 defines different limit values depending on the
installation site of the drive system, referred to as the first and second environments.
Residential buildings or locations at which the drive system is directly connected to a
public low-voltage network without an intermediate transformer are defined as the first
environment.
The term second environment refers to all locations outside residential areas. These
are basically industrial areas that have their own medium-voltage supply via their own
transformers.
0HGLXPYROWDJHQHWZRUN
'LVWULEXWLRQ
RIFRQGXFWHG
IDXOWV
3XEOLF ,QGXVWULDO
ORZYROWDJHQHWZRUN ORZYROWDJHQHWZRUN
0HDVXULQJSRLQWIRU
FRQGXFWHG
IDXOWV
)LUVW 6HFRQG
HQYLURQPHQW HQYLURQPHQW
/LPLWRIIDFLOLW\
P
(TXLSPHQW 'ULYH
DIIHFWHGE\ LQWHUIHUHQFH
IDXOWV 0HDVXULQJSRLQWIRUHPLWWHG VRXUFH
LQWHUIHUHQFH
Figure 6-1 Definition of the first and second environment

Connecting
Categories
Depending on the installation site and the drive power, four different categories are
defined in IEC 61800‑3 with regard to the limit values for interference and two (operating)
environments with regard to the requirements on immunity:
• Category C1:
Drive systems for rated voltages < 1000 V for unrestricted use in the first environment.
• Category C2:
Stationary drive systems for rated voltages < 1000 V for use in the second environment. Use
in the first environment is possible if the drive system is distributed and installed by qualified
personnel. The warning information and installation instructions supplied by the
manufacturer must be observed.
CAUTION
Use in a residential environment
In a residential environment, the drive may cause radio interference. In such cases,
supplementary interference suppression measures may be required.
• Have the installation and commissioning with appropriate radio interference
suppression measures performed by qualified personnel.
• Category C3:
Drive systems for rated voltages < 1000 V for exclusive use in the second environment
CAUTION
Use in a residential environment
The device is not intended for use in a residential environment, and cannot ensure
appropriate protection of radio reception in environments such as these.
• Do not use this device in the first environment (residential area).
• Category C4:
Drive systems for rated voltages ≥ 1000 V or for rated currents ≥ 400 A for use in complex
systems in the second environment
The figure below shows how the four categories are assigned to the first and second
environments:
&
)LUVW & 6HFRQG
HQYLURQPHQW HQYLURQPHQW
&
&
Figure 6-2 Definition of categories C1 to C4
SINAMICS DCM devices are almost exclusively used in the second environment (Categories
C3 and C4).
Radio interference suppression filters and commutating reactors are required whenever they
are to be used in Category C2.

Connecting
SINAMICS DCM conform to the immunity requirements defined in IEC 61800‑3 for the
second environment, and therefore also with the lower immunity requirements in the first
environment.
SINAMICS DCM, use in industrial environments

SINAMICS DCM converter units are used in industrial areas and are components of an electrical
drive. In order to limit the interference in compliance with the limit value for category C2
according to IEC 61800-3, radio interference suppression filters are required in the line supply
feeder cables for the armature and field power units and the commutating reactors.
Non-grounded networks
Non-grounded networks (IT systems) are used in some branches of industry in order to increase
the availability of the plant. In the event of a ground fault, no fault current flows and the plant
can continue with production. If RFI suppression filters are brought into the equation, however,
a fault current does flow in the event of a ground fault, which may cause the drives to shut down
or the RFI suppression filter to potentially be destroyed. For this reason, the product standard
does not define any limit values for these networks. From an economic perspective, any radio
interference suppression measures required should be carried out on the grounded primary side
of the supply transformer.
EMC planning
If two devices are not electromagnetically compatible, you can reduce the interference level of
the source of interference or increase the immunity of the potentially susceptible equipment.
Sources of interference are generally power electronics devices with high current consumption;
reducing their interference levels requires complex filters. Potentially susceptible equipment
usually refers to controlgear and sensors, including their evaluation circuit. There is less work
involved in increasing the immunity of inefficient devices, meaning that - from an economic
perspective - increasing immunity is generally a more favorable option for industrial applications
than reducing the interference level.
In industrial applications, EMC between devices should be based on a carefully balanced
combination of the interference and immunity levels.
The most cost-effective measure that can be put in place to achieve EMC conformance is to
physically separate sources of interference and potentially susceptible equipment - provided
that you have taken this option into account during the planning stage of your machine/
plant. In the first instance, it is necessary to determine whether each unit used is a potential
source of interference or potentially susceptible equipment. Within this context, converter
units and contactors, for example, can be counted as sources of interference. While examples
of potentially susceptible equipment (interference sinks) include PLCs, encoders and sensors.
The components in the control cabinet (sources of interference and potentially susceptible
equipment) must be physically separated, by means of partition plates if necessary, or by
installing them in metal enclosures.

Connecting
6.1.2 EMC-compliant drive installation (installation instructions)
General information
Not only are drives operated in a wide variety of environments, but the electrical components
used (controllers, switch mode power supplies, and so on) can also differ widely with respect to
interference immunity and interference emission levels, meaning that all installation guidelines
of any kind can offer is a practical compromise. For this reason, EMC rules do not need to be
implemented to the letter in all cases, provided that measures are tested on a case-by-case basis.
In order to ensure electromagnetic compatibility (EMC) in your control cabinets in rugged
electrical environments and adhere to the standards required by the relevant legislating
body, the EMC rules listed below should be followed during the construction and design
stages.
Rules 1 to 10 apply on a general level. Rules 11 to 15 must be followed in order to fulfill
interference emission standards.
Rules for EMC-compliant installation
1 Connect all metallic parts of the control cabinet to one another over a flat area with good
conductivity (not paint against paint!). Use contact or scratch washers if necessary. The
cabinet door must be connected to the cabinet using the shortest possible ground strips (at
the top, center, and bottom).
2 Contactors, relays, solenoid valves, electromechanical operating hours counters, etc., in
the cabinet and - where applicable - in neighboring cabinets - must be provided with
quenching combinations such as RC elements, varistors, and diodes. These must be con‐
nected directly at the appropriate coil.
3 Whenever possible, guide signal cables 1) into the cabinet at one level only.
4 Unshielded cables in the same circuit (outgoing/incoming conductors) must be twisted
where possible, or the area between them minimized, to prevent unnecessary frame an‐
tennae.
5 Connect spare wires to the cabinet ground 2) at both ends. This achieves an additional
shielding effect.
6 Avoid unnecessary cable lengths in order to keep coupling capacities and inductances low.
7 Crosstalk is generally reduced if the cables are laid close to the control cabinet ground. Do
not, therefore, route cables freely around the cabinet, but lay them as close as possible to
the cabinet enclosure/mounting plates. This also applies to spare cables.
8 Signal and power cables must be physically separated (to prevent coupling paths). Mini‐
mum clearance: You should aim for a minimum of 20 cm.
If it is not possible to physically separate the encoder and motor cables, the encoder cable
must be decoupled either using a metal partition or by laying it in a metal conduit. The
partition or metal conduit must be grounded at several points.

Connecting
9 Ground the shields of digital signal cables at both ends (source and destination), ensuring
maximum contact area and good conductivity. In the event of poor equipotential bonding
between the shield connections, run an additional equalizing conductor with a cross-sec‐
tion of at least 10 mm² parallel to the shield for the purpose of reducing the shield current.
Generally speaking, the shields may also be connected to the cabinet enclosure (ground) 2)
at several points, and connected at several points outside the control cabinet.
Foil shields should be avoided as they are are at least 5 times less effective than braided
shields.
10 Shields for analog signal cables may be connected to ground at both ends if equipotential
bonding is good (this must be done over a large area with good conductivity). It can be
assumed that equipotential bonding is good if all metal parts are well interconnected and
the electronics components are supplied from a single source.
Connecting a shield at one end prevents low-frequency, capacitive interference from be‐
ing coupled in (e.g. 50 Hz hum). In this case, the shield should be connected in the control
cabinet; a sheath wire may also be used for this purpose.
The cable to the temperature sensor on the motor (X177:53 to 55) must be shielded. The
shield must be connected to ground at both ends.
11 Ensure that the RFI suppression filter is always located close to the suspected source of
interference. The filter must be attached to the cabinet enclosure, mounting plate, etc.,
over a flat area. Incoming and outgoing cables must be physically separated.
12 RFI suppression filters must be used in order to conform to limit value class A1. Additional
loads must be connected upstream of the filter (on the line side).
The controller used and the manner in which the rest of the control cabinet is wired will
determine whether an additional line filter needs to be installed.
13 A line reactor must be included in the field circuit for controlled field power supplies.
14 A line reactor must be included in the armature circuit of the converter.
15 The motor cables do not have to be shielded. There must be a clearance of at least 20 cm
between the line supply feeder cable and the motor cables (field, armature). Use a partition
if necessary.
Footnotes
1)
Signal cables are defined as:
Digital signal cables: e.g. cables for incremental encoders
Analog signal cables: e.g. ±10 V setpoint cable
Serial interfaces: e.g. PROFIBUS-DP
2)
Generally speaking, "ground" refers to all metallic conductive parts that can be connected
to a protective conductor, such as the cabinet enclosure, motor enclosure or foundation
ground.

Connecting
Cabinet configuration and shielding
'RQRWXVHVKLHOGEXVEDUDVVWUDLQ
&DEOHGXFW
UHOLHI
!&DEOHDQFKRULQJUDLO
&RQQHFWWRWKHFDELQHWKRXVLQJ
WKURXJKDODUJHVXUIDFHDUHDWR
6KLHOGFRQQHFWLRQDFFRUGLQJWRWKHIROORZLQJ
HQVXUHWKDWDJRRGHOHFWULFDO
YHUVLRQVDQG
FRQQHFWLRQLVHVWDEOLVKHGRQ
ERWKVLGHV
$OVRVKLHOGRQWKHV\VWHPVLGH HJRQSXOVHHQFRGHU &DEOHDQFKRULQJUDLO
Figure 6-3 Shielding at control cabinet inlet
'DWDFDEOH 'DWDFDEOH $QDORJ

HJ352),%86'3 HJSXOVHHQFRGHU 6LJQDOOLQH
&RQQHFWLQJWHUPLQDOV
&RQQHFWWRWKHFDELQHWKRXVLQJWKURXJKDODUJH
VXUIDFHDUHDWRHQVXUHWKDWDJRRGHOHFWULFDO
$OVRVKLHOGRQWKHV\VWHPVLGH HJRQSXOVHHQFRGHU FRQQHFWLRQLVHVWDEOLVKHGRQERWKVLGHV
Figure 6-4 Shielding in control cabinet

Connecting
Connecting shields to the SINAMICS DCM
Figure 6-5 Connecting shields
Note
The strain relief of shielded cables and the shield support must be mechanically decoupled from
one another.
Radio interference suppression filters for the field circuit
6HSDUDWHXQILOWHUHGDQG
XQILOWHUHGFDEOHV
/ / /
/ / /
1(7=/,1( /$67/2$'
/LQHFRQQHFWLRQ /LQHVXSSO\FRQQHFWLRQILHOGFLUFXLW
&RQQHFWWKHSURWHFWLYHFRQGXFWRU &RQQHFWWRWKHFDELQHWKRXVLQJWKURXJKDODUJHVXUIDFHDUHD
Figure 6-6 Radio interference suppression filter

Connecting
Shield connection

① Connecting terminal on copper bar, max. cable diameter 15 mm

Notice! Risk of pinching cable if screws tightened too much
② Bus-mounting terminal on copper bar, max. cable diameter 10 mm
Notice! Risk of pinching cable if screws tightened too much
③ Metal tube or cable tie on bare metal comb-type/toothed bar
④ Clamp with metallic backing plate on cable support rail
Figure 6-7 Shield connection

Connecting
6.1.3 Arranging components for converter units

9 /LQHYROWDJH

'&9

;39 8 : 8 9 :

)LHOG $UPDWXUH
6,1$0,&6'&0
&RQWURO0RGXOH
& ' & '
① The line reactor in the field circuit is dimensioned for the rated current of the motor field.
② The line reactor in the armature circuit is dimensioned for the rated motor current in the armature.
The line current equals 0.82 times the DC current.
③ The RFI suppression filter for the armature circuit is dimensioned for the rated motor current in the
armature. The line current equals 0.82 times the DC current.
④ The RFI suppression filter for the field circuit is dimensioned for the motor field's rated current.
⑤ If the supply voltages for the armature circuit and field circuit are the same, the supply voltages for
the field can also be taken after the radio interference suppression filter for the armature circuit. In
this case, the radio interference suppression filter must be dimensioned for the sum of the rated
armature current times 0.82 and the rated field current. The armature circuit and the field circuit
must always be separately protected.
Figure 6-8 Arrangement of reactors and RFI suppression filters
NOTICE
Use of radio interference suppression filters
When RFI suppression filters are being used, line reactors must always be used at the unit input
to decouple the TSE circuit.
An incorrect arrangement can destroy a thyristor (short-circuit) and rupture a fuse.
• The components must be wired in the following order:
Line supply – radio interference suppression filter – commutating reactor – power unit.

Connecting
6.1.4 Radio interference suppression filter
Table 6-1 Suggested RFI suppression filters from "TDK Electronics AG (previously EPCOS AG)"
Rated AC cur‐ TN / TT line sup‐ Weig IT line sys‐ Terminal cross- Article number Article number
rent ply ht tem section mm2 TDK Electronics AG SIEMENS
Radio interfer‐ Hole for the screw (previously EPCOS
ence suppres‐ M* AG)
sion filter V kg V
A
Line filters for armature circuit
25 760/440 4 580/335 Terminal 10 mm2 B84143A0025R021 -
50 760/440 4 580/335 Terminal 10 mm 2
B84143A0050R021 -
80 760/440 9.5 630/365 Terminal 25 mm2 B84143A0080R021 6RX1800 - 0LF03
120 760/440 10 630/365 Terminal 50 mm2 B84143A0120R021 6RX1800 - 0LF13
180 - 13 690/400 M10 B84143B0180S024 6RX1800 - 0KF00
180 520/300 5 360/208 M10 B84143B0180S080 6RX1800 - 0GF00
180 760/440 5 560/320 M10 B84143B0180S081 6RX1800 - 0LF04
250 520/300 5 360/208 M10 B84143B0250S080 6RX1800 - 0GF01
250 760/440 5 560/320 M10 B84143B0250S081 6RX1800 - 0LF14
400 - 21 690/400 M10 B84143B0400S024 6RX1800 - 0KF02
400 520/300 7.5 360/208 M10 B84143B0400S080 6RX1800 - 0GF03
400 760/440 7.5 560/320 M10 B84143B0400S081 6RX1800 - 0LF07
600 - 22 690/400 M10 B84143B0600S024 6RX1800 - 0KF03
600 520/300 7.8 360/208 M10 B84143B0600S080 6RX1800 - 0GF04
600 760/440 7.8 560/320 M10 B84143B0600S081 6RX1800 - 0LF08
1000 - 28 690/400 M12 B84143B1000S024 6RX1800 - 0KF04
1000 520/300 18.5 360/208 M12 B84143B1000S080 6RX1800 - 0GF05
1000 760/440 18.5 560/320 M12 B84143B1000S081 6RX1800 - 0LF10
1600 - 34 690/400 2 x M12 B84143B1600S024 6RX1800 - 0KF05
1600 520/300 24.5 360/208 2 x M12 B84143B1600S080 6RX1800 - 0GF06
1600 760/440 24.5 560/320 2 x M12 B84143B1600S081 6RX1800 - 0LF11
2500 530/310 105 460/265 4 x M12 B84143B2500S020 6RX1800 - 0GF07
2500 760/440 105 560/320 4 x M12 B84143B2500S021 6RX1800 - 0LF12
2500 - 105 690/400 4 x M12 B84143B2500S024 6RX1800 - 0KF06
Line filters for auxiliary power supply
25 A 520/300 A 1.1 440/255 A Terminal 4 mm2 B84143A0025R105 6RX1800 - 1GF00
50 A 520/300 A 1.75 440/255 A Terminal 10 mm2 B84143A0050R105 -
90 A 520/300 A 4.20 440/255 A Terminal 35 mm 2
B84143A0090R105 -
Operating temperature 0 °C to 40 °C.

Rated frequency 50 / 60 Hz (± 6%).
Additional information on the radio interference suppression filters can be found on the
Internet page of "TDK Electronics AG (previously EPCOS AG)" (Epcos (http://en.tdk.eu))

Connecting
Radio interference suppression filters generate leakage currents. In accordance with

IEC 61800‑5‑1, a PE connection with a cross-section of 10 mm2 is required. For the filters
to have maximum effect, it is absolutely essential that they and the device are installed on a
single metal plate.
In the case of converters with a 3-phase connection, the minimum rated current of the filter
is the same as the device's input current or output DC current, as specified on the device
rating plate (see Armature Input and Armature Output respectively), times 0.82.
In the case of a two-phase connection (field supply), only two phases are connected to the
three-phase radio interference suppression filter. In this case, the minimum rated current of
the filter is the same as the input current (see Field input) or field DC current specified on the
device rating plate.
6.1.5 Information on line-side harmonics produced by converter units in a fully-

controlled two-pulse bridge circuit configuration (B6C and (B6)A(B6)C)
The majority of converter units for medium-power applications have a fully-controlled three-
phase bridge circuit. Below is an example of the harmonics that can be found in a typical system
configuration for two firing angles (α = 20° and α = 60°).
The values have been taken from a previous publication, "Oberschwingungen im netzseitigen
Strom sechspulsiger netzgeführter Stromrichter (Harmonics in the Line-Side Current of Six-
Pulse, Line-Commutated Converters)" by H. Arremann and G. Möltgen, Siemens Research and
Development Division, Volume 7 (1978) No. 2, © Springer-Verlag 1978.
In addition, the formulas are specified which, depending on the actual operating data in
use [line voltage (no-load voltage Uv0), line frequency fN, and DC current Id], can be used
to calculate the short-circuit power SK and armature inductance La for the motor for which
the specified harmonics spectrum applies. If the actual line short-circuit power and/or actual
armature inductance deviate from the values calculated in this way, then they will need to be
calculated on a case-by-case basis.
The harmonics spectrum listed below is produced if the values for the short-circuit power
SK at the connection point of the device and the armature inductance La of the motor,
calculated using the formulas below, match the actual system values. If the values do not
match, the harmonics will have to be calculated separately.
a) α = 20° b) α = 60°
Fundamental factor g = 0.962 Fundamental factor g = 0.953
ν Iν / I1 ν Iν / I1 ν Iν / I1 ν Iν / I1
5 0.235 29 0.018 5 0.283 29 0.026
7 0.100 31 0.016 7 0.050 31 0.019
11 0.083 35 0.011 11 0.089 35 0.020
13 0.056 37 0.010 13 0.038 37 0.016
17 0.046 41 0.006 17 0.050 41 0.016
19 0.035 43 0.006 19 0.029 43 0.013
23 0.028 47 0.003 23 0.034 47 0.013
25 0.024 49 0.003 25 0.023 49 0.011
The fundamental component of current I1 as a reference variable is calculated using the
following formula

Connecting
I1 = g × 0.817 × Id
where Id is the DC current of the operating point under investigation
and where g is the fundamental factor (see previous table)
The harmonic currents calculated according to the previous table only apply for:
I.) Short-circuit power SK at the location where the converter is connected

SK = U2v0 / XN (VA)
with
XN = XK - XD = 0.03526 × Uv0 / Id - 2πfN × LD (Ω)
and
Uv0 No-load voltage on the power unit terminal V
Id Direct current of the operating point examined in A
fN Line frequency in Hz
LD Inductance of the commutating reactors used in H
XD Impedance of the commutating reactor
XN Impedance of the line
XK Impedance at the unit terminals
II.) Armature inductance La

La = 0.0488 × Uv0 / (fN × Id) (H)
If the actual values for the short-circuit power SK and/or armature inductance La deviate from
the values calculated using the previous formulas, a separate calculation procedure will need
to be carried out.
Example:
Let us assume a drive with the following data:
Uv0 = 400 V
Id = 150 A
fN = 50 Hz
LD = 0.169 mH (4EU2421-7AA10 with ILn = 125 A)
With
XN = 0.03536 × 400 / 150 - 2π × 50 × 0.169 × 10-3 = 0.0412 Ω
the network short-circuit power at the converter unit terminal is as follows:
SK = 4002 / 0.0412 = 3.88 MVA
and the armature inductance of the motor is as follows:
La = 0.0488 × 400 / (50 × 150) = 2.60 mH
The harmonic currents Iν (with I1 = g × 0.817 × Id for firing angles α = 20° and α = 60°) that can
be taken from the tables, only apply for the values SK and La that have been calculated in this
way. If the actual values deviate from these, a separate calculation will have to be made.
For the purpose of dimensioning filters and compensation equipment with reactors, it is only
possible to draw on the information provided by the harmonics values calculated in this way
if the values calculated for SK and La match the actual drive values. In all other cases, a
separate calculation procedure needs to be carried out (this particularly applies when using
machines with compensation, as they demonstrate a very low armature inductance level).

Connecting
6.1.6 Data on the line-side harmonics from converter units in a fully-controlled

AC bridge circuit B2C
Converter units for lower power ratings can be connected and parameterized as fully-controlled
AC bridge circuit.
Below is an example for the current harmonics of a typical system configuration of a field
excitation controller (this is a system with a large DC circuit inductance). The case with the
highest harmonic load of the line supply has been selected here.
For every motor used, a separate investigation must be performed to determine the actual
harmonic load. In any case, the result will be less than in the example shown.
For comparison purposes, the table also includes the harmonic load of a B6C three-phase
bridge at the same operating point as the field excitation controller.
Harmonic order B2C 2) B6C 2) Harmonic order B2C 2) B6C 2)

v Iv / I Iv / I v Iv / I Iv / I
1 1) 90.1% 95.6% 27 3.3%
3 30.0% 29 3.1% 3.3%
5 18.0% 19.1% 31 2.9% 3.1%
7 12.9% 13.7% 33 2.7%
9 10.0% 35 2.6% 2.7%
11 8.2% 8.7% 37 2.4% 2.6%
13 6.9% 7.4% 39 2.3%
15 6.0% 41 2.2% 2.3%
17 5.3% 5.6% 43 2.1% 2.2%
19 4.7% 5.0% 45 2.0%
21 4.3% 47 1.9% 2.0%
23 3.9% 4.2% 49 1.8% 2.0%
25 3.6% 3.8%
1)
Fundamental content
2)
converter circuit
6.1.7 Electromagnetic fields at the workplace
Protection of workers from electromagnetic fields is specified in the European EMF Directive
2013/35/EU. This directive is implemented in national law in the European Economic Area (EEA).
Employers are obligated to design workplaces in such a way that workers are protected from
impermissibly strong electromagnetic fields. To this end, assessments and/or measurements
must be performed for workplaces.
General conditions for correct assessment or measurement

1. The laws for protection from electromagnetic fields in force in individual EU member states
can go beyond the minimum requirements of the EMF Directive 2013/35/EU and always take
precedence.
2. The ICNIRP 2010 limits for the workplace are the basis for the assessment.

Connecting
6.2 Cable routing in the device
3. The 100 μT (RMS) mentioned below for assessment of active implants comes from the
26th BImSchV (Bundesimmissionsschutz Verordnung der Bundesrepublik Deutschland
[German Federal Emission Protection Regulation]).
According to Directive 2013/35/EU, 500 µT (RMS) at 50 Hz is applicable here.
4. Compliance with the limit values was checked for the following frequencies:
– Line frequency 45 ... 65 Hz (see system data)
5. The routing of power cables has a significant impact on the electromagnetic fields that occur.
Cable routing example
Note
Cables, which are not mechanically fixed in the device, must be externally fixed.

Connecting
Figure 6-9 Example for cable routing when fully expanded
Note
The PROFINET cables must be routed into the device from the top (PROFINET is only available
with Communication Board(s) CBE20).

Connecting

① XP24V, electronics power supply connection

② XL1, fan monitoring input, external fault input
③ XL2, floating relay output for the fan. Mechanically attach the cable using one of the shield
clamps ⑧ at the side of the enclosure.
④ XR1, floating relay output for the line contactor. Mechanically attach the cable using one of the
shield clamps ⑧ at the side of the enclosure.
⑤ XS1, E-STOP connection
⑥ XT1, analog tachometer connection
⑦ XB, current transformer connection
Route all cables into the device from the bottom. Cable clamps are provided at the side panels to me‐
chanically fix the cables.
Figure 6-10 Cable routing, power interface
PROFIBUS cable connection (cannot be seen in the previous diagrams):

1. Route the PROFIBUS cables into the device from the bottom
2. Screw the PROFIBUS bus connector to connector X126 at the CUD using the two screws
3. A shield support is not required in the device

Connecting
WARNING
Electric shock during connection while voltage is present
• Only connect the PROFIBUS cable to connector X126 when the unit is in a de-energized
state.
Note
Routing the PROFIBUS connection
If the PROFIBUS bus connector is connected and removed in a system during operation, the
system manufacturer must ensure that the PROFIBUS connection is routed outwards.
Routing the functional safety cable
① Route the cable into the device from the bottom.

② Connect the cable to terminals X200, X201.
③ Strain relief of the cables through positioning on shield clamps on the lower edge of the housing.
Figure 6-11 Routing the functional safety cable

Connecting
Note
It is not required to use shielded cables and shield connection in the device.

Connecting
6.3 Block diagram with connection suggestion

;
8

$QDORJLQSXWV
$OORFDWLRQ%RDUG
8

&RQQHFWRU%RDUG
8

&RQWURO8QLW

8

DQG

3B6 P$PD[

'LJLWDOLQSXWV
0

!

WRWKH

3RZHULQWHUIDFH
LQSXWVRXWSXWV

'LJLWDO

0HPRU\FDUG
3 2SHUDWRUSDQHO

%23
'LJLWDORXWSXWV

;
!
2SWLRQ0RGXOH,QWHUIDFH
20,VORW

3 ; 3DUDOOHO
0GLJLWDO ,QWHUIDFH [

;
8
8,
; $23RSHUDWRUSDQHO
$QDORJLQSXWV
8
352),%86 RSWLRQ
8,
8 ;
! '5,9(&/L4
3sP$ ;
! '5,9(&/L4
1sP$
0DLQVHWSRLQW

0DQDORJ
;
56 %$
RU
6HULDOLQWHUIDFH
0GLJLWDO 866

3HHUWRSHHU
LQWHUIDFH
7; 56 ; RU 866
7; LQWHUIDFH
5;
%$ '
5; $ $QDORJRXWSXWV
3 '
6XSSO\ $

3XOVHHQFRGHU
0 P$PD[
0DQDORJ
7UDFN

0RWRU
7UDFN VHQVH
WHPSHUDWXUH
P$

=HURPDUN 0DQDORJ
;
! !
! RQO\RQ$GYDQFHG&8' %$ HOHFWURQLFDOO\VZLWFKDEOHEXVWHUPLQDWRU
! .O; 2)) IRUWKHQG&8'
8, HOHFWURQLFDOO\VZLWFKDEOHYROWDJHFXUUHQWLQSXW
.O; HQDEOH 2SWLRQ
Figure 6-12 Open-loop/closed-loop control section block diagram

Connecting
(6723 '&9 $&+]9
;6
;7

00
9 0 ;0 ;39
(63

.
$QDORJ 3RZHU21
WDFKRPHWHU ;5
(6723

3RZHU21
0 1 3 .
(OHFWURQLFVSRZHUVXSSO\
)DQ21
)DQ21 ;/
)XVH2. IRUIXVH
;$;% PRQLWRULQJ
/LQHYROWDJHDUPDWXUH IRUYROWDJH
$UPDWXUHYROWDJH VHQVLQJ
;
)LULQJSXOVHVDUPDWXUH IRUWKH
;$
)LULQJSXOVH
WUDQVIRUPHUV
;$
,B,67
;B,B,67
0B,B,67
;%
0B%8(5'( ;% UHVHUYHG
;% IRUODWHUXVH
˖
$UPDWXUHFXUUHQW ;%
/RDG ;%
˖ 0B%8(5'( ;%
;%
˖ &XUUHQWWUDQVIRUPHU
;%
D
7HPSHUDWXUHVHQVRU
E
F
)DQPRQLWRULQJ
7HPSHUDWXUHPRQLWRULQJ ;7

7HPSHUDWXUHPRQLWRULQJ ;7
;
IRUDOORFDWLRQ
ERDUG&8'
)DQ2.

([WHUQDOIDXOW H[WHUQDO
IDXOW
;/
6XSSO\YROWDJHILHOG
)LULQJSXOVHVILHOG
WRWKHILHOGVXSSO\
)LHOGFXUUHQWDFWXDOYDOXH
3RZHULQWHUIDFHIRUWKH&RQWURO0RGXOH ;)
Figure 6-13 Block diagram for power interface

Connecting
$&9+]
$&9
+]
N
8 : N
:
:
8
9
8
9
9 9 9 9 9
;6B ;6B ;6B ;6B ;6B
)XVHV
WRWKH
3RZHU
,QWHUIDFH
;% ;6B ;6B ;6B ;6B ;6B
)XVHPRQLWRULQJ
/LQHYROWDJH
$UPDWXUH 9 9 9 9 9 9
98 a
a ;8 ;8 ;8 ;8 ;8 ;8 8
; ;9 ;9 ;9 ;9 ;9 ;9 9
9: a
a ;: ;: ;: ;: ;: ;: :
WRWKH
;& ;& ;& ;& ;& ;& &
3RZHU ([WHUQDO
;' ;' ;' ;' ;' ;' '
,QWHUIDFH $UPDWXUH ! 3RZHUXQLW
YROWDJH
9ROWDJHPHDVXUHPHQW
ˡ 0
)LULQJSXOVHWUDQVIRUPHU )LULQJSXOVH a
PRGXOH WUDQVIRUPHU ;B :
PRGXOH ;B 8
;,03B ;,03 ;B 9 )DQ
WRWKH ;B & PRQLWRULQJ
3RZHU
,QWHUIDFH
;$
;
;
;$ ;,03B
WRWKH
3RZHU
WRWKH D
,QWHUIDFH ;,03 ;B '
;3$5 ;3$5 3RZHU
,QWHU E
IDFH
F
! 9ROWDJHVHQVLQJIURPWKHILULQJSXOVHWUDQVIRUPHUPRGXOHRUGLUHFWO\
IURPWKHSRZHUXQLW
& '
' &
)LULQJSXOVHVILHOG
0
WRWKH
3RZHU
8 6XSSO\YROWDJHILHOG *
$QDORJWDFKRPHWHU
7HUPLQDOV
,QWHUIDFH ;7
&
)LHOGFXUUHQWDFWXDOYDOXH
6KXQW
'
8
3XOVHHQFRGHU

3RZHUXQLWILHOGVXSSO\ 7HUPLQDOV
;
Figure 6-14 Block diagram for fuse monitoring/voltage measurement equipment, firing pulse transformers, power unit

Connecting
6.4 Connecting the external power unit

The following 5 figures show all the required connections to the power unit.
• Figure: "Connection of a 4-quadrant power unit (1)":
– 4-quadrant drive (parameters assigned for a 4-quadrant drive as delivered - p51825 = 4)
– Line voltage and armature voltage measured via Faston terminals on the firing pulse
transformer module (as delivered)
– 4-quadrant drive (parameters assigned for a 4-quadrant drive as delivered - p51825 = 4)
– Line voltage and armature voltage measured via cables directly from the power unit
– 2-quadrant drive (parameter assignment using parameter p51825 = 2)
– Line voltage and armature voltage measured via Faston terminals on the firing pulse
transformer module (as delivered). The armature current can only be measured if a
connection is made to 1D1 on the power unit.
– 2-quadrant drive (parameter assignment using parameter p51825 = 2)
– Line voltage and armature voltage measured via cables directly from the power unit
• Figure: "Connections to the power interface":
– Connection of fan contactor, fan monitoring equipment, temperature sensors on the
heat sink, external monitoring equipment
WARNING
Electric shock due to incorrectly replaced lines
In its delivered state, the Control Module (both plates mounted on top of each other) is
equipped with connection cables for voltage sensing devices. If the device is mounted in
another form, (according to the descriptions in Chapter "Division options (Page 96)"), the
existing connection cables must be replaced 1:1 by longer cables accordingly.
The cables installed ex works are of type Spec 44 with a voltage rating of 2500 V. The
replacement cables must be selected according to the criteria for routing unprotected active
cables according to EN 61439-1.

Connecting
Please refer to the Chapter "Division options (Page 96)“ for options on how to position the
two plates and how the unit can be divided.
WARNING
Electric shock due to non-fused electrical connections
The following electrical connections between the power unit (line voltage) and the electronics
are affected:
• Secondary sides of the firing pulse transformers
• Voltage sensing devices
• Fuse monitoring equipment
All these cables must be routed according to the criteria for routing unprotected active cables.
• Route the cables between the plates so that a ground fault or short-circuit can be ruled out.
• Comply with local installation regulations, which allow this fault to be ruled out.
• Protect the cables from mechanical damage.
• Apply one of the following measures:
– Use cables with double insulation.
– Observe adequate clearances, e.g. through the use of spacers.
– Route the cables in separate cable ducts or pipes.

Connecting
)LULQJSXOVHRXWSXWV
* *
'
. +.
;
* *
+.
+.
+.
+.
+.
+.
. +.
*
*
*
*
*
*
; :
;
* *
. +.
;
* * 9 9 9 9 9 9
+.
&XUUHQWWUDQVIRUPHU
. 9 9 9
; 8 ! ! 7
; / . 8
* *
. +. O N
; & 9
;
* / 7 .
* :
. +. ! ! ! O N
; 9 9 9 9
;
* 9 9 9 9 9 9
*
. +.
;
* *
. +.
+.
+.
+.
+.
+.
+.
*
*
*
*
*
*
;
* *
. +.
; &
* *
. +. O O N N
;
* * 7RWKHSRZHULQWHUIDFH
. +.
; ' 7KHDUUDQJHPHQWVKRZQKHUH
;
* * IURP./WRNO
. +. DQG./WRNO
;
:LWKUHIHUHQFHWRWKHOLQHVXSSO\LWLVFUXFLDO
9ROWDJHPHDVXUHPHQW WKDWWKHFXUUHQWDFWXDOYDOXHVHQVLQJIXQFWLRQV
9 9 9 9 9 9 SHUIHFWO\
;8 ;8 ;8 ;8 ;8 ;8 8
;9 ;9 ;9 ;9 ;9 ;9 9
;: ;: ;: ;: ;: ;: :
;& ;& ;& ;& ;& ;& &

'
;' ;' ;' ;' ;' ;' '
&
9 9 9 9 9

;6B ;6B ;6B ;6B ;6B
)XVH
;6B ;6B ;6B ;6B ;6B
;6B ;6B ;6B ;6B ;6B
)XVH
;6B ;6B ;6B ;6B ;6B
;6B ;6B ;6B ;6B ;6B
)XVH
;6B ;6B ;6B ;6B ;6B
;6B ;6B ;6B ;6B ;6B
)XVH
;6B ;6B ;6B ;6B ;6B
;6B ;6B ;6B ;6B ;6B
)XVH
;6B ;6B ;6B ;6B ;6B
;6B ;6B ;6B ;6B ;6B
;6B ;6B ;6B ;6B ;6B
)XVH ! 7RDGGLWLRQDOLQSXWVRIWKHIXVH

PRQLWRULQJ DQ\VHTXHQFH
)XVHPRQLWRULQJ
Figure 6-15 Connection of a 4-quadrant power unit (1)

Connecting
)LULQJSXOVHRXWSXWV
* * '
'
. +.
;
* *
+.
+.
+.
+.
+.
+.
. +.
*
*
*
*
*
*
;
;
* *
. +.
;
* * 9 9 9 9 9 9
+.
&XUUHQWWUDQVIRUPHU
. 9 9 9
; ! ! 7
; 8 / . 8
* *
. +. 9 O N
; 9
;
* : / 7 . :
*
. +. ! ! ! O N
; 9 9 9
;
* 9 9 9 9 9 9
*
. +.
;
* *
. +.
+.
+.
+.
+.
+.
+.
*
*
*
*
*
*
;
* *
. +.
; &
&
* *
. +. O O N N
;
* * 7RWKHSRZHULQWHUIDFH
. +.
; 7KHDUUDQJHPHQWVKRZQKHUH
;
* * IURP./WRNO
. +. DQG./WRNO
;
9 9 9 9 9 9 SHUIHFWO\
;8 ;8 ;8 ;8 ;8 ;8 8
;9 ;9 ;9 ;9 ;9 ;9 9
;: ;: ;: ;: ;: ;: :
;& ;& ;& ;& ;& ;& &

'
;' ;' ;' ;' ;' ;' '
&
9 9 9 9 9

;6B ;6B ;6B ;6B ;6B
)XVH
;6B ;6B ;6B ;6B ;6B
;6B ;6B ;6B ;6B ;6B
)XVH
;6B ;6B ;6B ;6B ;6B
;6B ;6B ;6B ;6B ;6B
)XVH
;6B ;6B ;6B ;6B ;6B
;6B ;6B ;6B ;6B ;6B
)XVH
;6B ;6B ;6B ;6B ;6B
;6B ;6B ;6B ;6B ;6B
)XVH
;6B ;6B ;6B ;6B ;6B
;6B ;6B ;6B ;6B ;6B
;6B ;6B ;6B ;6B ;6B

)XVHPRQLWRULQJ

Connecting
)LULQJSXOVHRXWSXWV
* * '
'
. +.
;
* *
+.
+.
+.
. +.
*
*
*
; :
;
* *
. +.
; 9 9 9
* *
. +. &XUUHQWWUDQVIRUPHU
9 9 9
; 8 ! ! 7
; / . 8
* *
. +. O N
; & 9
;
* / 7 .
* :
. +. ! ! ! O N
; 9 9 9 9
;
* 9 9 9
.
;
*
.
+.
+.
+.
*
*
*
;
*
.
; &
*
. O O N N
;
* 7RWKHSRZHULQWHUIDFH
.
; '
* IURP./WRNO
. DQG./WRNO
;
9 9 9 9 9 9 SHUIHFWO\
;8 ;8 ;8 ;8 ;8 ;8 8
;9 ;9 ;9 ;9 ;9 ;9 9
;: ;: ;: ;: ;: ;: :
;& ;& ;& ;& ;& ;& &

'
;' ;' ;' ;' ;' ;' '
&
9 9 9 9 9

;6B ;6B ;6B ;6B ;6B
)XVH
;6B ;6B ;6B ;6B ;6B
;6B ;6B ;6B ;6B ;6B
)XVH
;6B ;6B ;6B ;6B ;6B
;6B ;6B ;6B ;6B ;6B
)XVH
;6B ;6B ;6B ;6B ;6B
;6B ;6B ;6B ;6B ;6B
)XVH
;6B ;6B ;6B ;6B ;6B
;6B ;6B ;6B ;6B ;6B
)XVH
;6B ;6B ;6B ;6B ;6B
;6B ;6B ;6B ;6B ;6B
;6B ;6B ;6B ;6B ;6B

)XVHPRQLWRULQJ

Connecting
)LULQJSXOVHRXWSXWV
* * '
'
. +.
;
* *
+.
+.
+.
. +.
*
*
*
;
;
* *
. +.
; 9 9 9
* *
. +. 9 9
&XUUHQWWUDQVIRUPHU
9
; ! ! 7
; 8 / . 8
* *
. +. 9 O N
; 9
;
* : / 7 .
* :
. +. ! ! ! O N
; 9 9 9
;
* 9 9 9
.
;
*
.
+.
+.
+.
*
*
*
;
*
.
; &
&
*
. O O N N
;
* 7RWKHSRZHULQWHUIDFH
.
;
* IURP./WRNO
. DQG./WRNO
;
9 9 9 9 9 9 SHUIHFWO\
;8 ;8 ;8 ;8 ;8 ;8 8
;9 ;9 ;9 ;9 ;9 ;9 9
;: ;: ;: ;: ;: ;: :
;& ;& ;& ;& ;& ;& &

'
;' ;' ;' ;' ;' ;' '
&
9 9 9 9 9

;6B ;6B ;6B ;6B ;6B
)XVH
;6B ;6B ;6B ;6B ;6B
;6B ;6B ;6B ;6B ;6B
)XVH
;6B ;6B ;6B ;6B ;6B
;6B ;6B ;6B ;6B ;6B
)XVH
;6B ;6B ;6B ;6B ;6B
;6B ;6B ;6B ;6B ;6B
)XVH
;6B ;6B ;6B ;6B ;6B
;6B ;6B ;6B ;6B ;6B
)XVH
;6B ;6B ;6B ;6B ;6B
;6B ;6B ;6B ;6B ;6B
;6B ;6B ;6B ;6B ;6B

)XVHPRQLWRULQJ

Connecting
6.5 Division options
3RZHULQWHUIDFHIRUWKH&RQWURO0RGXOH
,WLVFUXFLDOWKDWFRQQHFWLRQVNOONDUHFRUUHFWO\
;% N
DVVLJQHGWRWKHFXUUHQWWUDQVIRUPHUV &7V WRHQVXUHWKDW
;% O
$FWXDOYDOXH WKHFXUUHQWDFWXDOYDOXHVHQVLQJIXQFWLRQVFRUUHFWO\
$UPDWXUHFXUUHQW ;% O
;% N
7HPSHUDWXUHVHQVRUDW
U
3RZHUXQLWKHDWVLQN ;7
;7 17& N˖RU
N˖DWr&
) FDQEHVHWZLWK
8 9 : S>@
)DXOWVLJQDOLIWHPSHUDWXUH!WKUHVKROG S
˽

)DQ21
IURPWKHLQWHUQDOVHTXHQFHFRQWURO .
;/B
0
a
9 ,QVXODWHGWHPSHUDWXUHVHQVRU
'HYLFHIDQ
RUKHDWVLQNJURXQGHG
S
)DQQRW2. ;/B

U>@

)

)DQPRQLWRULQJ
N˖
$
U>@ 6
U>@
S
;/B

)

([WIDXOW
H[WIDXOW
N˖
LQLWLDWHG
U>@ 6
U>@
;0
Figure 6-19 Connections to the power interface
WARNING
Electric shock in the event of voltage flashovers at the temperature sensor
Voltage flashovers in the signal electronics can occur in motors without safe electrical
separation of the temperature sensors.
• Use temperature sensors that comply with the specifications relating to protective
separation.

The SINAMICS DCM Control Module consists of two plates.
Modules in the front plate:
• Power interface for the Control Module
• Control Unit (CUD)
• BOP20 Operator Panel

Connecting
• Second CUD (optional)

• Communication Board(s) CBE20 (optional)
Modules in the rear plate:
• Fuse monitoring
• Voltage measurement
• Firing pulse transformer module
The two plates can be mounted at a distance from each other in the system, if required.
The firing pulse transformer module can be physically divided. This means parts of it can be
mounted outside the device itself in the area around the power unit.
Some examples are shown below:
Note
If the SINAMICS DCM Control Module is integrated in a functional safety application, the ability
of the Control Module to be disassembled is restricted, see also Chapter "Functional safety
(Page 671)".
• It is not permissible that the firing pulse transformer module or control is modified in any way.
• It is permissible to mount both plates of the Control Module separately.
• The fuse monitoring and the voltage sensing may be removed and mounted outside the
device.
Note
The SINAMICS DCM Control Module is supplied with front and rear plates mounted one on top
of the other. The correct cables (connectors X21A, X22A, XS20, XS21, and X102) for this
mounting type are already in place.
Refer to Chapter "Ordering information for options and accessories (Page 32)" for cable ordering
information if plates are being mounted in accordance with the examples below.
Note
Firing pulse cables (X11...X16, X21...X26)
The firing pulse cables should not be shielded.
If shielding is required, the shield is not connected to ground, but is connected to the auxiliary
cathode of the particular thyristor. This shield must be adequately insulated with respect to its
environment as it is at the full line supply voltage including the hole storage effect peaks.

Connecting
Example 1: Rear plate and front plate mounted one on top of the other or at a distance from
each other, firing pulse transformer module not divided
)XVHPRQLWRULQJHTXLSPHQW
&DEOHOHQJWKVPD[P 9ROWDJHVHQVLQJGHYLFHV
)LULQJSXOVHV
)LULQJSXOVHWUDQVIRUPHUPRGXOH
3RZHUXQLWILHOG
; ; VXSSO\ ([WHUQDO
3RZHU,QWHUIDFH ;,03B ;,03 ;,03 ;,03B 3RZHUXQLW
;)
IRUWKH&RQWURO0RGXOH ; ;
;,03B ;,03 ;,03 ;,03B
&8' ;7 ;6 ;5;/ ;/ ;7 ;3 ; ;
$OORFDWLRQ
;8
;'

;6B
;6B
;%

;,03B ;,03 ;,03 ;,03B ;%
%RDUG ; ; ; +HDWVLQN
; WHPSHUDWXUH
; ;3$5 ;,03 ;,03 ;3$5
; ; &XUUHQW &XUUHQW
)XVH
VHQVLQJ
9ROWDJH
WUDQVIRU WUDQVIRU
;B,B,67 ;% ;,03 ;,03 PRQLWRULQJ PHU PHU
;$ ;$ ; ; ;$
;$
;) ;
;0 ;,03 ;,03
&DEOHOHQJWKVPD[P &DEOHOHQJWKVPD[P
# Short-circuit proof cable installation

Figure 6-20 Division options - Example 1
Table 6-2 Cable
Connection Cable Length Notes

(Connectors/Terminals) max.
X21A (torque direction 1) Ribbon cable, 26-pin 10 m Shield if >1 m.

X23B (fuse monitoring equipment) Ribbon cable, 10-pin 10 m Shield if >1 m.
X45 (voltage measurement equip‐ CAT5 cable, 8-pin 15 m Do not roll up the cable
ment) Connect the cable shield at
both ends of the cable
Provide the cable with inser‐
tion loss elements ("snap-on
ferrites")
Type: Würth Elektronik article
no.: 742 711 32 or compara‐
ble
XF1 (field) Ribbon cable, 20-pin 10 m Shield if >1 m.
Current transformer (XB1) Single wires (stranded wires), twisted- 10 m Shield if >2 m.
pair
Heat sink temperature (XT5, XT6) Single wires (stranded wires), twisted 10 m Shield if >2 m.
Firing pulses Single wires (short-circuit proof rout‐ 3m Do not shield!
(X11 ... X16, X21 ... X26) ing), twisted-pair

Connecting

Fuse monitoring equipment Single wires (short-circuit proof rout‐ 10 m -

(XS1_1 ... XS1_12 etc.) ing), installed in pairs (for each fuse
being monitored)
Voltage sensing devices (XU1, XV1, Single wires (short-circuit proof rout‐ 3m see also Chapter "Connecting
XW1, XC1, XD1 etc.) ing), the external power unit
U-V-W twisted, C-D twisted (Page 90)"
Example 2: Rear plate and front plate mounted one on top of the other or at a distance from
each other, firing pulse transformer module divided, firing pulse transformers mounted on the
power unit
For mechanical modifications, see Chapter "Installation (Page 47)".
)LULQJSXOVHV
3RZHUXQLWILHOG
VXSSO\ ; ; ([WHUQDO
3RZHU,QWHUIDFH ;,03B ;,03B ;,03 ;,03
3RZHUXQLW
IRUWKH&RQWURO0RGXOH ;)
; ;
;,03B ;,03B ;,03 ;,03

&8' ;7 ;6 ;5 ;/ ;/ ;7 ;3 ; ;
;8
;'

$OORFDWLRQ
;6B
;6B
;%

;,03B ;,03B ;% ;,03 ;,03

+HDWVLQN
%RDUG ;
; ; ; WHPSHUDWXUH
; ;3$5 ;3$5 ;,03 ;,03
; ; &XUUHQW &XUUHQW
)XVH
VHQVLQJ
9ROWDJH
WUDQVIRU WUDQVIRU
;B,B,67 ;% PRQLWRULQJ ;,03 ;,03 PHU PHU
;$ ; ;
;$ ;$ ;$
;) ;
;0 ;,03 ;,03
)RUFDEOHVHHWDEOH )LULQJSXOVH
WUDQVIRUPHU
PRGXOH
&DEOHOHQJWKVPD[P &DEOHOHQJWKVPD[P

Table 6-3 Cable


Connecting

ferrites")
ble
pair
Firing pulse transformer control 2 x LiyCY 8 x 2 x 0.5 (or 1) mm2 10 m Connect both ends of the
(XIMP_1 - XIMP11...16) shield.
(XIMP_6 - XIMP21...26) Or
Single wires (stranded wires), twisted- 3 m Shield if >1 m.
pair
being monitored)
Example 3: Rear plate and front plate mounted one on top of the other or at a distance
from each other, firing pulse transformer module divided, firing pulse transformers, voltage

Connecting
measurement equipment and fuse monitoring equipment mounted on the power unit, field
supply remains in the plate.
For mechanical modifications, see Chapter "Installation (Page 47)".
)LULQJSXOVHV
; ; ([WHUQDO

3RZHU,QWHUIDFH ;,03B ;,03B ;,03 ;,03 3RZHUXQLW
;8
;'

IRUWKH&RQWURO0RGXOH
;6B
;6B

;% ; ;
;
;,03B ;,03B ;,03 ;,03
&8' ;7 ;6 ;5;/ ;/ ;7 ;3 ; ;
$OORFDWLRQ )XVH
VHQVLQJ
9ROWDJH
;% ;,03B ;,03B ;,03 ;,03
%RDUG PRQLWRULQJ ; ;
+HDWVLQN
; WHPSHUDWXUH
; ;3$5 ;3$5 ;,03 ;,03
; ; &XUUHQW &XUUHQW
WUDQVIRU WUDQVIRU
;B,B,67 ;% ;,03 ;,03 PHU PHU
;$ ; ;
;$ ;$ ;$
;) ;
;0 ;,03 ;,03
)RUFDEOHVHHWDEOH
)LULQJSXOVH
WUDQVIRUPHU
PRGXOH
3RZHUXQLWILHOG &DEOHOHQJWKVPD[P
VXSSO\
;)

Table 6-4 Cable

ferrites")
ble
pair

Connecting

Firing pulse transformer control 2 x LiyCY 8 x 2 x 0.5 (or 1) mm2 10 m Connect both ends of the
(XIMP_1 - XIMP11...16) shield.
(XIMP_6 - XIMP21...26) Or
Single wires (stranded wires), twisted- 3 m Shield if >1 m.
pair
being monitored)

Connecting
Example 4: Parallel connection of power units with a shared set of control electronics
&DEOHOHQJWKVPD[P
)LULQJSXOVHV
; ; ([WHUQDO

;,03 ;,03 3RZHUXQLW
;6B
;6B

;% ; ;
;,03 ;,03
; ;
)XVH ;,03 ;,03
PRQLWRULQJ ; ; +HDWVLQN
WHPSHUDWXUH
;,03 ;,03
; ;
;,03 ;,03
; ;
;,03 ;,03
)LULQJSXOVH
WUDQVIRUPHU
PRGXOH
)LULQJSXOVHWUDQVIRUPHUPRGXOH )LULQJSXOVHV
; ; ([WHUQDO

3RZHU,QWHUIDFH ;,03B ;,03B ;,03 ;,03 3RZHUXQLW
;8
;'

IRUWKH&RQWURO0RGXOH
;6B
;6B

;% ; ;

;
;,03B ;,03B ;,03 ;,03
&8' ;7
; ;
;7 ;6 ;5;/ ;/ ;7 ;3
$OORFDWLRQ )XVH
VHQVLQJ
9ROWDJH
;% ;,03B ;,03B ;,03 ;,03

%RDUG PRQLWRULQJ ; ;
+HDWVLQN
; WHPSHUDWXUH
; ;3$5 ;3$5 ;,03 ;,03
; ; &XUUHQW &XUUHQW
WUDQVIRU WUDQVIRU
;B,B,67 ;$ ;,03 ;,03 PHU PHU
;$ ; ;
;$ ;$ ;$
;) ;
;0 ;,03 ;,03
)LULQJSXOVH
WUDQVIRUPHU
PRGXOH
3RZHUXQLWILHOG &DEOHOHQJWKVPD[P
VXSSO\
;)
;$ )XVHPRQLWRULQJGLVWULEXWRU
;&
;'
;%
;(
;)
# short-circuit-proof routing

Connecting
Notes:
• Cables:
The corresponding information in Examples 1 to 3 of this section applies to the cable types
and permissible cable lengths.
• Please refer to the Chapter "Connecting the firing pulse transformers (Page 118)" for
information on parallel connection.
• Please refer to the Chapter titled “Connecting fuse monitoring equipment (Page 120)” for
information on fuse monitoring equipment.
• Please also note the information contained in Chapter "Parallel connection of power units
(Page 121)"
Example 5: Controlling a SITOR thyristor set 6QG12

The information on cables, cable lengths, and module division provided in Example 3 also largely
applies to this example.
The firing pulse transformer module is completely divided up. The small individual boards
containing the firing pulse transformers can be connected to the power unit instead
of the old-style small firing pulse transformer boards. The fuse monitoring and voltage
measurement equipment is mounted in the immediate vicinity of the SITOR set.
Connecting current transformers
① Current transformers
② Remove the connection between
the current transformers and mod‐
ule A7 and connect the current
transformer cables directly to the
current transformers' screw termi‐
nals.
Rear view

Connecting
Circuit (B6)A(B6)C (4-quadrant drive)
6,725WK\ULVWRUVHW4*
LQFLUFXLW%&
89: /LQHYROWDJH
)XVHV
3RZHU,QWHUIDFH
IRUWKH&RQWURO0RGXOH
) ) ) ) ) )
! ! ! ! ! !
&8' ;7;6;5;/;/ ;7 ;3
$OORFDWLRQ $ $ $ $ $ $
%RDUG ! ! ! ! !
;% !
;,03 ;,03 ;,03 ;,03 ;,03 ;,03
; ;
! ! ! ! ! !
;6%
;B,B,67
;$ ;,03 ;,03 ;,03 ;,03 ;,03
;,03
;) ;$ ;
;0
; ; !
3RZHUXQLW ;$ ;$ ;3$5

ILHOG ;3$5 ;,03B ;,03B ;,03B ;,03B ;,03B ;,03B
VXSSO\
!$UPDWXUHYROWDJH
;)
)XVH ;6B 9ROWDJH ;8

;9
PRQLWRULQJ VHQVLQJ
;
;:
;&
&DEOHOHQJWKV ;'
;%
PD[P

;6B

+HDWVLQNWHPSHUDWXUH
&XUUHQWWUDQVIRUPHU

<1> Firing pulse transformer module inserted into the available plastic holders (following the order of the terminal names
shown in the figure).
Cables routed to the firing pulse transformers run from terminal strips XIMP_1 and XIMP_6 to XIMP11 (IMP11, P24) -
XIMP26 (IMP26, P24).
Firing cables X11 (K, G) to X26 (K, G) routed to the thyristors not shown
(X11 to X16 each routed to thyristor V01 in the thyristor double block, X21 to X26 routed to thyristor V02)
<2> Connection of the fuse monitoring equipment to the Faston tabs on the fuse holders.
The equipment for measuring the line voltage can be connected to the fuses in the thyristor blocks A1 (= AK1 = U), A3
(= AK3 = V), and A5 (= AK5 = W) (see circuit diagram below).
<3> Do not connect X1, X2
<4> Measurement of armature voltage: connection of KW (AW) - C and AW (KW) - D
Figure 6-24 Circuit (B6)A(B6)C (4-quadrant drive)
For information: Circuit diagram, SITOR set (4Q) before being equipped with SINAMICS
DCM Control Module

Connecting
SITOR sets 6QG12 in an anti-parallel connection of two three-phase current bridge circuits [(B6)A(B6)C] with a trans‐
former module for measuring actual current values (if SITOR sets 6QG12 are being used without a transformer module
for measuring actual current values, there is no need for an A7 module)
Figure 6-25 SITOR 4Q before modification

Connecting
Circuit B6C (2-quadrant drive)
6,725WK\ULVWRUVHW4*
LQFLUFXLW%&
89: /LQHYROWDJH
)XVHV
3RZHU,QWHUIDFH
IRUWKH&RQWURO0RGXOH
) ) ) ) ) )
! ! ! ! ! !
&8' ;7;6;5;/;/ ;7 ;3
$OORFDWLRQ
$ $ $ $ $ $
%RDUG
;%
; ;
! ! ! ! ! !
;6%
;B,B,67
;$
;,03 ;,03 ;,03 ;,03 ;,03 ;,03
;) ;$ ;
;0
; !
3RZHUXQLW ;$ ;$ ;3$5

ILHOG ;3$5 ;,03B ;,03B ;,03B ;,03B ;,03B ;,03B
VXSSO\
!$UPDWXUHYROWDJH
;)
&DEOHOHQJWK
PD[P )XVH ;6B 9ROWDJH ;8
;9
PRQLWRULQJ VHQVLQJ
;
;:
&DEOHOHQJWKV ;&
PD[P ;'
;%

;6B

+HDWVLQNWHPSHUDWXUH
&XUUHQWWUDQVIRUPHU

<1> Firing pulse transformer module inserted into the plastic holders available (following the order of the terminal names
shown in the figure).
Cables routed to the firing pulse transformers run from terminal strips XIMP_1 to XIMP11 (IMP11, P24) - XIMP16 (IMP16,
P24).
Firing cables X11 (K, G) to X16 (K, G) routed to the thyristors not shown
(X11 to X16 each routed to thyristor V01 in the thyristor double block, X21 to X26 routed to thyristor V02)
<2> Connection of the fuse monitoring equipment to the Faston tabs on the fuse holders.
The equipment for measuring the line voltage can be connected to the fuses in the thyristor blocks A1 (= AK1 = U), A3
(= AK3 = V), and A5 (= AK5 = W) (see circuit diagram below).
<3> Do not connect X1
<4> Measurement of armature voltage: Connection of KW - C and AW - D. (see the circuit diagram below for details of how
to connect to Faston tabs on the thyristor blocks)
Figure 6-26 Circuit B6C (2-quadrant drive)

Connecting
For information: Circuit diagram, SITOR set (2Q) before being equipped with SINAMICS
DCM Control Module
SITOR sets 6QG12 in a three-phase current bridge circuit [B6C] with a transformer module for measuring actual current
values (if SITOR sets 6QG12 are being used without a transformer module for measuring actual current values, there is
no need for an A7 module)
Figure 6-27 SITOR 2Q before modification

Connecting
6.6 Measurement of the armature current
6.6.1 General information
Measuring circuit on the power interface for the Control Module:
;%
; 6
5
˖ IRUWKH&8'
; %8(5'(B
;% N N

;% ;

5 N
˖ ;1
; N N
;%
IRUWKH&8'
˖ N
,B,B,67 %8(5'(B
;B,B,67 0B,B,67
;B,B,67
;%
;%
;% ;
N
5
˖
; N 0B%8(5'(
;%
Figure 6-28 Current measurement
Arrangement on the power interface for the Control Module:
Arrangement of X_I_IST
Arrangement of terminals XB

Connecting
Note
In the previous diagrams, switch S700 is shown in the state when shipped from the factory.
The disconnecting links for switch S700 must be soldered into the hooks to ensure the
connection is secure.
Dimensioning current transformers, load resistors

The digital-to-analog converter circuit on the CUD can process voltages of up to ±3 V (peak
value). When dimensioning the current transformers and load resistors, it is important to ensure
the voltage at signals BUERDE_1 and BUERDE_2 (see "Current measurement" figure) never
exceeds this value, even at the highest expected overcurrent in the power unit. On delivery,
actual current value measurement on the SINAMICS DCM Control Module is configured in such
a way as to ensure an actual current value signal of 1 V at the rated device current. The difference
amplifier in the "Current measurement" figure can also be used (with amplification of 0.1) to
adjust the input voltage of existing measuring equipment with different scaling.
It is better to dimension the current transformers and load resistors in such a way as to
ensure an average load voltage of no more than 1 V at the armature's rated DC current.
If an external load resistor is being used, ensure the wires between this resistor and terminals
XB-1 to XB-8 are twisted and kept as short as possible. To prevent measuring errors, the
external load resistor itself should be connected in accordance with the four-wire method
(potential tap) and have as little inductance as possible.
With the four-wire method, the current to be measured is routed through the resistor. The
resulting voltage (load voltage) is tapped at the connections at a distance specified by the
manufacturer. This ensures measurements are as accurate as possible.
Only load resistors with a maximum power loss of at least 0.5 W can be soldered in at
the soldering terminals parallel to the 10 Ω load resistors already installed. If 5 A current
transformers are already present, 5 A/ 0.1 A matching transformers should be used. In such
cases, the standard R701 and R708 load resistors can be used with 10 Ω each.
The maximum permissible current at input terminals XB1 to XB4, XB7, and XB8 is 1 A.
If two current transformers are already present in a V-circuit, these can be connected directly
to terminals XB-1 to XB-4 without V-circuit in order to reduce the wait time for current
reversal (higher dynamic response to torque changes). See next chapter.
Interposing current transformers may only be connected directly downstream of a current
transformer and not downstream of a V-circuit!
6.6.2 Current measurement with two current transformers on the line side
(on delivery)
Configuration as shown in Chapter "Connecting the external power unit (Page 90)"

Connecting
Current transformer
XB-1 k1 Current transformer T1 signal K line side

XB-2 l1 Ground reference L device side
XB-3 l2 Ground reference
XB-4 k2 Current transformer T2 signal
The current transformers must have no external connection to ground. Only terminals XB-2
and XB-3 may be used for this purpose.
S700 switch positions:

2 – 3 connected
5 – 6 connected
8 – 9 connected
The position of the S700 means that the difference amplifier on the power interface for the
Control Module (see "Measuring circuit" figure) is not active. The load voltages from X3 are
connected directly to the control electronics.
Load resistors
8%
5%
¾[,G
RB = Load resistor
UB = Load voltage (= mean value over 1 current crest, not the rms value or mean value over the entire
period); recommended value = 1 V
ü= Transformation ratio of the current transformer (I2/I1) (in general, ü = 1/number of turns)
Id = Rated armature DC current
The values determined for the load resistances can be set by soldering additional resistors
onto the soldering lugs parallel to R701 and R704 and, if necessary, by removing R701 and
R704.
The influence of the magnetizing current can be taken into account in order to determine
the load resistances accurately. If the magnetizing current is not taken into account, then
a higher current equivalent to "magnetizing current x number of turns" flows through the
cables than is actually displayed.
Determining the magnetizing current
The secondary current of the current transformer must flow through its ohmic resistor (at
maximum operating temperature), load resistor, and any rectifier diodes connected in series.
This results in a calculable voltage drop at the rated current (sinusoidal). This voltage (50 Hz
sine-wave) is then applied on the secondary side and the magnetizing current measured.
This value is then used to calculate RB.
It is also important to ensure that current transformers do not experience excessive
saturation in the event of an overcurrent, as the magnetizing current will increase
dramatically. It is also important to take temperature rise into account when operating at
permanent load.
Load resistor taking into account the magnetizing current

Connecting
8%
5%
,P
¾[ ,G
¾
Im = Magnetizing current
Parameter settings
p51822 = Rated armature DC current

p51823 = Load voltage at rated armature current
(on delivery = 1000.0 mV)
p51824 = 1: Current transformers in phases U and V
2: Current transformers in phases U and W (on delivery)
3: Current transformers in phases V and W
4: Current transformers externally interconnected in a V-circuit
5: Actual current value signal, bipolar (external shunt)
p51852 = 0: Internal measurement of armature actual current value
1: Measurement of armature actual current value via X177.1/2
6.6.3 Current measurement via terminal block XB-1 to XB-4 with external
measuring circuit
6.6.3.1 External current transformers in V-circuit with +1 V at rated armature DC current
Principle of operation of the V-circuit

Two current transformers (CTs), a rectifier bridge and an external load resistor are connected-
up corresponding to the following diagram to measure the current.
It is important that the ends with the same name (lower case l) are connected together. This
is then followed by a 3-phase bridge rectifier with a load resistor. As a consequence, any
current can flow through the load resistor.

Connecting
Advantage of the V-circuit

Due to the threshold voltage of the diodes, the CT (current transformer) is more quickly
demagnetized.
Disadvantage of the V-circuit

The demagnetization current of the CT is converted into an apparent armature current as a
result of the rectifier diodes (in spite of armature current = 0). This makes it more difficult
to identify a no-current interval to change the current flow direction. As a consequence,
when using this circuit, a longer torque-free pause must be maintained than when directly
measuring the armature current.
Connection
The output signal of the V-circuit is connected to terminals XB-1 (+) and XB-2 (-).
Terminals XB-3 and XB-4 are not used.

2 – 3 connected
5 – 6 connected
8 – 9 connected
Remove R701! The difference amplifier is not used.
Parameter settings

p51823 = Input voltage at rated armature current
p51824 = 4 (V-circuit)
Load
The load resistor for the open-delta connection should be located externally, but must not be
grounded externally. Terminal XB-2 is used for grounding. R701 should be removed.
6.6.3.2 External current transformers in V-circuit with +10 V at rated armature DC current
Connection
The output signal of the V-circuit is connected to terminals XB-1 (+) and XB-2 (-), terminals
XB-3 and XB-4 must be shorted.

1 – 3 connected
4 – 6 connected
7 – 9 connected
Remove R701. The difference amplifier at the power interface is active. The input signal is
reduced to a tenth of its value (10 V to 1 V at rated DC current).

Connecting
Parameter settings

p51823 = Input voltage at rated armature current/10
p51824 = 4
Load
The load resistor for the open-delta connection should be located externally, but must not be
grounded externally. Terminal XB-2 is used for grounding. R701 should be removed.
6.6.3.3 Differential input for +/-10 V at rated armature DC current

This connection option is intended for operation with an LEM transformer or shunt amplifier.
It should be remembered that many products are limited in terms of what they can control.
Where this is the case, connection should be based on a 1 V input.
Connection
XB-1 positive (not inverted), XB-4 negative (inverted). External grounding at XB-4 is
recommended. The signal has both polarities (switches pole during torque changes).

1 – 3 connected
4 – 6 connected
7 – 9 connected
Remove R701 and R704. The difference amplifier has an attenuating effect (10:1).
Parameter settings

p51824 = 5 (bipolar)
Load
The load resistor of the LEM current transducer should be located externally and grounded
with the power supply. Since shunt amplifiers generally have a ±10 V voltage output, they do
not require a load.
6.6.3.4 Input for +/-1 V at rated armature DC current

This connection option is intended for operation with an LEM transformer.
Connection
XB-1 positive (non inverting), XB-2 negative (inverting). The signal has both polarities
(switches pole during torque changes).

Connecting
XB-1
LEM
XB-2

2 – 3 connected
5 – 6 connected
8 – 9 connected
Remove R701.
Parameter settings

p51823 = Input voltage at rated armature current
p51824 = 5 (bipolar)
Load
The load resistor should be located externally and grounded with the LEM transformer's
power supply. The value should be dimensioned to produce a 1 V voltage at the rated current.
6.6.4 External current measurement via X21A or X_I_IST
For the arrangement of the terminals at the

Power Interface of the SINAMICS DCM Control
Module, see also the diagram in Chapter “Gen‐
eral information (Page 109)”.

Connecting
X21A-23 and X_I_IST-1 = I_IST, negative actual current value

X21A-24 and X_I_IST-2 = M_I_IST, reference potential
S700 switch positions

1 – 3 connected
5 – 6 connected
8 – 9 connected
The difference amplifier is active. The input signal is inverted and reduced to a tenth of its
value (-10 V to 1 V at rated DC current or -30 V to 3 V at the control limit).
Parameter settings

p51824 = 4 for unipolar (negative) actual current value signal
5 for bipolar actual current value signal
6.6.5 Offset correction via XN1
For SITOR sets 6QGXX with shunt current measurement and both V/f and f/V conversion, the
potentiometer (R202 on module 6QM400 for SITOR thyristor set 6QG22) on the secondary side
should be calibrated to exactly match the zero point of the output voltage when the device is de-
energized. Please refer to Chapter 6 for 6QG22, "Improving interference immunity and drift
problems of the analog actual current value for SITOR electronics". If this potentiometer is not set
correctly, not only will an offset error occur, but current measurement will be subject to a scaling
error. In order to make additional adjustments to the offset for a precise zero current message,
connector XN1 on the power interface for the Control Module must be connected to an analog
output (±10 V) on the Control Module (CUD). The offset can be minimized by assigning output
voltage parameters manually. This will not, however, rectify the scaling error referred to above.
6.6.6 Information on the differential input, control limits, and grounding
If the difference amplifier is used with an amplification of 0.1, a differential input voltage of up
to ±30 V can be processed as a single-ended output voltage (up to ±3 V). The value ±3 V
represents the control limits of the analog digital converter on the CUD.
If the output signal from external armature current measurement is scaled to ±10 V at rated
current, it will not be possible to measure overcurrent. For example, if the output signal from
armature current measurement is scaled to ±5 V at rated current, a current of 2 × IRATED can be
measured.
It is vital for users of the SINAMICS DCM Control Module to realize that they need to
check whether the method used for current measurement is really able to map the desired
overcurrents and the expected peak values within the tolerance required. It is important to
check the current measurement circuit to ensure that current mapping remains linear right

Connecting
through to the desired overcurrent capacity. If this is not the case, the capping of the actual
value will result in current overshooting and, ultimately, in blown fuses.
The most common risk is overloading of the last operational amplifier in the measuring
circuit. This problem can be avoided by scaling external current measurement to a sufficiently
low value. For example, R642 needs to be shorted in 6QG22. Similarly, R71 needs to be
jumpered with an additional 100 kΩ in 6QG35. This ensures there is controllability at
anything up to 2 x rated current (±10 V).
The SINAMICS DCM Control Module is able to process load signals up to a peak value of ±3 V
(= 3 × rated current). This means processing is possible up to a peak value of ±30 V when the
differential input is being used.
If the V-circuit is being used with an external load resistor and there is no downstream
amplifier, it is advisable to dimension the load resistor for 1 V at rated current. The R701 or
R704 internal 10 Ω resistor should be removed to minimize the influence of the supply line
and terminal resistance. Please take care when performing calculations if the resistor is still
in place! In this case, the integrated load resistor of 10 Ω must be taken into consideration
when calculating the external load resistor. Existing load resistors for 10 V at rated current
can have their previous value and power loss reduced to a tenth. Terminals XB-1 and XB-2
are used for the connection, with XB-2 acting as the ground connection. EMC requirements
mean there should be no other connection between the V-circuit and ground.
If a V-circuit for 10 V at rated current is to be connected without any changes, either
terminals XB-1 and XB-4 (with the difference amplifier at 0.1) or terminals X_I_IST must be
used. In such cases, one end of the load resistor should be grounded for EMC reasons.
If an external measuring circuit (LEM transformer) is connected, its electronic ground should
be grounded for EMC reasons.

Connecting
6.7 Connecting the firing pulse transformers
6.7.1 General information

The twelve firing pulse drivers for the firing pulse transformers are located on the "Power
interface for the Control Module" module. The firing pulses for the first torque direction can be
accessed via connector X21A and those for the second torque direction via connector X22A.
Each firing pulse driver has an open drain output with a parallel diode downstream of the
electronics ground. A further diode discharges shutdown overvoltages internally downstream
of P44 (+44 V). The twelve firing pulse transformers (containing 33 Ω series resistors) are located
on the "Firing pulse transformer module". Each is connected between P24 and the firing-circuit
cable. Each of the twelve firing pulse drivers can control up to three firing pulse transformers
(containing 33 Ω series resistors) in parallel. There is no short-circuit protection! The user is
responsible for ensuring the outputs are not overloaded. The maximum power pulse current at
each of these outputs is 2.5 A. The circuit as a whole is dimensioned for long pulses.
Note
If the SINAMICS DCM Control Module is integrated in a functional safety application, it is not
permissible that the firing pulse transformer module or its control is modified in any way, see also
Chapter "Functional safety (Page 671)".
6.7.2 Normal use (individual)

Connectors X21A and X22A are connected with the connectors of the same name on the "Firing
pulse transformer module" via two 26-pin ribbon cables. The firing pulse transformers on the
module with the same name are then connected. It is only necessary to use the ribbon cable for
X21A for operation with just one current direction. If the "Firing pulse transformer module" has
been divided (broken up), each firing pulse transformer must be connected to the terminal strip
via two twisted cables.

Connecting
6.7.3 Parallel connection of firing pulses

Up to three firing pulse transformers (containing 33 Ω series resistors) can be connected in
parallel. This involves connecting additional "Firing pulse transformer modules" (firing pulse
transformers) (spare part article number 6RY1703-0CM01) via ribbon cables or using two
twisted cables to wire each individual firing pulse transformer in parallel with the terminal with
the same name.
• Two or three firing pulse transformers can be connected in parallel to increase the firing
current of the thyristors. This involves connecting the secondary sides of the firing pulse
transformers in parallel for each firing pulse. The firing current actually achieved should be
checked with a current probe and an oscilloscope.
• For operation with just one current direction (torque direction), the second half of the "Firing
pulse transformer module" can be used for connecting a power unit in parallel or increasing
the firing current. This involves connecting connector X21PAR on the "Firing pulse
transformer module" with connector X22PAR via a 26-pin ribbon cable. Where this is the
case, numbers X21 to X26 on the firing pulse transformers are no longer really applicable.
NOTICE
Only connect a maximum of three firing pulse transformers to any one firing pulse output!
There is a risk of the firing drivers on the "Power interface for the Control Module" module being
damaged due to overload.
The power interface for the Control Module is protected by F400 fuses (1 A, time-lag).
6.7.4 External amplification of firing pulses

No more than three power units can be connected in parallel unless external firing pulse
amplifiers with their own 24 V supply are connected. The maximum possible load of the internal
firing pulse drivers (open drain) is 2.5 A per pulse.
The associated cables for the electronic ground are also brought out at connectors X21A and
X22A.
The P24 cables of connectors X21A and X22A must not be subjected to loads greater than
1 A (this is not normally connected either). The external firing pulse amplifiers must be
provided with 24 V (22 V to 30 V) via their own power supply. The supply lines for the
external firing pulse amplifiers must be sufficiently interference-proof to prevent thyristors
misfiring under the prevailing conditions.
Notes
• External firing pulse amplifiers usually have integrated pull-up resistors at their inputs. If this
is not the case or interference immunity needs to be increased, additional pull up resistors
can be connected. However, the power pulse current must not exceed 1 A for each output.
• Where several firing pulse amplifiers with their own power supply are connected in parallel
on the input side, the inputs will need to be decoupled by isolation diodes.

Connecting
6.9 Connecting fuse monitoring equipment
Note
Restriction in conjunction with functional safety
In conjunction with the use of functional safety, it is not permissible that external firing pulse
amplifiers are used.
6.8 Connecting voltage measurement equipment

The following potentials from the power unit need to be connected to the "Voltage
measurement" module:
• Line supply voltage 1U1, 1V1, and 1W1
• Output voltage 1C1 and 1D1
The mounting tabs are arranged in groups for the different line voltage ranges.
Table 6-5 Connecting voltage measurement equipment, parameter settings
Rated line voltage Plug in at Parameter 1)

<6V 5.6 V p51821 = 6
6 V - 50 V 50 V p51821 = 50
51 V - 125 V 125 V p51821 = 125
126 V - 250 V 250 V p51821 = 250
251 V - 575 V 575 V p51821 = 575
576 V - 1000 V 1000 V p51821 = 1,000
1)
Index [0] for line voltage, index [1] for armature voltage
Other parameters:
p50078[0] Actual rated input voltage, armature
p51820 Suitable rated supply voltage (rms value) for the power unit (thyristors' proof
voltage)
The voltage level selected must be the same on the printed circuit board and in the firmware
or the voltages measured will be highly inaccurate.
Voltage measurement equipment does not generate any ground leakage current.
6.9 Connecting fuse monitoring equipment

One or more fuse monitoring units can be used to monitor the fuses of one or more power units.
Fuse monitoring equipment does not generate any ground leakage current.

Connecting
6.10 Parallel connection of power units
Just the same as for the voltage sensing, the cables must be inserted at the blade terminals
for the particular line voltage range. Two adjacent blade terminals form a monitoring
function.
Using the fuse monitoring unit, up to six individual fuses can be monitored, isolated from
one another – or twelve fuses, if there are two for each phase. The module is connected at
the Power Interface via X23B.
Fuse monitoring equipment connected in parallel
Up to five fuse monitoring units can be connected in parallel to monitor additional fuses. In
this way, up to 30 individual fuses can be monitored or 60 fuses if there are two for each
phase.
The fuse monitoring units are connected through the fuse monitoring distributor available as
an accessory.
All fuse monitoring units used are connected at the fuse monitoring distributor (connectors
X23B to X23F). The fuse monitoring distributor is connected to the power interface for the
Control Module via the ribbon cable provided (connector X23A).
The individual fuse monitoring modules can be activated by entering a "1" at p51831[0...4].
Note
In Chapter "Division options (Page 96)", the connection of the fuse monitoring unit to the power
interface via X23B can be seen in the circuit diagrams for examples 1 to 3.
Example 4 shows the use of the fuse monitoring distributor for connecting two fuse monitoring
units to a power interface.
Ordering modules
When delivered, the SINAMICS DCM Control Module contains a fuse monitoring unit.
Additional fuse monitoring units as well as the fuse monitoring distributor module are
available as accessories.
See Chapter "Ordering information for options and accessories (Page 32)" for ordering data.
Current splitting / symmetry

It is important to ensure the current is split correctly when connecting power units in
parallel. Even distribution must be ensured to prevent power unit overloads. Appropriate
derating measures should be implemented where necessary. In view of this, it is absolutely
essential that all parallel firing pulse transformers/firing pulse amplifiers are of the same
type and design. The split of current across the power units connected in parallel should
be checked during commissioning and corrected, where necessary, by harmonizing source
impedances (line reactors, supply lines, and transformers). If unexpected problems are
encountered during this process, check whether the firing pulses at the thyristors are
occurring simultaneously. The execution times for the firing pulses must not differ by more
than 200 ns. It is recommended that the firing currents of those thyristors that are to fired
simultaneously in a parallel connection, should be compared on an oscilloscope with two

Connecting
small current probes.

"Simulation mode" can be used for this purpose. It can be activated individually for each
thyristor with parameter p51840. With electrical connections, the power unit should be
safely disconnected to prevent accidents.
Comments on voltage measurement/Synchronization

The best method is to connect voltage measurement equipment 1U1, 1V1, and 1W1 at
the branching points of the line supply. The connection of motor voltages 1C1 and 1D1 is
relatively unimportant.
Comments on fuse monitoring

If possible, all the fuses of the devices connected in parallel should be monitored. It
is particularly important to monitor the fuses at branches not measured by a current
transformer. The SINAMICS DCM Control Module is unable to measure whether the current
has been split evenly at these points.
Note
The currents (current splits) measured by the SINAMICS DCM Control Module itself are wholly
dependent on the values determined by the current transformers. The device itself is not able to
measure current splitting in the phase that runs through the current transformers (mainly 1V1).
Where only one set of SINAMICS DCM control electronics is being used, with firing pulses
connected in parallel accordingly, it is not easy to determine how the current is split between the
power units. One method is to measure the current at one device and work out the other
currents, and thereby the total current, on the basis of the known current split. The other
method involves using separate control electronics for each power unit capable of determining
the allocated direct current. These currents can then be added together and the resulting values
used elsewhere.
WARNING

Connecting
6.12 Commutating reactors
6.11 Field supply
Power unit field supply
8 : 8 :

D D
* * * *

$. $.
$ 9 . $ 9 .
* *

$. $.
$ 9 . $ 9 .
'6 '6
6KXQW 6KXQW
'6 '6
D D D D
' & ' &

4ILHOGVXSSO\SRZHUXQLW 4ILHOGVXSSO\SRZHUXQLW
Gate cables: Betatherm 145 0.5 mm2, UL

a = Betatherm 145 6 mm2, UL
Figure 6-29 Power unit field supply

Commutating reactors should be dimensioned to produce a short-circuit voltage of between 4%
and 10% (based on the rated field current and taking supply impedance into account).
Local regulations regarding line harmonic distortion need to be observed when selecting
commutating reactors.
Commutating reactor selection list
Table 6-6 Commutating reactors 3ph, rated voltage = 3 AC 400 V/50 Hz or 3 AC 480 V/60 Hz, uk = 4 %
Article number Rated current Inductance Copper Total los‐ SCCR Weight Rated insulation
losses ses voltage
6RX1800-4DK00 13 A AC 2.315 mH 22.8 W 33.1 W 2.0 kA (20 ms) 2.9 kg 600 V

Connecting
losses ses voltage
6RX1800-4DK04 106 A AC 0.278 mH 51.3 W 119.3 W 15 kA (100 ms) 23.9 kg 600 V
losses ses voltage
6RX1800-4FK00 13 A AC 2.779 mH 27.4 W 39.2 W 2.0 kA (20 ms) 2.9 kg 600 V
6RX1800-4FK04 106 A AC 0.333 mH 68.8 W 152.9 W 15 kA (100 ms) 22.3 kg 600 V
losses ses voltage
6RX1800-4GK00 51 A AC 0.832 mH 56.8 W 109.7 W 6.5 kA (100 ms) 13.6 kg 600 V
6RX1800-4GK01 106 A AC 0.399 mH 65.6 W 156.7 W 15 kA (100 ms) 26.4 kg 600 V

Connecting
losses ses voltage
losses ses voltage
6RX1800-4KK00 598 A AC 0.085 mH 388.2 W 562.1 W 55 kA (200 ms) 108.9 kg 1000 V
losses ses voltage
6RX1800-4LK00 789 A AC 0.077 mH 312.0 W 532.1 W 75 kA (200 ms) 205.2 kg 1000 V

Connecting
Table 6-11 Commutating reactors 3ph, rated voltage = 3 AC 950 V/50 Hz, uk = 4 %, operation at 60 Hz and rated current
permissible
losses ses voltage
6RX1800-4MK00 1826 A AC 0.038 mH 534.9 W 1303.5 W 75 kA (200 ms) 399.7 kg 1000 V
Article number Rated current Inductance Weight Rated insulation volt‐

age
6RX1800-4DE00 3 A AC 16.977 mH 0.7 kg 600 V
6RX1800-4DE01 5 A AC 10.186 mH 1.5 kg 600 V
6RX1800-4DE02 10 A AC 5.093 mH 2.0 kg 600 V
6RX1800-4DE03 15 A AC 3.395 mH 2.3 kg 600 V
6RX1800-4DE04 25 A AC 2.037 mH 3.0 kg 600 V
6RX1800-4DE05 30 A AC 1.698 mH 3.8 kg 600 V
6RX1800-4DE06 40 A AC 1.273 mH 5.2 kg 600 V
6RX1800-4DE07 85 A AC 0.599 mH 9.6 kg 600 V
Connections:
3-phase reactors with rated current ≤85 A: Terminal blocks

3-phase reactors with rated current >85 A: Connecting lugs
1-phase reactors with rated current ≤30 A: Terminal blocks
1-phase reactors with rated current >30 A: Connecting lugs
Information
Note
3-phase commutating reactors with uk = 2% can be supplied on request.
For SCCR specifications (time specifications 20 ms): These shutdown times are achieved with the
recommended semiconductor fuses.
Standards, approvals
REACH, ROHS, CE, cULus

Connecting
6.13 Fuses
6.13 Fuses
Field circuit
Table 6-13 Recommended fuses for the field circuit
Max. excitation cur‐ Siemens fuse Bussmann fuse

rent FWP 700V ЯU
A Article number A Order number A
3 5SD420 16 FWP-5B 5
5 5SD420 16 FWP-5B 5
10 5SD420 16 FWP-15B 15
15 5SD440 25 FWP-20B 20
25 5SD440 25 FWP-30B 30
30 5SD480 30 FWP-35B 35
40 3NE1802-0 40 FWP-50B 50
Power interface for the Control Module
Slot Article number Type

F200 6RY1802-0BA00 T 6.3
T6.3 A/250 V
F400 6RY1702-0BA00 T1
T1 A / 250 V
The slot for the fuses can be seen on Figure 6-34 Terminal/connector arrangement on
the"Power interface for the Control Module" (Page 132).

Connecting
6.14 Arrangement of printed circuit boards
6.14 Arrangement of printed circuit boards

① Control Unit (CUD) (Advanced CUD and CUD on the right are options)
② Power interface for the Control Module
③ Firing pulse transformer module
④ Power unit field supply
⑤ Fuse monitoring
⑥ Voltage measurement
Figure 6-30 Arrangement of printed circuit boards

Connecting
6.15 Arrangement of customer connections (connector terminals, Faston mounting tabs)
6.15 Arrangement of customer connections (connector terminals,

Faston mounting tabs)
Module - Control Unit (CUD)
$GYDQFHG&8'ZLWKLQVHUWHG&RQQHFWRU%RDUG 6WDQGDUG&8'ZLWKLQVHUWHG&RQQHFWRU%RDUG
; ;
;
; ;
;
; ;
; ;
; ; ; ; ; ; ; ;

; ;
1 2 3 4 5 6 ;
1 2 3 4 5 6 ;
Figure 6-31 Terminal/connector arrangement on the "Control Unit (CUD)"

Connecting
Allocation Board module
Figure 6-32 Terminal/connector assignment on the "Allocation Board"
Note
Jumper STO to P24 for Functional Safety
The jumper STO to P24 must be removed for use of the safety function and the wiring performed
according to one of the applications in Chapter "Functional safety (Page 671)" with a safety relay.

Connecting
Module - Control Unit (CUD), option G63
$GYDQFHG&8'ZLWKLQVHUWHG&DELQHW%RDUG 6WDQGDUG&8'ZLWKLQVHUWHG&DELQHW%RDUG
; ;
;
; ;
;
;B ;B
; ;
; ;
; ; ; ; ; ; ; ;

; ;
;
;
Figure 6-33 Terminal/connector arrangement on the "Control Unit (CUD)" - option G63

Connecting
"Power interface for the Control Module" module
;7 ;6 ;5 ;/ ;/ ;9 ;9 ;9 ;39

;7

;9 ;7
)
6 6
7$9
6
;1
; ;
;%

;%
;
;%
;
;%
;

;
;%
;%
;% ;
;%
;

;%

;$ ;$
;B,B,67

)
;0

;$
7$9
;)
;

Figure 6-34 Terminal/connector arrangement on the"Power interface for the Control Module"

Connecting
Modules for option G63
;B

;
;
Figure 6-35 Terminal/connector arrangement on the "Cabinet Board"
; ;
;B ;B

Figure 6-36 Terminal arrangement on the "Terminal Module Cabinet (TMC)"
"Voltage measurement" module
9 999
99
;&;';:;9;8
;&;';:;9;8
;&;';:;9;8
;& ;&;& ;(

& ;&
;'
;
;'
' ;';';'
;
;&
: ;:;:
;:
9 ;9;9

;9
9
8 ;8;8
;8 ;(
999 99
Figure 6-37 Terminal/connector arrangement on the "Voltage measurement"

Connecting
"Fuse monitoring" module
99999
;6B ;6B ;6B ;6B ;6B
;6B ;6B ;6B ;6B ;6B

;6B ;6B ;6B ;6B ;6B
;6B ;6B ;6B ;6B ;6B

;%
;6B ;6B ;6B ;6B ;6B

;6B ;6B ;6B ;6B ;6B
;6B ;6B ;6B ;6B ;6B
;6B ;6B ;6B ;6B ;6B

;6B ;6B ;6B ;6B ;6B
;6B ;6B ;6B ;6B ;6B

;6B ;6B ;6B ;6B ;6B
;6B ;6B ;6B ;6B ;6B

99999
Figure 6-38 Terminal/connector arrangement on the "Fuse monitoring"

Connecting
"Firing pulse transformer module"
;B ,03
3 ;;,03 3
,03
3 3 . * ,03 ,03
,03 3
;,03B
;,03B
3 ,03
,03 * 3
,03 . 3
3 ,03
,03 ;,03; 3
3 ,03
,03 ;B 3
3 ;;,03 ,03
,03 3
3 . * ,03
3 ,03
,03 3
3 ,03
,03 * . 3 3
,03
;,03B
;,03B
,03
3 ;,03; ;B 3
,03
3 ,03
;B 3
,03 ;;,03 ,03
3
,03 3 . * ,03 3
3 ,03
,03 3
3 ,03 * . 3 ,03
,03 3
3
;,03; ,03
,03 3
;,03B
;,03B
3 ,03
,03
;;,03 3
3 ,03
3 . * ,03
,03 3
3 ,03
,03 3
,03 * . 3 ,03
3
3
,03 ;,03;
;B
;;,03
3 . * ,03
,03 * . 3
;3$5 ;3$5
;,03;
;;,03
3 . * ,03
,03 * . 3
;$ ;,03; ;$
The following parallel connections are made in each case:

• The terminals with the same names on terminal strips XIMP_1, XIMP_2, and XIMP_3.
• The terminals with the same names on terminal strips XIMP_4, XIMP_5, and XIMP_6.
• X21A and X21PAR, X22A and X22PAR
Figure 6-39 Terminal/connector arrangement on the "Firing pulse transformer module"

Connecting
"Connector Board" module
;
Figure 6-40 Terminal/connector arrangement on the "Connector Board"
"Fuse monitoring distributor" module
;% ;& ;' ;( ;)
;$
Figure 6-41 Connector arrangement on the "Fuse monitoring distributor"

Connecting
6.16 Connector assignment (terminals, Faston mounting tabs, ribbon cables)
"40 A field module"
:
8
& '
;)
;7
Figure 6-42 Terminals/connector arrangement of the "40 A field module"
6.16 Connector assignment (terminals, Faston mounting tabs, ribbon

cables)
NOTICE
Damage or destruction of the device as a result of incorrect connection
Connecting the unit incorrectly can lead to damage or destruction.
Power cables and busbars must be mechanically fastened in place outside of the unit.
NOTICE
Dimensioning the connection cables
The information regarding terminal connection options in the tables below is based on values
from the terminal data sheets. The connecting cables must be dimensioned for the prevailing
currents.

Connecting
Overview
Table 6-14 Terminals and connectors overview
3U1, 3W1, 3C, 3D Field circuit

XP24V Electronics power supply
X21A, X22A Firing module
X23A Fuse monitoring distributor
X23B Fuse monitoring, individual
X45 Voltage measurement
X100, X101 DRIVE-CLiQ
X126 PROFIBUS
X165, X166 Parallel-connection interface
X177 Analog inputs, digital inputs, digital outputs, setpoints, reference voltage (P10/N10), serial
for option G63: interface (peer-to-peer), incremental encoder, analog outputs, temperature sensor
X177_1, X177_2, X177_5
X178, X179 Interface to AOP30, USS interface
XF1 Field module
X_I_IST External current actual value
XB-1 ... XB-8 Current transformer
XL1 Relay output for fan (up to 240 V)
XL2 Fan monitoring
XM Ground
XR1 Relay output for line contactor (up to 240 V)
XS1 Safety shutdown E-STOP
XT1 Analog tachometer
XT5, XT6 Temperature sensors
X200, X201 Functional safety
6.16.1 Connecting the protective conductor

The SINAMICS DCM Control Module has connecting lugs at the side of both cradles to connect
the protective conductor.
In the delivery condition (both cradles assembled), the protective conductor should be
connected to one of these lugs. Minimum cross section 4 mm2.
If the two cradles are installed separately, then a protective conductor must be connected to
both cradles.
Note
If the unit is stored for a longer period of time, a layer of corrosion can form on the bare metal
surfaces of the cradles. Before connecting the protective conductor, this must be removed from
the connection lugs.

Connecting
6.16.2 Field circuit
Table 6-15 Type of terminals for connecting the field circuit
Type 20E/4DS terminal strip

Connection capacity Rigid/flexible (mm2/mm2): 6 - 16 / 6-10
Stripped length 8 mm
Tightening torque 1.5 Nm
Table 6-16 Assignment of the connections for the field circuit
Terminal Function Technical data

3U1, 3W1 Line supply connection 2 AC 400 V (– 20%), 2 AC 480 V (+10%)
3C, 3D Field winding connection 325/373 rated VDC voltage
with 2-ph. 400/480 VAC line connection
6.16.3 Electronic power supply
Table 6-17 Terminal type, electronics power supply
Type Wago 256 spring-loaded terminal

Connection capacity 0.08 … 2.5 mm2, AWG 18-12
Stripped length 5 - 6 mm
Table 6-18 Assignment of terminals for the electronics power supply

XP24V
+ 24 V infeed 18 V to 30 VDC; current consumption 1 A ... 5 A
- Recommended conductor cross-section 1.5 mm2
Internal protection with F200 fuses (6.3 A, time-lag. See Chapter “Fuses
(Page 127)”),
external protection 6 A ... 16 A, B or C characteristic
6.16.4 Open-loop and closed-loop control section
Table 6-19 Terminal type, open-loop and closed-loop control section
X177, X177_5 (for option G63):

Type SPT 1.5 spring-loaded terminal

Connecting
Connection capacity Rigid/flexible/conductor sizes (mm2/mm2/AWG): 0.2 - 1.5 / 0.2 - 1.5 / 24 - 16

flexible with ferrule with/without plastic sleeve:
0.25 - 1.5 / 0.25 - 0.75 mm2 (stripped length 8 mm)
X177_1, X177_2 (for option G63):
Type Two-tier terminal with spring-loaded terminal PK 68
Connection capacity rigid / flexible 0.5 - 2.5 mm2
X178, X179:
Type FMC 1.5 plug-in terminal
flexible with ferrule with/without plastic sleeve: 0.25 - 1.5 / 0.25 - 0.75 mm2
XR1, XS1, XT1:
Type MSTB 2.5/CIF plug-in terminal
flexible with ferrule with/without plastic sleeve: 0.25 - 2.5 / 0.25 - 2.5 mm2
Tightening torque 0.5 - 0.6 Nm
X126:
Type Submin D, 9-pin
X100, X101:
Type Modular jack 8/4 (RJ45)
XB-1... XB-8, X_I_IST, XM:
Connection capacity 0.08 - 2.5 mm2, AWG 18 - 12
XT5, XT6:
Type Faston connecting tabs, 2.8 × 0.8 mm
6.16.4.1 Terminals on the Connector Board

See also Chapter "Inputs/outputs (Page 371)".
Table 6-20 Assignment, terminal X177
Terminal Function Technical specifications

X177
Analog inputs (assignable inputs)
1 AI 3 + Analog input 3 Input type (signal type):
2 AI 3 - Differential input ±10 V; 150 kΩ
3 AI 4 + Analog input 4 Resolution approx. 5.4 mV (±11 bits)
4 AI 4 - Common-mode controllability: ±15 V
5 AI 5 + Analog input 5
6 AI 5 -
7 AI 6 + Analog input 6
8 AI 6 -

Connecting

X177
Digital inputs (assignable inputs)
9 24 V 24 V supply (output) 24 V DC, short-circuit proof
10 DC max. Load 200 mA (terminals 9 and 10 together),
internal supply referred to internal ground
11 DI 0 Digital input 0 H signal: +15 V to +30 V
12 DI 1 Digital input 1 L signal: –30 V to +5 V or terminal open
8.5 mA at 24 V
13 DI 2 Digital input 2
14 DI 3 Digital input 3
Digital inputs/outputs (assignable inputs/outputs)
15 DI/ Digital input Type, input/output can be parameterized
DO 4 /output 4 Features, inputs:
16 DI/ Digital input H signal: +15 V to +30 V
DO 5 /output 5 L signal: 0 V to +5 V or terminal open
8.5 mA at 24 V
17 DI/ Digital input
DO 6 /output 6 Features, outputs:
H signal: +20 V to +26 V
18 DI/ Digital input L signal: 0 to +2 V
DO 7 /output 7 short-circuit proof; max. current carrying capacity: 100 mA per DO;
max. total load of all DO (CUD left X177:15-22 + CUD right
X177:15-22): 800 mA
internal protection circuit (freewheeling diode)
If overload occurs: alarm A60018
19 DO 0 Digital output 0 H signal: +20 V to +26 V
20 DO 1 Digital output 1 L signal: 0 to +2 V
short-circuit proof; max. current carrying capacity: 100 mA per DO;
21 DO 2 Digital output 2 max. total load of all DO (CUD left X177:15-22 + CUD right
22 DO 3 Digital output 3 X177:15-22): 800 mA
23, 24 M Ground, digital internal protection circuit (freewheeling diode)
If overload occurs: alarm A60018
Analog inputs, setpoint inputs (assignable inputs)
25 AI 0 + Analog input 0 Input type (signal type), parameterizable:
26 AI 0 - Main setpoint - Differential input ±10 V; 150 kΩ
27 AI 1 + Analog input 1 - Current input 0 - 20 mA; 300 Ω or 4 - 20 mA; 300 Ω
28 AI 1 - Resolution approx. 0.66 mV (±14 bits)
Common-mode controllability: ±15 V
29 AI 2 + Analog input 2 Input type (signal type):
30 AI 2 - Differential input ±10 V; 150 kΩ
Resolution approx. 0.66 mV (±14 bits)
Common-mode controllability: ±15 V
Note:
An external armature voltage actual value can also be connected at this
input. See function diagram 6902 in the SINAMICS DCM List Manual.
Reference voltage
31 P10 Reference voltage ±10 V Tolerance ±1% at 25° C
32 N10 (output) Stability 0.1% per 10° K
33, 34 M Ground, analog 10 mA short-circuit proof
Serial interface, peer-to-peer RS485
35, 36 M Ground, digital

Connecting

X177
37 TX+ Send cable + 4-wire send cable, positive differential output
38 TX- Send cable - 4-wire send cable, negative differential output
39 RX+ Receive cable + 4-wire receive cable, positive differential output
40 RX- Receive cable - 4-wire receive cable, negative differential output
Pulse encoder input
41 Pulse encoder supply +13.7 to +15.2 V, 300 mA short-circuit proof (electronically protected)If
42 Ground, pulse encoder overload occurs: Fault message F60094
43 Track 1+ Load: ≤ 5.25 mA at 15 V (without switching losses)
Incremental signal A Pulse duty factor: 1:1
44 Track 1- See below for data relating to cables, cable length, shield support, input
Inverse incremental signal A* pulse levels, hysteresis, track displacement, and pulse frequency.
45 Track 2+
Incremental signal B
46 Track 2-
Inverse incremental signal B*
47 Zero mark+
Reference signal R
48 Zero mark-
Reference signal R*
Analog outputs (assignable outputs)
49 AO 0 Analog output 0 ±10 V, max. 2 mA short-circuit proof, resolution ±15 bits
50 M Ground, analog
51 AO 1 Analog output 1
52 M Ground, analog
Connections for temperature sensor (motor interface 1)
53 Temp 1 Connect the sensor according to p50490 (see SINAMICS DCM List Man‐
54 Temp 2 (sense cable) ual). The cable to the temperature sensor at the motor must be shiel‐
ded, the shield must be connected to ground at both ends.
55 Temp 3 The cables for the Temp 1 and Temp 3 connections to the temperature
sensor must be approximately the same length.
The sense line (Temp 2) is used to compensate cable resistances; if a
sense line is not used, then terminals 54 and 55 must be directly con‐
nected at the CUD.
Connection with/without sense cable:
VHQVH
; ;
7HPS7HPS7HPS7HPS7HPS7HPS
56 M Ground, analog
Connector board module

Connecting
6.16.4.2 Using a pulse encoder with SINAMICS DCM

The supported encoder types are listed in Chapter "Encoder evaluation (Page 546)" or in the
description of parameter p0400 in the SINAMICS DCM List Manual. The abbreviations used are
described in Appendix A.2.
Note
Pulse encoder evaluation via terminals X177.41 to 48 does not support any SSI encoders.
A Sensor Module Cabinet-Mounted SMC30 is required for evaluating SSI encoders, see Chapter
"Additional system components (Page 169)".
NOTICE
Selecting the encoder type with p0400 does not result in any changes to the supply
voltage for the pulse encoder (terminals X177.41 and 42).
Terminal X177.41 always supplies +15 V. An external power supply is required for pulse
encoders with other supply voltages (e.g. +5 V).

Connecting
Characteristic values for the pulse encoder evaluation electronics

• Input pulse levels
Encoder signals (symmetrical/asymmetrical) up to a maximum of 27 V differential voltage
can be processed by the evaluation electronics.
The encoder type is selected using p0400.
The evaluation electronics are adjusted electronically to the encoder signal voltage:
Encoder type TTL HTL

Rated input voltage 5V 15 V
Low signal level (differential voltage) < 0.8 V < 5.0 V
High signal level (differential voltage) > 2.0 V > 8.0 V
Hysteresis > 0.2 V > 1.0 V
Common-mode controllability ±10 V ±10 V
If the pulse encoder does not supply any symmetrical encoder signals, it must be grounded
with each signal cable twisted in pairs and connected to the negative connections of track 1,
track 2, and zero mark.
• Switching frequency
The maximum frequency of the encoder pulses is 300 kHz. To ensure the encoder pulses are
evaluated correctly, the minimum distance (Tmin) between two encoder signal edges (track
1, track 2), as listed in the table, must be adhered to.
Encoder type TTL HTL

Rated input voltage 5V 15 V
Differential voltage 1)
2V > 2.5 V 8V 10 V > 14 V
Tmin 2) 630 ns 380 ns 630 ns 430 ns 380 ns
1)
Differential voltage at the terminals of the evaluation electronics
2)
The phase error LG (deviation from 90°) that may occur as a result of the encoder and cable can be
calculated on the basis of Tmin:
LG = ± (90° – fp × Tmin × 360°)
LG = phase fault
fp = pulse frequency
Tmin = minimum edge clearance
This formula only applies if the pulse duty factor of the encoder signals is 1:1.
If the pulse encoder is incorrectly matched to the encoder cable, disturbing cable reflections
will occur at the receiving end. To ensure that encoder pulses of this type can be evaluated
without errors, these reflections need to be damped. The limit values listed in the table below
must be adhered to in order to prevent the resulting power losses in the evaluation
electronics adaptor from being exceeded.
fmax 50 kHz 100 kHz 150 kHz 200 kHz 300 kHz
Differential voltage 1)
≤ 27 V ≤ 22 V ≤ 18 V ≤ 16 V ≤ 14 V
1)
Differential voltage of the encoder pulses without load
(approximately corresponds to the pulse encoder supply voltage)
• Cable, cable length, shield support
The capacitance of the encoder cable must be recharged at each encoder edge change.
The rms value of this current is proportional to the cable length and pulse frequency, and
must not exceed the current permitted by the encoder manufacturer. A suitable cable that
meets the recommendations of the encoder manufacturer must be used, and the maximum

Connecting
cable length must not be exceeded.

Generally, a twisted conductor pair with shared shielding for the pairs is sufficient for each
track.
This reduces mutual interference and crosstalk between the conductors/cables. Shielding all
the pairs provides protection against interference pulses. The shield should be connected to
the SINAMICS DCM shield support over a large area.
Connecting a pulse encoder
WARNING
Electric shock due to unconnected cable shields
cable shields.
• Attach the cable shield to the component via terminals for the encoder system connection.
Note
Because the physical transmission media is more robust, the bipolar connection should always
be used.
The unipolar connection should only be used if the encoder type does not output push-pull
signals.
Also for a unipolar connection, the encoder ground should also be routed in the signal cable.
Signal cables with twisted conductor pairs should be used to improve protection against
induced disturbances.
Connection examples
HTL encoder with reference signal, bipolar connection
;
8E 3 3XOVHHQFRGHUSRZHUVXSSO\9
0
0 3XOVHHQFRGHUJURXQG
.
7UDFN ,QFUHPHQWDOVLJQDO$
. 7UDFN ,QYHUVHLQFUHPHQWDOVLJQDO$
.
7UDFN ,QFUHPHQWDOVLJQDO%
. 7UDFN ,QYHUVHLQFUHPHQWDOVLJQDO%
.
=HURPDUN 5HIHUHQFHVLJQDO]HURPDUN5
. =HURPDUN ,QYHUVHUHIHUHQFHVLJQDO]HURPDUN5
Figure 6-43 Connection example, HTL encoder with reference signal, bipolar connection

Connecting
HTL encoder with reference signal, unipolar connection including the encoder ground
;
0
.
7UDFN ,QYHUVHLQFUHPHQWDOVLJQDO$
.
7UDFN ,QYHUVHLQFUHPHQWDOVLJQDO%
.
=HURPDUN ,QYHUVHUHIHUHQFHVLJQDO]HURPDUN5
Figure 6-44 Connection example, HTL encoder with reference signal, unipolar connection with encoder ground routed in
the cable
HTL encoder with reference signal, unipolar connection without the encoder ground
;
0
.
7UDFN ,QYHUVHLQFUHPHQWDOVLJQDO$
.
7UDFN ,QYHUVHLQFUHPHQWDOVLJQDO%
.
=HURPDUN ,QYHUVHUHIHUHQFHVLJQDO]HURPDUN5
Figure 6-45 Connection example, HTL encoder with reference signal, unipolar connection without the encoder ground
6.16.4.3 Assignment of electronics terminals at the Power Interface
Terminals at the power interface
Table 6-21 Terminals XR1, XS1, XT1, XL1, XL2, XM, X_I_IST, XB

Analog tachometer XT1
XT1-103 Tachometer connection ±270 V
8 to 270 V Input resistance 159 kΩ
XT1-104 Ground, analog M Resolution ±14 bits
Safety shutdown E-STOP XS1
XS1-105 Input (switch) Ie = 20 mA
XS1-106 Supply (output) 24 VDC, max. load 1 A, short-circuit proof
Floating relay outputs XR1, XL1

Connecting

XR1-109 Relay for line contactor Current carrying capacity:
XR1-110 ≤ 250 V AC, 4 A; cosφ = 1
XL1-120 Relay for fan contactor ≤ 250 V AC, 2 A; cosφ = 0.4
XL1-121 ≤ 30 V DC, 2 A
Max. 4 A external protection, C characteristic recommended
Monitoring inputs XL2
XL2-122 + Fan monitoring Differential inputs
XL2-123 - (fault F60267) max. Input voltage ±50 V
Configuration with p51832 Common mode range -2 V to +50 V
L signal:<8 V, H signal: >11 V
XL2-124 + External monitoring
input resistance 30 kΩ
XL2-125 - (fault F60203)
switchable resistances 1.8 kΩ:
Configuration with p51833

N˖ N˖
6 6

Electronics ground
XM-M Electronics ground
XM-M
Actual current value X_I_IST
I_I_IST Actual current value Input for external actual current value
M_I_IST Ground reference for actual cur‐ Analog 0 ... -10 V
rent value
Current transformer connections XB
XB1 Current transformer T1 - k1 Configuration of current transformers in accordance with p51824
XB2 Current transformer T1 - l1
M_BUERDE
M_BUERDE
XB4 Current transformer T2 - k2
XB5 Amplifier output from T3 Configuration of current transformers in accordance with p51824
XB6 M_BUERDE
M_BUERDE
XB8 Current transformer T3 - k3

Connecting
6.16.4.4 Serial interface to AOP30/USS interface
Arrangement of terminals X178 and X179
&8'
1 2 3 4 5 6
;
1 2 3 4 5 6 ;
Figure 6-46 Arrangement X178 and X179
Table 6-22 Terminal X178
Terminal X178 Function Technical specifications

1 Supply (output) 24 VDC short-circuit proof, maximum load 200 mA
Internal supply related to internal ground terminal
2 Ground, AOP M
3 RX+/TX+ Send and receive cable, RS485, two-wire
Positive differential input/output
4 RX-/TX- Send and receive cable, RS485, two-wire
Negative differential input/output
5 Ground, digital M
6 Ground, digital M
"Control Unit (CUD)" module
Table 6-23 Terminal X179
Terminal X179 Function Technical specifications

1 Supply (output) 4.4 to 5.4 VDC short-circuit proof, maximum load 300 mA
Internal supply related to internal ground terminal
2 Ground, digital M
3 TXD1 Send cable, RS232 standard (V.24)
4 RXD1 Receive cable, RS232 standard (V.24)
5 TXD2 Send cable, RS232 standard (V.24)
6 RXD2 Receive cable, RS232 standard (V.24)
Note
Only one of the two interfaces - RS485 (X178-3, 4) or RS232 (X179-3, 4) - may be used.

Connecting
6.16.4.5 PROFIBUS connection
Table 6-24 PROFIBUS connector assignment
Connector Pin Signal name Technical specifications

X126
1 - Not assigned
1 2 - Not assigned
3 RxD/TxD-P RS485 receive/transmit data P (B)
4 CNTR-P Control signal (TTL)
5 DGND PROFIBUS data ground
9 6 VP Positive supply voltage (5 V +/-10%)
7 - Not assigned
8 RxD/TxD-N RS485 receive/transmit data N (A)
9 - Not assigned
6.16.4.6 DRIVE-CLiQ connection
Table 6-25 DRIVE-CLiQ connector assignment

X100, X101
1 TXP Transmit data +
2 TXN Transmit data -

3 RXP Receive data +
4 - Reserved, do not use
6 RXN Receive data -
- Shield Permanently connected to ground
"Advanced CUD" module

Connecting
6.16.4.7 Parallel interface
Table 6-26 Connector assignment, parallel interface

X165, X166
1 SYNC_P Synchronization +
2 SYNC_N Synchronization -

3 CANH CAN +
6 CANL CAN -
- Shield Permanently connected to ground
Standard CUD, Advanced CUD module
6.16.4.8 Terminal assignment for option G63

The technical data for terminals X177_1, X177_2 and X177_5 corresponds to the specifications
for terminal X177 on the Connector Board in the version without option G63, see Table 6-20
Assignment, terminal X177InputsOutputs (Page 140).
Table 6-27 Assignment of the terminals on the Terminal Module Cabinet (TMC) (overview)
Terminal Function Description

X177_1, X177_2
1st terminal block (X177_1)
1, 2 AI 3 +, AI 3 - Analog input 3 See X177.1 and 2
9, 10 24 VDC 24 V supply (output) 24 VDC, short-circuit proof
Max. load 200 mA (terminals 9, 10, 57, 58, 59 and 60
combined),
internal supply to digital ground and analog ground
11, 12, 13, 14 DI 0, 1, 2, 3 Digital input 0, 1, 2, 3 See X177.11, 12, 13, 14
15, 16, 17, 18 DI/DO 4, 5, 6, 7 Digital input/output 4, 5, See X177.15, 16, 17, 18
6, 7
19, 20, 21 22 DO 0, 1, 2, 3 Digital output 0, 1, 2, 3 See X177.19, 20, 21, 22, 23, 24
23, 24 M Ground, digital
25, 26 AI 0 +, AI 0 - Analog input 0, main set‐ See X177.25 and 26
point

Connecting

X177_1, X177_2
31, 32 P10, N10 Reference voltage ±10 V See X177.31, 32, 33, 34
(output)
33, 34 M Ground, analog
2nd terminal block (X177_2)
35, 36 M Ground, digital See X177.35 and 36
37, 38 RS485: TX+, TX- Send cable +, - See X177.37 and 38
39, 40 RS485: RX+, RX- Receive cable +, - See X177.39 and 40
41, 42 Pulse encoder supply See X177.41 and 42
43, 44 Pulse encoder track 1 +/- See X177.43 and 44
45, 46 Pulse encoder track 2 +/- See X177.45 and 46
47, 48 Pulse encoder zero mark +/- See X177.47 and 48
49, 50 AO 0, M Analog output 0, analog See X177.49 and 50
ground
51, 52 AO 1, M Analog output 1, analog See X177.51 and 52
ground
53, 54, 55 Temp 1, 2, 3 Temperature sensor, mo‐ See X177.53, 54, 55
tor interface 1
56 M Ground, analog See X177.56
57, 58, 59, 60 24 VDC 24 V supply (output) 24 VDC, short-circuit proof
Max. load 200 mA (terminals 9, 10, 57, 58, 59 and 60
combined),
internal supply to digital ground and analog ground
61, 62, 63, 64 M Ground, digital -
"Terminal Module Cabinet (TMC)" module
Table 6-28 Assignment of the terminals on the Cabinet Board (overview)

X177_5
33, 34 M Ground, analog -
35, 36 M Ground, digital See X177.35 and 36
37, 38 RS485: TX+, TX- Send cable +, - See X177.37 and 38
39, 40 RS485: RX+, RX- Receive cable +, - See X177.39 and 40
"Cabinet Board" module
Note:
The terminals on X177_5 are connected in parallel to the terminals with the same name on the Terminal Module Cabinet (TMC).

Connecting
6.16.4.9 Connectors at the power interface
Table 6-29 Connectors XT5, XT6

Temperature sensor input (XT5)
XT5-1 Electronics ground GND Sensor according to p51830[0...2]
XT5-3 Heat sink temperature
Temperature sensor input (XT6)
XT6-1 Electronics ground GND Sensor according to p51830[0...2]
XT6-3 Heat sink temperature
Zero calibration of actual current value measurement (XN1)
XN1 Infeed point for zero calibration See Chapter "Measurement of the armature current (Page 109)"
Ground (X600)
X600 Ground, e.g. for zero calibration via
XN1
Soldering lugs for load resistor R701 (X701, X702)
X701 Connection to XB-1
6.16.4.10 CompactFlash Card slot
Figure 6-47 "Control Unit (CUD)" module, memory card slot

Connecting
NOTICE
Undesirable response or data loss if the memory card is improperly handled
• The memory card may only be inserted as shown in the previous figure.
• For disturbance-free operation of the control electronics (CUD), the memory card
recommended by Siemens must only be inserted in the device when the SINAMICS DCM is
switched-off and in a no voltage condition. Inserting the card when operational can result in
undefined states of the device with the corresponding effects.
• The memory card must not be removed or inserted while data is being saved. For the
procedure to safely remove the memory card, see Chapter "Memory card functions
(Page 329)".
• When returning a defective "Control Unit (CUD)" module, do not return the memory card
along with it – instead, keep it in a safe place so that you can use it in the replacement
module.
• To avoid data loss when removing the memory card, it must be logged off from the device
as described in Section "Safely removing the memory card".
A memory card is not required for the standard drive operation.

The memory card is required for the following applications:
• Saving parameters
Parameters are saved on the memory card and can simply be copied onto a new CUD if it
needs to be replaced.
• Firmware update
It is easy to perform a firmware update using a memory card.
• Loading additional languages to the Advanced Operator Panel AOP30 (with the exception of
German, English and Chinese)
• Performing an offline long-time trace. See also Chapter "Diagnostic memory (Page 605)".
• Loading the DCC block library into the drive
• For communication via Modbus TCP (see Chapter "Communication via MODBUS TCP
(Page 517)").
The memory card must remain inserted at all times.
• For the SINAMICS Link function (see Chapter "Communication via SINAMICS Link
(Page 484)").
The memory card must remain inserted at all times.
• Saving the Diagstor.spd diagnostics file to the \USER\SINAMICS\DATA\LOG directory. See also
Chapter "Trend recorder function (Page 606)".

Connecting
6.16.5 Voltage measurement equipment

Connection type: Faston mounting tabs, 4.8 mm
Table 6-30 Voltage measurement connections
Connection Function Technical data, comments

XU1 Measurement of the line voltage Rated line voltage (armature) >575 V to 1000 V
XV1 Phases U-V-W (p51821 = 1,000)
XW1 (1000 V)
XC1 Measurement of the armature Rated line voltage (armature) >575 V to 1000 V
XD1 voltage (p51821 = 1,000)
(1000 V)
XV2 Phases U-V-W (p51821 = 575)
XW2 (575 V)
XD2 voltage (p51821 = 575)
(575 V)
XV3 Phases U-V-W (p51821 = 250)
XW3 (250 V)
XD3 voltage (p51821 = 250)
(250 V)
XV4 Phases U-V-W (p51821 = 125)
XW4 (125 V)
XD4 voltage (p51821 = 125)
(125 V)
XU5 Measurement of the line voltage Rated line voltage (armature) >5.6 V to 50 V
XV5 Phases U-V-W (p51821 = 50)
XW5 (50 V)
XC5 Measurement of the armature Rated line voltage (armature) >5.6 V to 50 V
XD5 voltage (p51821 = 50)
(50 V)
XU6 Measurement of the line voltage Rated line voltage (armature) ≤5.6 V
XV6 Phases U-V-W (p51821 = 6)
XW6 (5.6 V)
XC6 Measurement of the armature Rated line voltage (armature) ≤5.6 V
XD6 voltage (p51821 = 6)
(5.6 V)
"Voltage measurement" module

Connecting
6.16.6 Fuse monitoring equipment

Connection type: Faston mounting tabs, 4.8 mm
Table 6-31 Connections for fuse monitoring equipment

XS1_1 Fuse 1 Measurement cables for the fuses to be monitored at a rated line voltage
XS2_1 (1000 V) >575 V to 1000 V*)
XS3_1 Fuse 2 Resistance between two associated connections: 388.4 kΩ **)
XS4_1 (1000 V)
XS5_1 Fuse 3
XS6_1 (1000 V)
XS7_1 Fuse 4
XS8_1 (1000 V)
XS9_1 Fuse 5
XS10_1 (1000 V)
XS11_1 Fuse 6
XS12_1 (1000 V)
XS2_2 (575 V) >250 V to 600 V*)
XS4_2 (575 V)
XS5_2 Fuse 3
XS6_2 (575 V)
XS7_2 Fuse 4
XS8_2 (575 V)
XS9_2 Fuse 5
XS10_2 (575 V)
XS11_2 Fuse 6
XS12_2 (575 V)
XS2_3 (250 V) >125 V to 250 V*)
XS4_3 (250 V)
XS5_3 Fuse 3
XS6_3 (250 V)
XS7_3 Fuse 4
XS8_3 (250 V)
XS9_3 Fuse 5
XS10_3 (250 V)
XS11_3 Fuse 6
XS12_3 (250 V)

Connecting

XS2_4 (125 V) >50 V to 125 V*)
XS4_4 (125 V)
XS5_4 Fuse 3
XS6_4 (125 V)
XS7_4 Fuse 4
XS8_4 (125 V)
XS9_4 Fuse 5
XS10_4 (125 V)
XS11_4 Fuse 6
XS12_4 (125 V)
XS2_5 (50 V) = 10 V to 50 V*)
XS4_5 (50 V)
XS5_5 Fuse 3
XS6_5 (50 V)
XS7_5 Fuse 4
XS8_5 (50 V)
XS9_5 Fuse 5
XS10_5 (50 V)
XS11_5 Fuse 6
XS12_5 (50 V)
*) The fuse monitoring equipment is generally connected to the armature current circuit, although it can also be used for the
field circuit, fan circuit, or the primary circuit of a heavy-current transformer. The connections used for the fuse monitoring
depend on the voltage that is present at a fuse that has ruptured.
**) This resistor is in parallel with the fuse. A bridge rectifier is connected in series to this resistor; this means that the specified
value cannot be correctly measured using a commercially available ohmmeter.
"Fuse monitoring" module
Activating/deactivating fuse monitoring using p51831 (0=OFF, 1=ON).
6.16.7 Firing pulse transformers
Table 6-32 Terminal type, firing pulse module
XIMP_1 to XIMP_26, X11 to X26

Connection capacity 0.08 … 2.5 mm2, AWG 18-12
X12_1, X14_1, X15_1, X16_1, X25_1
Type Faston mounting tabs, 6.3 mm

Connecting
The P24 on the "Power interface for the Control Module" is protected by F400 fuses (1 A,
time-lag).
Table 6-33 Firing pulse module connections
Terminal, con‐ Function Technical data, comments

nection
XIMP_1 control for firing pulse transformers for the thyristors
IMP11 For thyristor V11 If the firing pulse transformer module is divided up (please refer to the
P24 section titled "Removal/Installation and division of modules"), the con‐
IMP12 For thyristor V12 trols for the firing pulse transformers must be routed via these terminal
P24 connections.
IMP13 For thyristor V13 This involves making the following connections:
P24 XIMP_1 - IMP11 → XIMP11 - IMP11 (for thyristor V11)
IMP14 For thyristor V14 XIMP_1 - P24 → XIMP11 - P24 (for thyristor V11)
P24
etc.
IMP16 For thyristor V16
P24
XIMP_2
Same as XIMP_1
The terminals on terminal strip XIMP_2 are parallel to the terminals on terminal strip XIMP_1 with the same name.
XIMP_3
Same as XIMP_1
XIMP_4 control for firing pulse transformers for the thyristors
IMP21 For thyristor V21 If the firing pulse transformer module is divided up (please refer to the
P24 section titled "Removal/Installation and division of modules"), the con‐
IMP22 For thyristor V22 trols for the firing pulse transformers must be routed via these terminal
P24 connections.
IMP23 For thyristor V23 This involves making the following connections:
P24
etc.
IMP26 For thyristor V26
P24
XIMP_5
Same as XIMP_4
XIMP_6
Same as XIMP_4
XIMP11 control for firing pulse transformers for the thyristors
IMP11 For thyristor V11 Only to be connected if the firing pulse transformer module is divided up
P24 (see terminal strip XIMP_1)

Connecting

nection
X11
G, K Firing cable, thyristor V11 Firing pulse (see below) gate (G) to auxiliary cathode (K)
X12
X13
X14
X15
X16
X21
X22
X23

Connecting

nection
X24
X25
X26
Outputs for voltage measurement
X12_1 Armature line voltage W When the firing cables are connected to the thyristors in the power unit,
X14_1 Armature line voltage U the line and armature voltages are automatically present at the firing
pulse transformer module.
X15_1 Armature voltage 1C1 These voltages can then be routed from here (connections X12_1, etc.) to
X16_1 Armature line voltage V the voltage measurement equipment, without having to route any addi‐
X25_1 Armature voltage 1D1 tional cables to the power unit.
See also Chapter "Connecting the external power unit".
"Firing pulse transformer module"
6.16.8 Firing pulse

Time sequence
The time sequence for firing pulses is set via parameter p51826:
p51826[0] Length of first pulse (factory setting = 50 µs)

p51826[1] Length of other pulses (factory setting = 35 µs)
p51826[2] Length of pause (factory setting = 70 µs)
Notes
• If p51826[0] = 105 or p51826[1] = 105: Block pulse (without pulse chopping)
• If p51826[0] ≤ p51826[1] is set, p51826[0] will be ignored and the first pulse will have the
same length as all the other pulses.
• p50079 is used for short pulse/long pulse selection.
p50079 = 0 Short pulses, pulse length 890 µs

p50079 = 1 Long pulses, pulse duration up to approx. 0.1 ms before the next pulse

Connecting
ุwV wV DSSUR[GHJUHHVDW+]
S>@ S>@
S>@
Figure 6-48 Firing pulse - time sequence
The pulse shape of the current depends on the length of the cable to the thyristor (cathode/
gate). Cable inductance causes the rising edge of the current pulse to become slower as the
cable length increases.
Relationship between firing current and output voltage (incl. tolerances):
8>9@ ① normal working range of thyristors is from 1 to

4.2 V

No-load voltage = 7.8 to 8.4 V

Short-circuit current = 1.15 to 1.25 A

,>$@
Application
The firing condition for the thyristor used (minimum firing current) must be to the left of
the firing circuit characteristic. The firing current can be determined graphically by finding
the point at which the thyristor's input characteristic intersects with the firing circuit's output
characteristic. It is important to remember that the thyristor's gate/cathode voltage drop
increases as the temperature decreases.
Examples of oscillograms
Firing voltage = gate/cathode voltage with 1 m twisted cable from the firing current circuit to
the thyristor's gate connection

Connecting

$ %
A Substitution load 20 Ω in parallel with 2 diodes

B Substitution load 20 Ω in parallel with 4 diodes
① Control signal
② Voltage at load (0.5 V/div)
③ Current through load (0.5 A/div)
Figure 6-49 Firing pulse - oscillograms

Connecting
6.16.9 Ribbon cables
Firing pulse cable, torque direction 1, connectors X21A/X21PAR
Table 6-34 Assignment X21A, X21PAR
Function Pin Signal name Connection values / com‐

ments
Free 1
Free 2
Free 3
Electronics ground 4 M
Thyristor firing pulse, armature 2 5 IMP_12 24 V / 2 A pulse
24 V supply, firing 6 P24_Z 24 VDC / 2 A
Actual current value 23 I_IST analog ±10 V
Ground reference for actual current value 24 M_I_IST analog ±10 V
Electronic grounds 25 M
Free 26
Modules: "Power interface for the Control Module" / "Firing pulse transformer module"
Connectors X21A and X21PAR are connected in parallel on the firing pulse transformer module,
except for I_IST (pin 23) and M_I_IST (pin 24)
Ribbon cable, 26 pole

Connecting
Firing pulse cable, torque direction 2, connectors X22A/X22PAR
Table 6-35 Assignment X22A, X22PAR

ments
Free 1
Free 2
Free 3
Free 23
Free 24
Free 26
Modules: "Power interface for the Control Module" / "Firing pulse transformer module"
Connectors X22A and X22PAR are connected in parallel on the firing pulse transformer module

Connecting
Power interface connecting cable - fuse monitoring equipment
Table 6-36 Assignment X23B

ments
24 V supply 1 P24 22...26 V
24 V supply 2 P24 22...26 V
Fuse monitoring 3 SICHERUNG_OK 24 V logic
Ground 9 M
Ground 10 M
"Power interface for the Control Module" / "Fuse monitoring or fuse monitoring distributor"

Connecting
Table 6-37 Assignment X23A

ments
24 V supply 1 P24 22...26 V
24 V supply 2 P24 22...26 V
Ground 33 M
Ground 34 M
Modules: "Power interface for the Control Module" / "Fuse monitoring distributor"

Connecting
Power interface connecting cable - voltage measurement equipment
Table 6-38 Assignment X45

ments
RS485 signal data + 1 ANKER_RS485_SP
RS485 signal data - 2 ANKER_RS485_SN
3.3 V supply 3 P3V3 3.3 V
RS485 signal direction + 4 ANKER_RS485_DP
RS485 signal direction - 5 ANKER_RS485_DN
Ground 6 M
16 VAC supply 7 HF16_1 ±16 V HF
16 VAC supply 8 HF16_2 ±16 V HF
Modules: "Power interface for the Control Module" / "Voltage sensing"
CAT5 cable, 8 pole
Power interface connecting cable - field supply
Table 6-39 Assignment XF1

ments
16 VAC supply 2 HF16_1 ± 16 V HF
16 VAC supply 3 HF16_2 ± 16 V HF
Thyristor firing pulse, field 1 5 IMP_F1 CMOS 5 V
Thyristor firing pulse, field 2 7 IMP_F2 CMOS 5 V
RS485 signal data + 9 ANKER_RS485_SP
RS485 signal data - 10 ANKER_RS485_SN
3.3 V supply 11 P3V3 3.3 V
RS485 signal direction + 12 ANKER_RS485_DP
RS485 signal direction – 13 ANKER_RS485_DN
+24 V firing supply 15 P24_ZV 22...26 V
+24 V firing supply 16 P24_ZV 22...26 V
Heat sink temperature sensor 18 KK_TEMP_FELD analog
Modules: "Power Interface for the Control Module" / "Power unit field supply"

Connecting
6.16.10 Assignment of the RS485 cable to the AOP30
Note
A 24 V power supply is required to operate the AOP30. For a maximum cable length of 50 m, this
can be taken from the CUD of the SINAMICS DCM. An external power supply must be used for
cable lengths > 50 m.

$23 ; 5;7;

5;7; ; &8'
5;7; 5;7;

*URXQG *URXQG

'&9

; *URXQG

$23 ; 5;7;

5;7; ; &8'

5;7;
5;7;

*URXQG *URXQG

'&9
; *URXQG

5;7; ; &8'

5;7;

*URXQG

'&9

$23 ; 5;7; 5;7; ; &8'

5;7; 5;7;

*URXQG *URXQG
2
; *URXQG
1 9H[WHUQDO

① RS485 cable with 24 V DC power supply from the CUD - max. 50 m

② RS485 cable when operating with 2 CUDs, 24 V DC power supply from one CUD - max. 50 m
③ RS485 cable when supplying the AOP30 from an external 24 V DC source - max. 200 m
X524 Plug terminals X178 Plug terminals
X540 9-pin Sub-D socket
Figure 6-50 Assignment, RS485 cable

Connecting
6.16.11 Terminal assignment functional safety
Table 6-40 Terminal type functional safety
X200, X201:
Type PUSH IN connecting terminal LMF 5.08
Clamping range min. 0.12 - 2.5 mm² / AWG 26 - AWG 12
Connection capacity Rigid/flexible/conductor sizes (mm²/AWG): 0.2 - 2.5 / 26 - 12, with ferrule: 0.25 ... 2.5 mm²
Connection system PUSH IN screwdriver blade 0.6 x 3.5 mm according to DIN 5264 standard
Table 6-41 Assignment of customer terminals on Allocation Board (overview)
Terminal Function / Labeling Technical specifications

X200-1 P24 Output 20 to 26 V, short-circuit proof
can be continuously loaded up to 30 mA
Used for supplying X200-2, if STO is not used.
X200-2 STO Input (both terminals are connected)
X200-3 STO H signal (no STO): +15 V to +30 V, input current 2 mA (typical)
L signal (STO): -30 V to +5 V or terminal open;
Leakage current maximum 0.5 mA
Maximum cable length: 30 m
The input must be fed from an SELV‑/PELV power supply with a maximum
output voltage of 60 V DC.
Test pulses are not permitted.
X201-1 RM2 Feedback signal contact "STO active" for a safety relay
X201-2 RM1 The contact is closed if STO is active.
Rated voltage 24 V, maximum current load 200 mA, leakage current max‐
imum 0.5 mA.
Connected to a diagnostic circuit of a safety relay, supplied from an SELV‑/
PELV power supply with a maximum output voltage of 60 V DC.
"Allocation Board" module
Note
The maximum cable length that can be connected is 30 m.

Additional system components 7
Note
The components described here are used in several units in the SINAMICS family. The next
chapter may, therefore, contain references to manuals for these units.
The SINAMICS DCM supports the following components from the SINAMICS drive system:
CBE20 Communication Board Ethernet

SMC10, SMC30 Sensor Module Cabinet-Mounted
TM15 Terminal Module
In order to operate the SINAMICS DCM with these components, it must be equipped with
Advanced CUD(s); (see the list of options in Chapter "Ordering information for options and
accessories (Page 32)").
The CBE20 Communication Board can be ordered as an option for the SINAMICS DCM and is
installed directly in the unit in the OMI slot (Option Module Interface) of the CUD.
The SMC10, SMC30, TM15, TM31 and TM150 modules are installed separately and
connected to the SINAMICS DCM via the DRIVE-CLiQ interface.
Note
The modules SMC10, SMC30, TM15, TM31 and TM150 must not be connected with the DRIVE-
CLiQ hubs DME20 and DMC20 during operation with SINAMICS DCM.
DRIVE-CLiQ interface
Up to three Terminal Modules TM15/TM31/TM150 can be connected to the DRIVE-CLiQ at the
SINAMICS DCM in any desired combination. One Sensor Module Cabinet-Mounted SMC10 or
SMC30 can also be connected.
The CUD features two DRIVE-CLiQ ports (X100, X101). Any combination of the modules can
be connected in series or in parallel. The Sensor Modules SMC10 or SMC30 only have one
DRIVE-CLiQ interface and are therefore always the last module on the bus.

Additional system components
7.1 Option Board: CBE20 Communication Board Ethernet
7.1.1 Description
The SINAMICS DCM can be connected to PROFINET using the CBE20 Communication Board
Ethernet interface module. The module supports PROFINET IO with Isochronous Realtime
Ethernet (IRT) and PROFINET IO with RT. Mixed operation is not permissible. PROFINET CBA is not
supported.
The option board has an X1400 interface with 4 ports for communication.
The CBE20 Communication Board Ethernet also allows SINAMICS link connections to be
established, connection to EtherNet/IP and to Modbus TCP.
SINAMICS Link allows data to be directly exchanged between up to 64 CU320-2 PN
or CU320-2 DP Control Units or CUD, see Chapter "Communication via SINAMICS Link
(Page 484)".
For further information on EtherNet/IP, see Chapter "Communication via EtherNet/IP (EIP)
(Page 496)".
For further information on Modbus TCP, see Chapter "Communication via MODBUS TCP
(Page 517)".
7.1.2 Safety instructions
NOTICE
Damage or malfunctions of the Option Board by inserting and withdrawing during
operation
Withdrawing and inserting the Option Board during operation can damage it or cause it to
malfunction.
• Only withdraw or insert the Option Board when the Control Unit is de-energized.
NOTICE
Qualified personnel
The CBE20 must only be operated by qualified personnel. The ESD information must be
observed.

7.1.3 Interface description
7.1.3.1 Overview
/LQN3RUW
3RUW
$FWLYLW\3RUW
3RUW
;
3RUW
3RUW
6\QF )DXOW
Figure 7-1 Interface description CBE20
MAC address
The MAC address of the Ethernet interface is located on the upper side of the board.
7.1.3.2 X1400 Ethernet interface
Table 7-1 X1400 Ethernet, ports 1-4

4 Reserved, do not use
Screened M_EXT Screen, permanently connected
backshell
Connector type: RJ45 socket

For diagnostic purposes, the ports have one green and one yellow LED.
Cable and connector types
Cable type: Industrial Ethernet

Max. cable length: 100 m
Information on PROFINET cables and connectors can be found in the following catalog:
Industrial Communication
Catalog IK PI, 2015 Edition
7.1.4 Meaning of the LEDs
Table 7-2 Meaning of the LEDs at ports 1 to 4 of the X1400 interface
LED Color Status Description

Link port - Off Electronics power supply is missing or outside permissible tolerance range (link
missing or defective).
Green Continuous A different device is connected to port x and a physical connection exists.
light
Activity port - Off Electronics power supply is missing or outside permissible tolerance range (no ac‐
tivity).
Yellow Flashing light Data is being received or sent at port x.
Table 7-3 Meaning of the Sync and Fault LEDs on the CBE20

Fault – Off If the link port LED is green:
The CBE20 is operating normally, data is being exchanged with the configured IO
Controller.
Red Flashing light • The response monitoring interval has elapsed.
• Communications is interrupted.
• The IP address is incorrect.
• Incorrect or no configuration.
• Incorrect parameter settings.
• Incorrect or missing device name.
• IO Controller not connected/switched off, although an Ethernet connection has
been established.
• Other CBE20 errors
Continuous CBE20 bus error
light • No physical connection to a subnet/switch.
• Incorrect transmission rate
• Full duplex transmission is not activated.


Sync – Off If the link port LED is green:
Control Unit task system is not synchronized with the IRT clock. An internal substi‐
tute clock is generated.
Green Flashing light Control Unit task system has synchronized with the IRT clock and data is being
exchanged.
Continuous Task system and MC-PLL have synchronized with the IRT clock.
light
Table 7-4 Meaning of the OPT LED on the Control Unit
LED Color Status Description, cause Remedy

OPT – OFF Electronics power supply is missing or outside permissible –
tolerance range.
CBE20 is either defective or not inserted.
Green Continuous CBE20 is ready and cyclic communication is taking place. –
light
Flashing light CBE20 is ready but cyclic communication is not running. –
0.5 Hz Possible causes:
• Communication is being established.
• At least one fault is present.
Red Continuous Cyclic communication via PROFINET has not yet been estab‐ –
light lished. However, non-cyclic communication is possible. SI‐
NAMICS is waiting for a parameterization/configuration tele‐
gram.
Flashing light The firmware update into the CBE20 has been completed –
0.5 Hz with an error.
Possible causes:
• The memory card for the Control Unit is defective.
• The CBE20 is defective.
In this state CBE20 cannot be used.
Flashing light There is a communications error between the Control Unit Correctly insert the
2 Hz and the CBE20. board, if required, re‐
Possible causes: place.
• The CBE20 was withdrawn after booting.
• The CBE20 is defective.
Orange Flashing light Firmware of the CBE20 currently being updated. –
0.5 Hz

7.1.5 Installation
Push the CBE20 into the option module

interface ① on the CUD from above, and
tighten the screws ②.
Tool: Torx T10 screwdriver
Tightening torque: 1 Nm
&%(
&8'
Installing the CBE20
7.1.6 Technical data
Table 7-5 Technical data
Communication Board CBE20 Unit Value

6SL3055-0AA00-2EBx
Max. current requirements (at 24 V DC) ADC 0.1
Power loss W 2.4
Weight kg < 0.1

7.2 Sensor Module Cabinet-Mounted SMC10
7.2.1 Description
The Sensor Module Cabinet-Mounted SMC10 is an expansion module for snapping onto a
mounting rail acc. to IEC 60715. It evaluates encoder signals and transmits the speed, actual
position value and the rotor position via DRIVE-CLiQ to the Control Unit.
The SMC10 is used to evaluate sensor signals from resolvers.
WARNING
Non-observance of the safety instructions
If the safety instructions in Chapter 1 are not observed, accidents can occur involving severe
injuries or death.
• Make sure that the safety instructions are observed.
WARNING
Fire through overheating due to insufficient ventilation clearances
Inadequate ventilation clearances cause overheating with a risk for personnel due to smoke
and fire. This can also result in increased failures and reduced service life of the Sensor Module
Cabinet-Mounted.
• For this reason, it is imperative that you maintain the 50 mm clearances above and below
the Sensor Module Cabinet-Mounted.
Note
Encoder failures due to encoder signal disturbances
Unfavorable material combinations generate static electricity between the belt pulley and the
belt. This electrostatic charge (several kV) can discharge via the motor shaft and the encoder
which leads to disturbance of the encoder signals (encoder error).
• Use an antistatic version of the belt (special conductive polyurethane mixture).
WARNING
Electric shock when disconnecting and connecting encoder cables during operation
When disconnecting plug-in connections during operation, arcs can result in severe injury or
death.
• Only disconnect or connect the encoder cables to Siemens motors in a voltage-free state if
hot-plugging has not been specifically released. When using direct measuring systems
(third-party encoders), ask the manufacturer whether hot-plugging is permitted.

Note
Reduced interference immunity through equalization currents via the electronic ground
Make sure there is no electrical connection between the encoder system housing and the signal
lines and the sensor system electronics.
If this is not carefully observed, under certain circumstances the system will not be able to reach
the required interference immunity level (there is then a danger of equalization currents
flowing through the electronics ground).
NOTICE
Damage through the use of incorrect DRIVE-CLiQ cables
Damage or malfunctions can occur on the devices or system when incorrect or unreleased
DRIVE-CLiQ cables are used.
• Only use suitable DRIVE-CLiQ cables that have been released by Siemens for the respective
application.
Note
Malfunctions due to polluted DRIVE-CLiQ interfaces
Malfunctions can occur in the system through the use of polluted DRIVE-CLiQ interfaces.
• Cover unused DRIVE-CLiQ interfaces with the supplied blanking covers.
Note
The safety instructions on the Sensor Module must be observed.
After the product has reached the end of its service life, the individual parts should be disposed
of in compliance with local regulations.

7.2.3.1 Overview
;
'5,9(&/L4LQWHUIDFH
;
/('
;
(QFRGHUV\VWHPLQWHUIDFH
3URWHFWLYHFRQGXFWRUFRQQHFWLRQ
01P
Figure 7-2 Interface overview for the SMC10
Terminal type
X524
Terminal type Spring-loaded terminal
Connectable cable cross-sec‐ Rigid, flexible 0.2 ... 2.5 mm2
tions Flexible with conductor end sleeve without plastic sleeve 0.25 ... 2.5 mm2
Flexible with conductor end sleeve with plastic sleeve 0.25 ... 1.5 mm2
AWG / kcmil 24 ... 12

7.2.3.2 X500 DRIVE-CLiQ interface
Table 7-6 X500: DRIVE-CLiQ interface

A Reserved, do not use
B M (0 V) Electronics ground
Connector type: DRIVE-CLiQ socket
The blanking cover for the DRIVE-CLiQ port is included in the scope of delivery.
Blanking covers (50 x) Article No.: 6SL3066-4CA00-0AA0
7.2.3.3 X524 Electronics power supply
Table 7-7 X524: Electronics power supply
Connector Terminal Designation Technical specifications

+ Electronics power supply Voltage: 24 V DC (20.4 ... 28.8 V)
Current consumption: Max. 0.35 A
UHG
+ Electronics power supply

M Electronics ground Max. current via jumper in connector:
20 A (15 A according to UL/CSA)
EOXH
M Electronics ground
Type: Spring-loaded terminal

Connectable conductor cross-section: rigid, flexible 0.2 ... 2.5 mm2
Stripped length: 8 mm
Note
The two "+" or "M" terminals are jumpered in the connector. This ensures that the supply voltage
is looped through.

7.2.3.4 X520 Encoder system interface
Table 7-8 X520: Encoder system interface

25 3 S2 Resolver signal A (sin+)
4 S4 Inverted resolver signal A (sin-)
5 Ground Ground (for internal shield)
6 S1 Resolver signal B (cos+)
7 S3 Inverted resolver signal B (cos-)
9 R1 Resolver excitation positive
1
11 R2 Resolver excitation negative
13 -
25 -
Connector type: 25-pin SUB D connector

7.2.4 Connection example
9 (QFRGHUFDEOH
'5,9(&/L4
FDEOH
(QFRGHU *
0RWRU 60&
0RGXOH 0
˽
a
3RZHUFDEOH
&RQWUROFDELQHW
0RWRU
Figure 7-3 Connecting the encoder via a Sensor Module Cabinet-Mounted (SMC)
7.2.5 Meaning of the LED
Table 7-9 Meaning of the LED on the Sensor Module Cabinet-Mounted SMC10

RDY - Off The electronics power supply is missing or outside the –
READY permissible tolerance range.
Green Continuous The component is ready for operation. Cyclic DRIVE- –
light CLiQ communication is taking place.
Orange Continuous DRIVE-CLiQ communication is being established. –
light
Red Continuous This component has at least one fault. Remove and ac‐
light Note: knowledge the fault.
The LED is activated irrespective of whether the corre‐
sponding messages have been reconfigured.
Green/red Flashing Firmware is being downloaded. –
light 0.5 Hz
Flashing Firmware download has been completed. The system Carry out a POWER
light 2 Hz waits for POWER ON. ON.
Green/ orange Flashing Component recognition via LED is activated1). –
or light 2 Hz Note:
red/ orange Both options depend on the LED status when compo‐
nent recognition is activated.
1)
Parameters for activating the identification of components via LED are 1.p9210 and 1.p9211 (see DCM List Manual)
Cause and rectification of faults

Additional information about the cause and how to resolve faults can be found here:
• SINAMICS DCM List Manual
• Chapter “Commissioning with the Starter commissioning tool”

7.2.6 Dimension drawing

Figure 7-4 Dimension drawing of the Sensor Module Cabinet SMC10, all dimensions in mm and
(inches)
7.2.7 Installation
Installation
1. Tilt the component backwards slightly and attach it to the mounting rail using the hooks.
2. Swivel the component onto the mounting rail until you hear the mounting slide at the rear
latch into position.
3. Slide the components along the mounting rail to either the left or right up to their final
position.
Removal
1. First shift the mounting slide downwards at the lug to release the interlocking with the
mounting rail.
2. Swivel the component to the front and withdraw it upwards from the mounting rail.

① Mounting slide
② Mounting rail
Figure 7-5 Removing from a mounting rail
6SL3055-0AA00-5AAx Unit Value

Electronics power supply
Voltage VDC 24 (20.4 … 28.8)
Current (without encoder system) ADC ≤ 0.20
Power loss W ≤4
Max. Cable length m 30
Specification
Transformation ratio of the resolver (ü) 0.5
Excitation voltage on the SMC10 when ü=0.5 Vrms 4.1
Amplitude monitoring threshold (secondary Vrms 0.76
tracks) of the SMC10
Excitation voltage (cannot be parameterized) Vrms 4.1
Excitation frequency (synchronized to the current kHz 5 to 16
controller clock cycle)
Protective conductor connection At the housing with M4/1.8 Nm screw
Max. encoder cable length m 130
Weight kg 0.45

Table 7-11 Max. frequency that can be evaluated (speed)
Resolver Max. speed resolver / motor

Number of Number of 8 kHz / 125 μs 4 kHz / 250 μs 2 kHz / 500 μs
poles pole pairs
2-pole 1 120000 rpm 60000 rpm 30000 rpm
4-pole 2 60000 rpm 30000 rpm 15000 rpm
6-pole 3 40000 rpm 20000 rpm 10000 rpm
8-pole 4 30000 rpm 15000 rpm 7500 rpm
The ratio between the ohmic resistance R and the inductance L (the primary winding of the
resolver) determines whether the resolver can be evaluated with the SMC10. See the figure
below:
Minimum impedances
2,5
2,2
1,9
1,6
1,3
Inductance L [mH]
Non-permitted range
1,0
0,7
0,4
0 10 20 30 40 50 60 70 80
Ohmic resistance R [Ohm]
Figure 7-6 Rotor impedances that can be connected with excitation frequency f = 5000 Hz
To check as shown in the previous figure, the impedances Zrs or Zro (impedance between R1
and R2 with short-circuited or open outputs) from the encoder manufacturer's data sheet
must be used.

Supported types
The SINAMICS DCM only supports the Sensor Module Cabinet-Mounted SMC30 with article
number 6SL3055-0AA00-5CA2. Other types may not be used. You can easily identify
whether the version is supported by the width of the module:
Table 7-12 SMC30 types
SMC30 article number Width Use with SINAMICS DCM

6SL3055-0AA00-5CA2 30 mm Possible
6SL3055-0AA00-5CA0 50 mm Not possible
6SL3055-0AA00-5CA1 50 mm Not possible
Number of SMC30s connected

The SINAMICS DCM supports the connection of one Sensor Module Cabinet-Mounted SMC30.
7.3.1 Description
The Sensor Module Cabinet-Mounted SMC30 evaluates encoder signals and transfers the speed,
actual position value, and, if necessary, the motor temperature and reference point via DRIVE-
CLiQ to the Control Unit.
The SMC30 is used to evaluate encoder signals from encoders with TTL, HTL or SSI interfaces.
A combination of a TTL/HTL signal and SSI absolute signal is possible at terminals X521/X531,
if both signals are derived from the same measured variable.
WARNING
injuries or death.

WARNING
and fire. This can also result in increased failures and reduced service life of the Sensor Module
Cabinet-Mounted.
the Sensor Module Cabinet-Mounted.
NOTICE
Shield support
When the encoder system is connected via terminals, make sure that the cable shield is
connected to the component.
Note
Encoder failures due to encoder signal disturbances
Unfavorable material combinations generate static electricity between the belt pulley and the
belt. This electrostatic charge (several kV) can discharge via the motor shaft and the encoder
which leads to disturbance of the encoder signals (encoder error).
• Use an antistatic version of the belt (special conductive polyurethane mixture).
WARNING
Electric shock when disconnecting and connecting encoder cables during operation
When disconnecting plug-in connections during operation, arcs can result in severe injury or
death.
• Only disconnect or connect the encoder cables to Siemens motors in a voltage-free state if
hot-plugging has not been specifically released. When using direct measuring systems
(third-party encoders), ask the manufacturer whether hot-plugging is permitted.
NOTICE
Damage when connecting an impermissible number of encoder systems
Damage results when more than the maximum permissible number of encoder systems are
connected to a Sensor Module.
• Only connect one encoder system to a Sensor Module.
Note
Reduced interference immunity through equalization currents via the electronic ground
Make sure there is no electrical connection between the encoder system housing and the signal
lines and the sensor system electronics.
If this is not carefully observed, under certain circumstances the system will not be able to reach
the required interference immunity level (there is then a danger of equalization currents
flowing through the electronics ground).

NOTICE
application.
Note
Note
The safety instructions on the Sensor Module must be observed.
After the product has reached the end of its service life, the individual parts should be disposed
of in compliance with local regulations.

7.3.3.1 Overview
;
'5,9(&/L4LQWHUIDFH
;
/('V
;
(QFRGHUV\VWHPLQWHUIDFH
+7/77/ZLWK
WUDFNPRQLWRULQJ
66,
$OWHUQDWLYHHQFRGHU
;
V\VWHP
,QWHUIDFH
+7/77/ZLWK ;
WUDFNPRQLWRULQJ
66,
6KLHOGFRQQHFWLRQ
3URWHFWLYHFRQGXFWRUFRQQHFWLRQ
01P
Figure 7-7 SMC30 interface description
Terminal type
X521, X531
Terminal type Screw terminal
AWG / kcmil 28 ... 14
Tool 0.4 × 2.0 mm screwdriver
Tightening torque 0.22 … 0.25 Nm

X524
AWG / kcmil 24 ... 12
7.3.3.2 X500 DRIVE-CLiQ interface
Table 7-13 X500: DRIVE-CLiQ interface

A Reserved, do not use
Connector type: DRIVE-CLiQ socket
The blanking cover for the DRIVE-CLiQ port is included in the scope of delivery.

Current consumption: Max. 0.55 A
UHG

EOXH
Type: Spring-loaded terminal

Connectable conductor cross-section: rigid, flexible 0.2 ... 2.5 mm2
Stripped length: 8 mm

Note
is looped through.
7.3.3.4 X520 Encoder system interface
Table 7-15 X520: Encoder system interface

2 Clock SSI clock
3 Clock* Inverse SSI clock
4 P encoder 5 V/24 V Encoder supply
5 P encoder 5 V/24 V
6 P sense Sense input, encoder supply
7 M encoder (M) Ground encoder power supply
9 M sense Ground for sense input
10 R Reference signal R
11 R* Inverse reference signal R
12 B* Inverse incremental signal B
13 B Incremental signal B
14 A*/data* Inverted incremental signal A/inverted SSI da‐
ta
15 A/data Incremental signal A/SSI data
Connector type: SUB-D female, 15-pin
NOTICE
Destruction of the encoder due to an incorrect supply voltage
The encoder supply can be parameterized for 5 V or 24 V. The encoder may be destroyed if you
enter the wrong parameters.
• Select the appropriate motor supply voltage.

7.3.3.5 X521/X531 Alternative encoder system interface
Table 7-16 X521/X531 alternative encoder system interface

X521 1 A Incremental signal A
2 A* Inverse incremental signal A
3 B Incremental signal B
4 B* Inverse incremental signal B
5 R Reference signal R
6 R* Inverse reference signal R
7 CTRL Control signal
8 M Ground
1 P_encoder 5 V/24 V Encoder supply

X531 2 M_Encoder Ground encoder power supply
3 - Temp 1) Temperature sensor PT1000 / KTY84-1C130
4 + Temp 1)
Temperature sensor PT1000 / KTY84-1C130
5 Clock SSI clock
6 Clock* Inverse SSI clock
7 Data SSI data
8 Data* Inverse SSI data
Max. connectable cross-section: 1.5 mm2

Measuring current via the temperature sensor connection: 2 mA
When unipolar HTL encoders are used, A*, B*, and R* on the terminal block must be jumpered with
M_Encoder (X531) 2).
1)
Accuracy of the temperature measurement (temperature sensor including evaluation)
- PT1000: ±5 °C (PT1000 tolerance class B acc. to IEC 60751)
- KTY: ±7 °C
2)
Because the physical transmission properties are more robust, the bipolar connection should always be
used. The unipolar connection should only be used if the encoder type does not output push-pull
signals.
WARNING
Electric shock due to unconnected cable shields
cable shields.
• Attach the cable shield to the component via terminals for the encoder system connection.

Temperature sensor connection

For the evaluation of the temperature sensor, see function diagram 8030 in the SINAMICS
DCM List Manual.
NOTICE
Motor damage due to incorrectly connected KTY temperature sensor
A KTY temperature sensor connected with incorrect polarity cannot detect if the motor
overheats. Overheating may result in damage to the motor.
• Connect a KTY temperature sensor with the correct polarity.
WARNING
Electric shock in the event of voltage flashovers on the temperature sensor cable
Voltage flashovers in the signal electronics can occur for motors without safe electrical
• Only use temperature sensors that meet the specifications of safety isolation according to
IEC 61800‑5‑1.
Note
The maximum length of the temperature sensor cable is 100 m. The cables must be shielded.
7.3.4 Connection examples
Connection example 1: HTL encoder with reference signal, bipolar connection
3XOVHHQFRGHU ;
.
$ ,QFUHPHQWDOVLJQDO$
. $ ,QYHUVHLQFUHPHQWDOVLJQDO$
.
% ,QFUHPHQWDOVLJQDO%
. % ,QYHUVHLQFUHPHQWDOVLJQDO%
.
5 5HIHUHQFHVLJQDO]HURPDUN5
. 5 ,QYHUVHUHIHUHQFHVLJQDO]HURPDUN5

8E &75/

0 *URXQG
;
(QFRGHUSRZHUVXSSO\9

*URXQGHQFRGHUSRZHUVXSSO\
Figure 7-8 Connection example 1: HTL encoder with reference signal, bipolar connection
Signal cables must be twisted in pairs in order to improve immunity against induced
interference.

Connection example 2: HTL encoder with reference signal, unipolar connection including the
encoder ground
3XOVHHQFRGHU ;
.
$ ,QYHUVHLQFUHPHQWDOVLJQDO$
.
% ,QYHUVHLQFUHPHQWDOVLJQDO%
.
5 ,QYHUVHUHIHUHQFHVLJQDO]HURPDUN5

8E &75/

0 *URXQG
;
(QFRGHUSRZHUVXSSO\9

Figure 7-9 Connection example 2: HTL encoder with reference signal, unipolar connection including the encoder ground
Signal cables must be twisted in pairs in order to improve immunity against induced
interference.
Connection example 3: HTL encoder with reference signal, unipolar connection without the
encoder ground
3XOVHHQFRGHU ;
.
$ ,QYHUVHLQFUHPHQWDOVLJQDO$
.
% ,QYHUVHLQFUHPHQWDOVLJQDO%
.
5 ,QYHUVHUHIHUHQFHVLJQDO]HURPDUN5

8E &75/

0 *URXQG
;
(QFRGHUSRZHUVXSSO\9

Figure 7-10 Connection example 3: HTL encoder with reference signal, unipolar connection without the encoder ground

7.3.5 Meaning of the LEDs
Table 7-17 Meaning of LEDs on the Sensor Module Cabinet SMC30

RDY - Off Electronics power supply is missing or outside permis‐ –
READY sible tolerance range.
Green Continuous The component is ready for operation and cyclic DRIVE- –
light
Red Continuous At least one fault is present in this component. Remove and ac‐
light Note: knowledge the
The LED is activated irrespective of whether the corre‐ fault.
Green/red 0.5 Hz flash‐ Firmware is being downloaded. –
ing light
Green/red 2 Hz flashing Firmware download is complete. Wait for POWER ON. Carry out a POWER
light ON.
Green/ orange 2 Hz flashing Component recognition via LED is activated (p0144). –
or light Note:
red/ orange Both options depend on the LED status when module
recognition is activated via p0144 = 1.
OUT > 5 V - Off Electronics power supply is missing or outside permis‐ –
sible tolerance range.
Power supply ≤ 5 V.
Orange Continuous Electronics power supply for encoder system available. –
light Power supply > 5 V.
Important:
Make sure that the connected encoder can be operated
with a 24 V power supply. If an encoder that is designed
for a 5 V supply is operated with a 24 V supply, this can
destroy the encoder electronics.


Figure 7-11 Dimension drawing of the Sensor Module Cabinet SMC30, all data in mm and (inches)
7.3.7 Installation
Installation
position.

Removal
mounting rail.
① Mounting slide
② Mounting rail

7.3.8 Protective conductor connection and shield support

Shield supports are only required if the system is connected to X521/X531.
2
1
① Shield connection terminal, Weidmüller company, type: KLBUE CO1, Article number:
1753311001
② Protective conductor connection M4 / 1.8 Nm
Figure 7-13 Shield support and protective conductor connection
The bending radii of the cables must be observed (see MOTION-CONNECT description).
NOTICE
Damage or faulty operation due to incorrect shielding or impermissible cable lengths
If the correct shielding procedures and the permissible cable lengths are not observed, the
machine can be damaged or may malfunction.
• Only use shielded cables.
• Do not exceed the cable lengths stated in the technical data.
6SL3055-0AA00-5CA2 Unit Value

Voltage VDC 24 (20.4 ... 28.8)
Current (without encoder system) ADC ≤ 0.20
Power loss W ≤4
Max. Cable length m 30
Encoder system power supply
Voltage VDC 5 (with or without remote sense) 1) or VDC - 1 V
Current ADC 0.35
Encoder frequency that can be evaluated kHz ≤ 500
(fencoder)

6SL3055-0AA00-5CA2 Unit Value

SSI baud rate kBd 100 - 1000 2)
Protective conductor connection At the housing with M4/1.8 Nm screw
Weight 0.41
1)
A controller compares the encoder system supply voltage - sensed via the Remote Sense cables - with the reference supply
voltage of the encoder system, and adjusts the supply voltage for the encoder system at the output of the drive module until
the required supply voltage is obtained directly at the encoder system (only for 5 V encoder system power supply). Remote
Sense only to X520.
2)
See the diagram "Maximum cable lengths depending on the SSI baud rate for SSI encoders"
Connectable encoder systems
Table 7-19 Specification of encoder systems that can be connected
Parameter Designation Threshold Min. Max. Unit

High signal level UHdiff 2 5 V
(TTL bipolar at X520 or X521/X531)1)
Low signal level ULdiff -5 -2 V
(TTL bipolar at X520 or X521/X531)1)
High signal level UH High 17 VCC V
(HTL unipolar) Low 10 VCC V
Low signal level UL High 0 7 V
(HTL unipolar) Low 0 2 V
High signal level UHdiff 3 VCC V
(HTL bipolar)2)
Low signal level ULdiff -VCC -3 V
(HTL bipolar)2)
High signal level UHdiff 2 5 V
(SSI bipolar at X520 or X521/X531)1)
Low signal level ULdiff -5 -2 V
(SSI bipolar at X520 or X521/X531)1)
Signal frequency fS - 300 kHz
Edge clearance tmin 100 - ns
"Zero pulse inactive time" tLo 640 (tALo-BHi - tHi)/2 3) ns
(before and after A=B=high)
"Zero pulse active time" tHi 640 tALo-BHi - 2*tLo 3) ns
(while A=B=high and beyond)4)
1)
Other signal levels according to the RS422 standard
2)
The absolute level of the individual signals varies between 0 V and VCC of the encoder system.
3)
tALo-BHi is not a specified value, but is the time between the falling edge of track A and the next but one rising edge of track B.
4)
Additional information on setting the "Zero pulse active time" can be found in the Function Manual: /FH1/ SINAMICS S120,
tolerant encoder monitoring for SMC30.

Table 7-20 Connectable encoders
X520 X521 X531 Track Remote Sense2)

(SUB-D) (terminal) (terminal) monitoring
HTL bipolar 24 V Yes Yes Yes No
HTL unipolar 24 V 1)
Yes Yes 1)
No No
TTL bipolar 24 V Yes Yes Yes No
TTL bipolar 5 V Yes Yes Yes At X520
SSI 24 V/5 V Yes Yes No No
TTL unipolar No
1)
Because the physical transmission properties are more robust, the bipolar connection should always be used. The unipolar
connection should only be used if the encoder type does not output push-pull signals.
2)
A controller compares the encoder system supply voltage - sensed via the Remote Sense cables - with the reference supply
voltage of the encoder system, and adjusts the supply voltage for the encoder system at the output of the drive module until
the required supply voltage is obtained directly at the encoder system (only for 5 V encoder system power supply).
Maximum encoder cable lengths
Note
The maximum cable lengths according to the following table must not be exceeded even when
longer cable lengths can be calculated.
Table 7-21 Maximum encoder cable length
Encoder type Maximum encoder cable length in m

TTL1) 100
HTL unipolar 2)
100
HTL bipolar 300
SSI 1003)
1)
For TTL encoders at X520 → Remote Sense → 100 m
2)
Because the physical transmission properties are more robust, the bipolar connection should always be
used. The unipolar connection should only be used if the encoder type does not output push-pull
signals.
2)
See diagram "Maximum cable length depending on the SSI baud rate for SSI encoders"

SSI encoders

0D[FDEOHOHQJWK>P@

66,EDXGUDWH>N+]@
Figure 7-14 Maximum cable lengths depending on the SSI baud rate for SSI encoders
Encoders with 5 V supply connected to X521/X531

For encoders with a 5 V supply at X521 / X531, the cable length 1) depends on the encoder
current (applicable for cable cross-sections with 0.5 mm2):

&DEOHOHQJWK>P@

(QFRGHUSRZHUFRQVXPSWLRQ>$@
When encoders without Remote Sense are used, the permissible cable length is limited to 100 m
1)
max. because the voltage drop depends on the cable length and the encoder current.
Figure 7-15 Max. cable length as a function of the encoder current drawn

7.4 Terminal Module TM15
$$
%%
WPLQ WPLQ
IV
Figure 7-16 Signal characteristic of track A and track B between two edges: Time between two edges
with pulse encoders
$$
%%
55
7ROHUDQFHUDQJH 7ROHUDQFHUDQJH
W/R IRUWKHULVLQJHGJH W+L IRUWKHIDOOLQJHGJH W/R
RIWKH]HURSXOVH RIWKH]HURSXOVH
W$/R%+L
Figure 7-17 Position of the zero pulse to the track signals
7.4.1 Description
The TM15 Terminal Module is a terminal expansion module for snapping onto a mounting rail
according to IEC 60715. The number of available digital inputs and outputs within a drive system
can be expanded with the TM15.
Table 7-22 Interface overview of the TM15
Type Number
DRIVE-CLiQ interfaces 2
Bidirectional digital inputs/outputs 24 (electrical isolation in 3 groups, each with 8 DI/DO)

WARNING
injuries or death.
WARNING
and fire. This can also result in more downtimes and reduced service lives of the Terminal
Module.
the Terminal Module.
NOTICE
application.
Note

7.4.3.1 Overview
;
'5,9(&/L4LQWHUIDFHV
;
;
; /('
'LJLWDOLQSXWVRXWSXWV
RQHJUHHQVWDWXV/('SHU ;
FKDQQHO
;
3(FRQGXFWRUFRQQHFWLRQ 6KLHOGFRQQHFWLRQ
01P
Figure 7-18 TM15 interface overview
Terminal type
X520, X521, X522

AWG / kcmil 28 ... 14
X524


AWG / kcmil 24 ... 12
7.4.3.2 X500/X501 DRIVE-CLiQ interfaces
Table 7-23 X500/X501: DRIVE-CLiQ interfaces

A + (24 V) Power supply
The blanking covers for the DRIVE-CLiQ interfaces are included in the scope of delivery;
blanking cover (50 x) Article number: 6SL3066-4CA00-0AA0
Note
The maximum DRIVE-CLiQ cable length is 100 m.

Current consumption: max. 0.6 A 1)
UHG

EOXH
1)
Including the current consumption for the digital outputs

Note
is looped through.
The digital outputs are supplied via terminals X520, X521, and X522.
7.4.3.4 X520 Bidirectional digital inputs/outputs
Table 7-25 X520: Bidirectional digital inputs/outputs
Connector Terminal Designation 1) Technical specifications
1 L1+ See Section

2 DI/DO 0 "Technical specifications"
3 DI/DO 1
4 DI/DO 2
5 DI/DO 3
;
6 DI/DO 4
7 DI/DO 5
8 DI/DO 6
9 DI/DO 7
10 M1 (GND)
1)
L1+: A 24 V DC power supply for DI/DO 0 to 7 (first potential group) must always be connected if at least
one DI/DO of the potential group is used as an output.
M1: A ground reference for DI/DO 0 to 7 (first potential group) must always be connected if at least one
DI/DO of the potential group is used as either an input or output.
DI/DO: Bidirectional digital input/output

1 L2+ See Section

3 DI/DO 9
4 DI/DO 10
5 DI/DO 11
;
6 DI/DO 12
7 DI/DO 13
8 DI/DO 14
9 DI/DO 15
10 M2 (GND)
1)
L2+: A 24 V DC power supply for DI/DO 8 to 15 (second potential group) must always be connected if
at least one DI/DO of the potential group is used as output.
M2: A ground reference for DI/DO 8 to 15 (second potential group) must always be connected if at least
one DI/DO of the potential group is used as either input or output.
1 L3+ See Section

3 DI/DO 17
4 DI/DO 18
5 DI/DO 19
;
6 DI/DO 20
7 DI/DO 21
8 DI/DO 22
9 DI/DO 23
10 M3 (GND)
1)
L3+: A 24 V DC power supply for DI/DO 16 to 23 (third potential group) must always be connected if at
least one DI/DO of the potential group is used as output.
M3: A ground reference for DI/DO 16 to 23 (third potential group) must always be connected if at least
one DI/DO of the potential group is used as either input or output.


([W
9 0 0
; ;
;
;

'5,9(&/L4VRFNHW
'5,9(&/L4VRFNHW
/ /
9

','2 0

0 ','2
0

0 ','2
0

','2
0
','2

','2

','2

','2

0
7HUPLQDO0RGXOH
70 ;

/ /

','2 0

','2

','2

','2
0
','2

','2

','2

','2

0
;

/ /

','2 0

','2

','2

','2
0
','2

','2

&DQEHLQGLYLGXDOO\SDUDPHWHUL]HGDVLQSXWRURXWSXW ','2

','2

0
Figure 7-19 Example connection of TM15

Table 7-28 Meanings of the LED on the Terminal Module TM15

READY - Off The electronics power supply is missing or outside the –
permissible tolerance range.
Green Continuous The component is ready for operation. Cyclic DRIVE- –
light
Red Continuous This component has at least one fault. Remove and ac‐
light Note: knowledge the fault.
The LED is activated irrespective of whether the corre‐
light 2 Hz
Flashing Firmware download has been completed. The system Carry out a POWER
light 2 Hz waits for POWER ON. ON.
Green/ orange Flashing Component recognition via LED is activated1). –
or light 2 Hz Note:
red/ orange Both options depend on the LED status when compo‐
nent recognition is activated.
1)
See SINAMICS DCM List Manual for the parameters to activate the recognition of components via LED

The following documents contain information about the cause of faults and how they can be
rectified:
SINAMICS DCM List Manual


Figure 7-20 Dimension drawing of Terminal Module TM15, all data in mm and (inches)
7.4.7 Installation
Installation
position.
Removal
mounting rail.

① Mounting slide
② Standard mounting rail

It is always advisable to shield the digital I/O wiring.
The following diagrams show typical Weidmüller shield connection terminals for the shield
supports.


1753311001
② Protective conductor connection with M4 screw / 1.8 Nm
Figure 7-22 Shield supports and protective conductor connection
NOTICE
Note
Only use screws with a permissible mounting depth of 4 - 6 mm.
The TM15 enclosure is connected to the ground terminal of the module supply (terminal
X524). If the ground terminal is actually grounded, then the enclosure is also grounded. An
additional ground connection using the M4 screw is especially necessary if high potential
bonding currents can flow (e.g. through the cable shield).
7.4.9 Connector coding

A series of coding elements ("coding sliders") are supplied with each Terminal Module TM15.
Connector coding
1. Insert at least one coding slider at the required position.
2. Remove the associated coding lug at the connector.


① Insert a coding slider.

② Cut off the coding lug on the connector.
Figure 7-23 Procedure for encoding a connector
To avoid wiring errors, unique coding patterns must be defined for the connectors X520,
X521 and X522.
Possible patterns:
• 3 connectors on one component are encoded differently (i.e. X520, X521 and X522).
• Different component types are encoded differently.
• Otherwise identical components are encoded differently on the same machine, (e.g. several
TM15-type components).

6SL3055-0AA00-3FAx Unit Value

Electronic power supply
Voltage VDC 24 (20.4 ... 28.8)
Current (without DRIVE-CLiQ or digital outputs) ADC 0.15
Power loss W <3
Max. cable length m 30
Peripherals
Digital inputs/outputs Can be parameterized as either DI or DO
Number of digital inputs/outputs 24
Electrical isolation Yes, in groups of 8
Digital inputs
Voltage VDC -30 … +30
Low level (an open digital input is interpreted as VDC -30 … +5
"low")
High level VDC 15 … 30
Input impedance kΩ 2.8
Input current, typical (at 24 V DC) mA 9
Max. voltage in OFF state VDC 5
Current in OFF state mA 0.0 to 1.0 (per channel)
Typical input delay of the digital inputs μs "0" → "1": 50
"1" → "0": 100
Digital outputs (continuously short-circuit proof)
Voltage VDC 24
Max. load current per digital output ADC 0.5
Output delay (resistive load)
Typical μs "0" → "1": 50
"1" → "0": 150
Maximum μs "0" → "1": 100
"1" → "0": 225
Min. output pulse μs 125 (typ.)
(100% amplitude, 0.5 A with resistive load) 350 (max.)
Switching frequency
For resistive load Hz max. 100
For inductive load Hz max. 0.5
For lamp load Hz max. 10
Max. lamp load W 5
Max. switching frequency kHz 1 (typ.)
(100% amplitude, 50%/50% duty cycle;
with 0.5 A and a resistive load)
Voltage drop in ON state VDC 0.75 (max.) for maximum load in all cir‐
cuits
Leakage current in OFF state μA Max. 10 per channel
Voltage drop, output VDC 0.5
(I/O power supply to the output)

6SL3055-0AA00-3FAx Unit Value

Max. total current of outputs (per group)
up to 60° C ADC 2
up to 50° C ADC 3
up to 40° C ADC 4
Response time The response time for the digital inputs/outputs (TM15 DI/DO) consists
of the following elements:
• Response time on the component itself
(approx. 1/2 DRIVE-CLiQ clock cycle).
• Transmission time via the DRIVE-CLiQ connection
(approx. 1 DRIVE-CLiQ clock cycle).
• Evaluation on the Control Unit (see function diagram)
For additional information:
SINAMICS DCM List Manual, Chapter "Function block diagrams"
Weight kg 1.0
Protective conductor connection On enclosure with M4/1.8 Nm screw
Approvals UL and cULus, http://www.ul.com (www.ul.com)
File: E164110, Vol. 2, Sec. 9
7.5.1 Description
The TM31 Terminal Module is a terminal expansion module for snapping onto a mounting rail
according to IEC 60715. The TM31 Terminal Module can be used to increase the number of
available digital and analog inputs and outputs within a drive system.
The TM31 contains the following interfaces:
Table 7-30 Interface overview of the TM31
Type Number
Digital inputs 8
Bidirectional digital inputs/outputs 4
Analog inputs 2
Analog outputs 2
Relay outputs 2
Temperature sensor input 1

Supported types
SINAMICS DCM only supports one version of the Terminal Module TM31:
Table 7-31 TM31 types
Article number TM31 Use with SINAMICS DCM

6SL3055-0AA00-3AA0 Not possible
6SL3055-0AA00-3AA1 Possible
WARNING
injuries or death.
WARNING
Module.
NOTICE
Device failure as a result of unshielded or incorrectly routed cables to temperature
sensors
Unshielded or incorrectly routed cables to temperature sensors can result in interference being
coupled into the signal processing electronics from the power side. This can result in
significant disturbance of all signals (fault messages) up to failure of individual components
(destruction of the devices).
• Only use shielded cables as temperature sensor cables.
• If temperature sensor cables are routed together with the motor cable, use separately
shielded cables twisted in pairs.
• Connect the cable shield at both ends to ground potential over a large surface area.

NOTICE
application.
Note

7.5.3.1 Overview
; '5,9(&/L4
; LQWHUIDFHV
;
(OHFWURQLFVSRZHU
VXSSO\
/('
6
; 9ROWDJH
$X[LOLDU\YROWDJHIRU FXUUHQWPHDVXUHPHQW
GLJLWDOLQSXWV
;
$QDORJLQSXWV
;
'LJLWDOLQSXWVRXWSXWV
;
$QDORJRXWSXWV
;
'LJLWDO
LQSXWV
; ;
5HOD\RXWSXWV
6KLHOG
FRQQHFWLRQ
3(FRQGXFWRU
FRQQHFWLRQ
01P
Figure 7-24 Interface description TM31
Terminal type
X520, X521, X522, X530, X540, X541

AWG / kcmil 28 ... 14


X542
Connectable cable cross-sec‐ Rigid, flexible 0.2 … 2.5 mm2
tions Flexible with conductor end sleeve without plastic sleeve 0.25 … 1 mm2
Flexible with conductor end sleeve with plastic sleeve 0.25 … 1 mm2
AWG / kcmil 22 ... 12
Tightening torque 0.5 ... 0.6 Nm
X524
AWG / kcmil 24 ... 12

A + (24 V) Power supply
The blanking covers for the DRIVE-CLiQ interfaces are included in the scope of delivery.
Note


UHG + Electronics power supply
EOXH
1)
Including the current consumption for the digital outputs and for supplying the sensor
Note
is looped through.
The current consumption increases by the value for the DRIVE-CLiQ node and digital outputs.
7.5.3.4 X520, X530 Digital inputs
Table 7-34 X520: Digital inputs

1 DI 0 Voltage: - 3 … +30 V
2 DI 1 Electrical isolation: Yes
3 DI 2 Reference potential: M1
4 DI 3 Input characteristic acc. to IEC 61131-2, type
5 M1 1
Input voltage (including ripple)
6 M
"1" signal: 15 … 30 V
"0" signal: -3 … +5 V
Input current
at 24 V DC: typ. 9 mA
at < 0.5 mA: "0" signal reliably detected
Input delay:
For "0" → "1": typ. 50 µs/max. 100 µs
for "1" → "0": typ. 130 µs, max. 150 µs

Table 7-35 X530: Digital inputs

1 DI 4 Voltage: - 3 … +30 V
2 DI 5 Electrical isolation: Yes
3 DI 6 Reference potential: M2
4 DI 7 Input characteristic acc. to IEC 61131-2, type
5 M2 1
Input voltage (including ripple)
6 M
"1" signal: 15 … 30 V
"0" signal: -3 … +5 V
Input current
Input delay:
For "0" → "1": typ. 50 µs/max. 100 µs
for "1" → "0": typ. 130 µs, max. 150 µs
1)
DI: Digital input; M: Electronics ground; M1, M2: Ground reference
Note
Ensuring the function of digital inputs
An open input is interpreted as "low".
Terminal M1 or M2 must be connected in order that digital inputs (DI) can function.
This is achieved through one of the following measures:
1. Provide the ground reference of the digital inputs
2. A jumper to terminal M
Note:: This removes isolation for these digital inputs.

7.5.3.5 X521 Analog inputs
Table 7-36 X521: Analog inputs

1 AI 0+ The analog inputs can be toggled between
2 AI 0- current and voltage input using switches S5.0
and S5.1
3 AI 1+
As voltage input
4 AI 1- : -10 ... +10 V; Ri > 100 kΩ
Resolution: 11 bits + sign
As current input:
-20 ... +20 mA; Ri = 250 kΩ
Resolution: 10 bits + sign
5 P10 Auxiliary voltage:
6 M P10 = 10 V
N10 = -10 V
7 N10 Current-carrying capacity: max. 3 mA
8 M Sustained short-circuit-proof
1)
AI: Analog inputs; P10/N10: Auxiliary voltage; M: Ground reference
NOTICE
Damage or malfunctions through impermissible voltage values
If a current exceeding ±35 mA flows through the analog current input, then the component
could be destroyed.
The common mode range must not be violated in order to avoid incorrect analog-digital
conversion results.
• The input voltage may only be in the range between -30 V and +30 V (destruction limit).
• The common mode voltage may only be in the range between -10 V and +10 V (error limit).
• The back EMF at the auxiliary voltage outputs may only be in the range between -15 V and
+15 V.
Note
The power supply for the analog inputs can be taken internally or from an external power supply
unit
7.5.3.6 Analog inputs current/voltage switch
Table 7-37 Current/Voltage Change-over switch S5
Switch Function
S5.0 Switchover of voltage (V)/current (I) Al0
S5.1 Switchover of voltage (V)/current (I) Al1

7.5.3.7 X522 Analog outputs/temperature sensor
Table 7-38 X522: Analog outputs/temperature sensor

1 AO 0V+ You can set the following output signals using parameters:
2 AO 0- Voltage: -10 V ... +10 V (max. 3 mA)
3 AO 0C+ Current 1: 4 … 20 mA (max. load resistance ≤ 500 Ω)
4 AO 1V+ Current 2: -20 … +20 mA (max. load resistance ≤ 500 Ω)
5 AO 1- Current 3: 0 … 20 mA (max. load resistance ≤ 500 Ω)
6 AO 1C+ Resolution: 11 bits + sign
Sustained short-circuit-proof
7 + Temp 2) Temperature sensor PT1000 / PTC / KTY84-1C130
8 - Temp 2) Measuring current via temperature sensor connection: 2 mA
1)
AO xV: Analog output voltage; AO xC: Analog output current
2)
Accuracy of the temperature measurement (including evaluation)
- PT1000: ±5 °C (PT1000 tolerance class B acc. to IEC 60751)
- PTC: ±5 °C
- KTY: ±7 °C
NOTICE
Damage or malfunctions through impermissible voltage values
If the back EMF is impermissible then damage and malfunctions may occur on the components.
• The back EMF at the outputs may only be in the range between -15 V and +15 V.
NOTICE
If a KTY temperature sensor is connected with incorrect polarity, it is not possible to detect
when the motor overheats. Overheating may result in damage to the motor.
WARNING
Electric shock when the motor temperature sensor insulation fails
When connecting temperature sensors which are not isolated from the motor power circuit
according to safe electrical separation, arcing to the signal electronics may occur.
• Use motors whose temperature sensors have safe electrical separation.
• Use only connecting cables and connectors with safe electrical separation between the
insulated conductors of the temperature sensor and the insulated conductors of the power
circuit.

7.5.3.8 X540 Auxiliary voltage for the digital inputs
Table 7-39 X540: Auxiliary voltage for the digital inputs

8 +24 V Voltage: +24 VDC
7 +24 V Max. total load current of +24 V auxiliary volt‐
6 +24 V age for terminals X540 and X541 combined:
150 mA
5 +24 V
4 +24 V
3 +24 V
2 +24 V
1 +24 V
Note
This power supply is only used for powering the digital inputs.
Note
If the 24 V supply is briefly interrupted, the auxiliary voltage for the digital inputs is deactivated
for this time.


6 M As input:
5 DI/DO 11 Voltage: -3 … 30 V
Electrical isolation: no
4 DI/DO 10 Reference potential: M
3 DI/DO 9 Input characteristic acc. to IEC 61131-2, type 1
2 DI/DO 8 Input voltage (including ripple)
"1" signal: 15 … 30 V
"0" signal: -3 … +5 V
Input current
Input delay:
For "0" → "1": typ. 50 μs
-for "1" → "0" typ. 100 μs
As output:
Voltage: 24 V DC
Electrical isolation: no
Reference potential: M
Output voltage
"1" signal, with load: > X524.+ -2 V
Output current
for each output: ≤ 0.5 A
Sum of all 4 outputs:
≤ 0.1 A (when parameter p4046 = 0)
≤ 1.0 A (when parameter p4046 = 1)
Residual current for "0" signal: < 0.5 mA
Short-circuit protection, automatic restart after a short-cir‐
cuit
Load types: ohmic, capacitive, inductive
Output delay
for "0" → "1": typ. 150 μs / max. 500 μs (ohmic load)
for "1" → "0": typ. 50 µs (ohmic load)
Switching frequency
For ohmic load: Max. 100 Hz
For inductive load: Max. 0.5 Hz
For lamp load: max. 10 Hz
Lamp load: max. 5 W
1 +24 V Auxiliary voltage:
Voltage: +24 V DC
Max. total load current of +24 V auxiliary voltage for termi‐
nals X540 and X541 combined: 150 mA
1)
DI/DO: Bidirectional digital input/output; M: Electronics ground
Note
An open input is interpreted as "low".

Note
If a the 24 V supply is briefly interrupted, the digital outputs are deactivated during this time.
7.5.3.10 X542 Relay outputs
Table 7-41 X542: Relay outputs

1 DO 0.NC Contact type: Two-way contact max. load current: 8 A
2 DO 0.COM Max. switching voltage: 250 VAC. 30 VDC
Max. switching capacity at 250 VAC: 2000 VA (cosφ = 1)
3 DO 0.NO Max. switching capacity at 250 VAC: 750 VA (cosφ = 0.4)
4 DO 1.NC Max. Switching capacity at 30 VDC: 240 W (resistive load)
5 DO 1.COM Required minimum current: 100 mA
Output delay: ≤ 20 ms 2)
6 DO 1.NO
Overvoltage category: Class II according to IEC 61800‑5‑1
DO: Digital output; NO: Normally open contact; NC: Normally closed contact; COM: Mid-
1)
position contact
2)
Depending on the parameterization and the supply voltage (P24) of the TM31


([W
9 0 0
; ;
;
'5,9(&/L4VRFNHW
'5,9(&/L4VRFNHW
9
;

$,
0 0
$,
s9
0 0
$,
$,
;
3
9
0
9

7HUPLQDO0RGXOH 1
9
70
9 0
9
9 ;
9 $29
9
9 $2
$2&
$
;
$29
0 9
$2
','2
$2&
$
','2
7HPS
','2
WHPS
','2
9
;
;
',
'2
', 0

', 0
',
0 '2
0
0
0
;
', -XPSHUVUHTXLUHGIRUWKLVW\SLFDOFLUFXLW
0
&DQEHLQGLYLGXDOO\SDUDPHWHUL]HGDVFXUUHQWVRXUFH
',
&DQEHLQGLYLGXDOO\SDUDPHWHUL]HGDVRXWSXW
', 0 6KLHOGUHTXLUHG
',
0

0
0

0
Figure 7-25 TM31 connection example

Table 7-42 Meanings of the LED on the Terminal Module TM31

READY - Off The electronics power supply is missing or outside the permis‐ –
sible tolerance range.
Green Continu‐ The component is ready for operation. Cyclic DRIVE-CLiQ com‐ –
ous light munication is taking place.
Orange Continu‐ DRIVE-CLiQ communication is being established. –
ous light
Red Continu‐ This component has at least one fault. Remove and acknowl‐
ous light Note: edge the fault.
The LED is activated irrespective of whether the corresponding
messages have been reconfigured.
light 0.5
Hz
Flashing Firmware download has been completed. The system waits for Carry out a POWER ON.
light 2 Hz POWER ON.
Green/ Flashing Component recognition via LED is activated1). –
orange light 2 Hz Note:
or Both options depend on the LED status when component rec‐
red/ ognition is activated.
orange
1)
See SINAMICS DCM List Manual for the parameters to activate the recognition of components via LED

rectified:


50 (1.97)
35 (1.38)
167,5 (6.59)
151 (5.94)
90,5 (3.56)
(1.06)
27
105 (4.13)
110 (4.33)
118 (4.65)
Figure 7-26 Dimension drawing of Terminal Module TM31, all data in mm and inches
7.5.7 Installation
Installation
position.

Removal
mounting rail.
① Mounting slide

It is always advisable to shield the digital input/output wiring.
The following diagrams show typical Weidmüller shield connection terminals for the shield
supports.


1753311001
Figure 7-28 Shield supports
NOTICE
Damage or faulty operation due to incorrect shielding or inadmissible cable lengths

7.5.9 Connector coding

To ensure that identical connectors are assigned correctly on the TM31, the connectors are
coded as shown in the diagram below.
Coded connectors
Figure 7-29 Example of connector coding at the TM31
The bending radii of the cables must be observed (see MOTION-CONNECT description).
6SL3055-0AA00-3AA1 Unit Value

Voltage VDC 24 (20.4 … 28.8)
Current (without DRIVE-CLiQ, ADC ≤0.2
digital outputs and auxiliary vol‐
tages) W ≤5
Power loss
PE/ground connection At the housing with M4/1.8 Nm screw

6SL3055-0AA00-3AA1 Unit Value

Response time The response time for the digital inputs/outputs and the analog in‐
puts/outputs consists of the following elements:
• Response time on the component itself (approx. 1/2 DRIVE-CLiQ
clock cycle).
• Transmission time via the DRIVE-CLiQ connection (approx. 1
DRIVE-CLiQ clock cycle)
• Evaluation on the Control Unit (see function diagram)
Further information: SINAMICS DCM List Manual, Chapter "Function
diagrams"
Maximum cable lengths:
Electronics power supply m 30
DRIVE-CLiQ cables m 100
inputs/outputs m 30
Weight kg 0.49
7.6.1 Description
The terminal module TM150 is a DRIVE-CLiQ component for temperature evaluation. The
temperature is measured in a temperature range from ‑99 °C to +250 °C for the following
temperature sensors:
• PT100 (with monitoring for wire breakage and short-circuit)
• PT1000 (with monitoring for wire breakage and short-circuit)
• KTY84 (with monitoring for wire breakage and short-circuit)
• PTC (with short-circuit monitoring)
• Bimetallic NC contact (without monitoring)
For the temperature sensor inputs, for each terminal block the evaluation can be
parameterized for 1x2-wire, 2x2-wire, 3-wire or 4-wire conductors. There is no galvanic
isolation in the TM150.
The TM150 is mounted in the control cabinet and can be snapped onto a mounting rail
(IEC 60715).
The TM150 contains the following interfaces:
Table 7-44 Overview of the TM150 interfaces
Type Quantity
Temperature sensor inputs 12
Electronics power supply 1

WARNING
injuries or death.
WARNING
Module.
NOTICE
sensors
NOTICE
application.
Note

7.6.3.1 Overview
; '5,9(&/L4
LQWHUIDFHV
;
;
(OHFWURQLFVSRZHU
VXSSO\
/('
;;
7HPSHUDWXUHVHQVRU
LQSXWV
6KLHOGFRQQHFWLRQ
3(FRQGXFWRUFRQQHFWLRQ
01P
Figure 7-30 Interface overview of Terminal Module TM150
Terminal type
X524
AWG / kcmil 24 ... 12
X531 - X536


AWG / kcmil 24 ... 16

A + (24 V) Power supply, max. 450 mA
The blanking covers for the DRIVE-CLiQ interfaces are included in the scope of delivery.
Note

UHG

EOXH
1)
Including DRIVE-CLiQ

Note
is looped through.
The current consumption increases by the value for the DRIVE-CLiQ node.
7.6.3.4 X531-X536 Temperature sensor inputs
Table 7-47 X531-X536: Temperature sensor inputs
Connector Terminal Function Function Technical specifications

1x2- / 2x2-wire 3 and 4-wire
1 + Temp + Temperature sensor connection for sensors with
(channel x) (Channel x) 1x2 wires
Connection of the 2nd measurement cable for
sensors with 4-wires
2 - Temp - Temperature sensor connection for sensors with
(channel x) (Channel x) 1x2 wires
Connection of the 1st measurement cable for sen‐
sors with 3 and 4-wires.
3 + Temp + Ic Temperature sensor connection for sensors with
(channel y) (constant current, posi‐ 2x2, 3 and 4-wires
tive
channel x)
4 - Temp - Ic
(channel y) (constant current, nega‐
tive
channel x)
Measuring current via temperature sensor connection: Approx. 0.83 mA
When connecting temperature sensors with three wires, a jumper must be inserted between
X53x.2 and X53x.4.
Table 7-48 Channel assignment
Terminal Channel number [x] Channel number [y]

for 1x2, 3 and 4-wires for 2x2 wires
X531 0 6
X532 1 7
X533 2 8
X534 3 9
X535 4 10
X536 5 11

NOTICE
A KTY temperature sensor connected with incorrect polarity cannot detect if the motor
overheats. Overheating may result in damage to the motor.
NOTICE
Overheating of the motor through jumpering the temperature sensor connections
Jumpering of the temperature sensor connections "+ Temp" and "- Temp" results in incorrect
measurement results. Damage to the motor can result if the overheating is not detected.
• When using several temperature sensors, separately connect the individual sensors to
"+ Temp" and "- Temp".
NOTICE
sensors
Note
Incorrect temperature measured values as a result of cables with an excessively high
resistance
An excessively long cable length or an excessively small cable cross-section can falsify the
temperature measurement (for a PT100, 10 Ω cable resistance can falsify the measurement
result by 10%). As a consequence, excessively high measured values are output, which could
lead to the motor being unnecessarily tripped prematurely.
• Use only cable lengths ≤ 300 m.
• For cable lengths >100 m, use cables with a cross-section of ≥1 mm2.

7.6.4 Connection examples
[
37 [
37 [
,F [
,F [
X53x
[
37 [ [
37
,F [
X53x
37
37
7HPS [
7HPS [
[
7HPS \
7HPS \
37
37 X53x
Figure 7-31 Connecting a PT100/PT1000 with 2x2, 3 and 4-wires to the temperature sensor inputs
X53x of Terminal Module TM150


([W
9 0 0
; ;
;
9
'5,9(&/L4VRFNHW
'5,9(&/L4VRFNHW

;
0 0

7HPS
0 0 ˽ &KDQQHO
7HPS

[ZLUH
7HPS
˽ &KDQQHO
7HPS
;

7HPS
˽ &KDQQHO
7HPS

[ZLUH
7HPS
˽ &KDQQHO
7HPS
7HUPLQDO0RGXOH ;
70 7HPS

˽ &KDQQHO
7HPS

[ZLUH
7HPS
˽ &KDQQHO
7HPS
;

&KDQQHO
,F WKUHHZLUH
˽
,F
;

&KDQQHO
,F
˽ IRXUZLUH

,F
;

&KDQQHO
,F
˽ IRXUZLUH

,F
Figure 7-32 Connection example for a Terminal Module TM150

Table 7-49 Meaning of the LEDs at the Terminal Module TM150

READY – Off Electronics power supply is missing or outside permissible tol‐ Check power supply
erance range.
Green Continu‐ The component is ready for operation and cyclic DRIVE-CLiQ –
ous light communication is taking place.
Orange Continu‐ DRIVE-CLiQ communication is being established. –
ous light
At least one fault is present in this component. Remove and acknowl‐
Red Continu‐ Remark: edge the fault.
ous light LED is controlled irrespective of the corresponding messages
being reconfigured.
Green/ Flashing Firmware is being downloaded. –
red light
0.5 Hz
Flashing Firmware has been downloaded. Carry out a POWER ON.
light Wait for POWER ON.
2 Hz
Green/ Flashing Component recognition via LED is activated (p0154). –
orange light Remark:
or 2 Hz
Both options depend on the LED status when module recog‐
red/
nition is activated via p0154 = 1.
orange

rectified:
SINAMICS S120 Commissioning Manual with STARTER


Figure 7-33 Dimension drawing of Terminal Module TM150, all data in mm and (inches)
7.6.7 Installation
Installation
position.
Removal
mounting rail.

① Mounting slide
Figure 7-34 Removing a TM150 from a mounting rail


The following diagram shows a typical Weidmüller shield connection clamp for the shield
supports.
2
1
1753311001
Figure 7-35 Shield support and protective conductor connection
NOTICE
6SL3055-0AA00-3LA0 Unit Value

Voltage VDC 24 (20.4 ... 28.8)
Current (without DRIVE-CLiQ) ADC ≤0.1
Power loss W ≤2
PE/ground connection At the housing with M4 / 1.8 Nm screw
Maximum cable length m 30
Weight kg 0.4

Commissioning 8
WARNING
Not observing fundamental safety instructions and residual risks
The non-observance of the fundamental safety instructions and residual risks stated in Chapter
1 can result in accidents with severe injuries or death.
• Adhere to the fundamental safety instructions.
Note
During a data save operation initiated by the user, the electronic power supply for the SINAMICS
DCM must not be interrupted.
An active saving process is indicated by the following actions:
• The RDY-LED flashes (see Chapter "Description of the LEDs on the CUD (Page 609)")
• The BOP20 flashes
Interrupting the power supply while saving can lead to the loss of the current device parameter
assignments. See also Chapter "Memory card functions (Page 329)".
8.1 Commissioning checklist
Preparation
• Read the safety instructions in Chapter "Safety instructions (Page 21)".
• Read Chapter "Transport, unpacking, installation (Page 47)".
• Read through the entire checklist together with another person before starting work on the
device.
• Before commissioning the converter, as a minimum, check the following points:

Commissioning
8.1 Commissioning checklist
Mechanical installation
Use the following checklist to guide you through the mechanical installation procedure for the
device.
Note
Checking the checklist
Check the boxes accordingly in the right-hand column if the activity applies to the cabinet unit
in your scope of supply. In the same way, check the boxes once you have finished the installation
procedure to confirm that the activities are complete.
Item Activity Available Completed

1 The device is properly mounted on a vertical wall/panel made of non-flammable ma‐
terial.
2 All shield connections are tight (see Chapter “Connecting (Page 67)”).
3 All cable connections are tight (see Chapter “Connecting (Page 67)”).
4 The ambient conditions are complied with (see Chapter “Environmental conditions
(Page 43)”).
5 The cooling air can flow unobstructed.
6 The motor and the driven machine are ready to run.
Electrical installation
Use the following checklist to guide you through the electrical installation procedure for the
device.
Note
Checking the checklist
Check the boxes accordingly in the right-hand column if the activity applies to the cabinet unit
in your scope of supply. In the same way, check the boxes once you have finished the installation
procedure to confirm that the activities are complete.

1 The converter devices have been properly grounded.
2 The line connections (1U1, 1V1, 1W1), motor connections (1C1, 1D1) and the field
connections (3C, 3D) are correctly established.
3 All control cables have been correctly connected (see Chapter “Connecting (Page 67)”).
4 The correct commutating reactors have been installed and connected (see Chapter
“Commutating reactors (Page 123)”).
5 The correct semiconductor protection fuses and cable protection fuses have been in‐
stalled (see Chapter “Fuses (Page 127)”).
6 There are no tools, foreign bodies or metal chips in the converter.
7 The correct covers are in place and correctly mounted.

Commissioning
8.2 Switching on

8 A higher-level Emergency Stop device to avoid hazardous situations is absolutely man‐
datory for all applications. This is available, is functioning and is operational.
9 The line supply voltage is the same as the rated input voltage of the converter.
10 A clockwise phase sequence is connected at the fan power supply (4U1, 4V1, 4W1).
(connection is only available only for devices with radial fan (3~AC 400 V)).
The fan rotates counterclockwise when viewed from above.
11 If the digital inputs for ON/OFF1 OR operating enable (X177 terminal 12 or 13) are not
used on the hardware side, they must be permanently supplied with +24 V.
Restoring the factory settings

The commissioning steps listed in “Commissioning using the BOP20 Operator Panel (Page 246)”,
“Commissioning using the AOP30 Operator Panel (Page 253)” and “Commissioning with the
STARTER commissioning tool (Page 259)” assume that all parameters are set to the factory
settings. This is the case when the device is initially shipped. If the parameters have already been
changed, or if you are not certain that all of the parameters are at their factory settings, then run
the "Restore factory setting" function!
With the basic operator panel BOP20:
(1)p0009 = 30
(1)p0976 = 1
SINAMICS DCM resets all of the parameters to the factory setting, and executes a power on.
The parameters must then be permanently saved by pressing the P button for a longer period
of time (at least 3 seconds, however until the display starts to flash).
8.2 Switching on
The drive runs up after the device is switched on (POWER ON) Running-up to operating state 7.0
in the SINAMICS DCM with the parameters saved (RAM to ROM was carried out) takes approx. 45
s. Power-up without the saved parameters (first commissioning) takes approx. 60 s.
Table 8-1 SINAMICS DCM ramp-up times
BOP20 display LED status CUD Ramp-up time 1)

Light on the BOP20 RDY: Red POWER ON
DP1: Red
- RDY: orange 15 s
DP1: -
Display "run up" RDY: orange 35 s
DP1: -
Operating state 12.4 RDY: Green 40 s
DP1: -
Operating state 7.0 RDY: Green 45 s
DP1: -
1)
Running-up with saved parameters (RAM to ROM was carried out)

Commissioning
8.3 Commissioning using the BOP20 Operator Panel
The status of the LEDs on the CUD (see also Chapter "Description of the LEDs on the CUD
(Page 609)") are only visible when the device cover is open.
Note
If options are being used (DCC, CBE20, SMC10, SMC30, TM15, TM31, TM150 etc.) and in the
case of certain device configurations, the duration of the run-up increases.
Note
If an external memory card with previously saved data is inserted into the drive during run-up,
the drive powers up based on the parameter assignments saved on the card (see also Chapter
"Memory card functions (Page 329)").
8.3.1 Requirements
Fundamentals of SINAMICS
If you are not yet familiar with SINAMICS basics (parameters, drive objects, BICO technology,
etc.), please read Chapter “Basic information (Page 321)” before starting commissioning.
BOP20 operator panel

If you are not yet familiar with the BOP20 operator panel, please read Chapter
"Parameterizing using the BOP20 (Basic Operator Panel 20) (Page 339)" before starting
commissioning.
Parameter notation
Expressed in full, a parameter consists of
the drive object + parameter number + index, with the following notation
(oo)pxxxxx[ii] for indexed parameters

(oo)pxxxxx for non-indexed parameters
To make these easier to read, in this chapter the drive object specification has been omitted
from all parameters belonging to the "Drive control" drive object (= drive object 2).
For example, the specification p50076[1] refers to parameter (2)p50076[1] (= drive object 2,
parameter 50076, index 1).

Commissioning
8.3.2 Commissioning steps
Note
Parameter with [D] depend on a data set. Commissioning must be carried out for each data set.
〈1〉Access authorization
In order to be able to set the access authorization, drive object 1 (DO1) must be activated at the
BOP20, see Chapter "Displays and operation with the BOP20 (Page 342)".
Access level
(1)p0003 = 1 Standard
(1)p0003 = 2 Advanced
(1)p0003 = 3 Expert
〈2〉Define the external power unit
p51819[0] Transformation ratio for armature voltage transformer

p51819[1] Transformation ratio for field voltage transformer
p51820 Rated armature supply voltage
p51821[0] Connection of line measurement cables
p51821[1] Connection of armature measurement cables
p51822 Rated armature DC current
p51823 Load voltage at rated armature current
p51824 Current transformer configuration
p51825 Type of power unit
p51826[0] Length of first pulse
p51826[1] Length of other pulses
p51829 Heat sink temperature threshold
p51830 Sensor for heat sink temperature
p51831 Fuse monitoring
p51832 Monitoring of device fan
p51833 External fault
p51834 Source of fan relay output
p51835[0] Monitoring of device fan's ON delay
p51835[1] Fault involving device fan's ON delay
p51835[2] Alarm involving device fan's ON delay
〈3〉Adjust the rated device currents

The rated armature DC current for the device must be adjusted by setting p50076[0] (in %)
or p50067 if:

Commissioning
Maximum armature current < 0.5 × rated armature DC current for the device
The rated field DC current for the device must be adapted by setting p50076[1] (in %) if:
Maximum field current < 0.5 × rated field DC current for the device
It is recommended to always adjust parameter p50076.x. As many display parameters in %
relate to the rated device current, these are re-standardized by adjusting the armature or field
current of the motor. This enables better interpretation of them, e.g. in the trace.
〈4〉Adjust to the actual device supply voltage
p50078[0] Rated value for armature supply voltage (in volts)

p50078[1] Rated value for field supply voltage (in volts)
〈5〉Enter the motor data

The motor data must be entered into the following parameters as specified on the motor rating
plate (see also the Chapter "Thermal overload protection for the DC motor (I2t monitoring of the
motor) (Page 562)" and "Speed-dependent current limiting (Page 567)").
'&02725 **1*99=
1R1 92 (1
:¦UPHNO7+&/ + ,3 ,0% *HZ:7 W
9 $ PLQ N:

S S
)UHPGHUU6(3$5$7((;&,79$ S
)UHPGN¾KOXQJ6(3$5&22/,1*P V /XIWULFKWXQJ
'LURI9HQWLODWLRQ
1'('(
%¾UVWHQ%586+(625'(5&2'(10$
%&a+=9
0$'(,1*(50$1<'18(51%(5*
Figure 8-1 Example of a rating plate
p2003 Rated torque = (kW x 9555) / rated speed

p50100[D] Rated armature current (in amperes)
p50101[D] Rated armature voltage (in volts)
p50102[D] Rated excitation current (in amperes)
p50104[D] Speed n1 (in rpm)
p50105[D] Armature current I1 (in amperes)
p50106[D] Speed n2 (in rpm)
p50107[D] Armature current I2 (in amperes)
p50108[D] Maximum operating speed n3 (in rpm)

Commissioning
p50109[D] 1 = Speed-dependent current limitation active

p50114[D] Motor thermal time constant (in seconds)
〈6〉Data for actual speed value acquisition
〈6.1〉Operation with analog tachometer

p50083[D] = 1 The actual speed value comes from the "Main actual value" (r52013) channel
(terminals XT.103, XT.104).
p50741[D] Tachometer voltage at maximum speed (– 270.00 to +270.00 V)
Remark:
The value set here determines the 100% speed for the closed-loop speed con‐
trol.
p2000 Speed in rpm for tachometer voltage set on p50741[0]
Comment 1:
Parameter p2000 is used to convert from a "physical speed" (rpm) into a "rel‐
ative speed" (%) and vice versa.
This conversion is required for:
• Speed setpoint input via the control panel in STARTER
• Speed setpoint input via the operating screen form at the AOP30
• Calculating the display values r020, r021, r060 and r063
Remark 2:
Parameter p2000 and parameters r020, r021, r060 and r063 are not data-set
dependent. This is the reason why the physical speed can only be displayed
correctly for one data set (DDS).
〈6.2〉Operation with pulse encoder

p50083[D] = 2 The actual speed value comes from a pulse encoder (r0061) connected to
terminal block X177.
p0400[0] Encoder type selection
p2000 Speed in rpm at 100% speed
Remark:
trol.
〈6.3〉Operation without tachometer (closed-loop EMF control)

p50083[D] = 3 The actual speed value comes from the "Actual EMF value" channel (r52287),
but is evaluated with p50115.
p50115[D] EMF at 100% speed
(1.00 to 140.00% of device rated supply voltage (p50078[0]))
Remark:
trol.

Commissioning
p2000 Speed in rpm for EMF set on p50115[0]

Comment 1:
Remark 2:
correctly for one data set (DDS).
〈6.4〉Freely-wired actual value

p50083[D] = 4 The actual value input is defined with p50609[C]
p50609[C] Number of the parameter that is switched to the actual speed controller value
p2000 Speed in rpm at which the parameter selected on p50609[0] accepts the value
100%
Comment 1:
Remark 2:
correctly for one data set (CDS).
〈6.5〉Operation with pulse encoder and SMC30

p50083[D] = 5 The actual speed value comes from a pulse encoder connected to an SMC30
(r3770).
p2000 Speed in rpm at 100% speed
Remark:
trol.
〈6.6〉Operation with resolver and SMC10

p50083[D] = 5 A DRIVE-CLiQ encoder supplies the speed actual value
p2000 Speed in rpm at 100 % speed
Comment:
The value set here defines the 100 % speed for the closed-loop speed control.

Commissioning
〈7〉Data for field
〈7.1〉Control of the field

p50082 = 0 Internal field is not used
(e.g. in the case of permanent-magnet motors)
p50082 = 1 The field is activated with the line contactor
(field pulses are activated or deactivated at the same time as the line contactor)
p50082 = 2 Automatic switching-in of the standstill field set using p50257 after a time that
can be parameterized using p50258 has elapsed, once operating state o7 or
higher has been reached
p50082 = 3 Field current permanently switched on
p50082 = 4 Field with Auxiliaries ON signal activated
〈7.2〉Field weakening
p50081 = 0 No speed-dependent or EMF-dependent field weakening
p50081 = 1 Field-weakening operation by means of internal closed-loop EMF control, i.e.
at speeds above the motor's rated speed (= "cut-in speed"), the motor EMF is
constantly kept at setpoint EMFset (r52289) = p50101 – p50100 x p50110
〈8〉Set basic technological functions
〈8.1〉Current limits
p50171[D] System current limit in torque direction I (as % of p50100)
p50172[D] System current limit in torque direction II (as % of p50100)
〈8.2〉Torque limits
p50180[D] Torque limit 1 in torque direction I
(as % of rated motor torque)
p50181[D] Torque limit 1 in torque direction II
(as % of rated motor torque)
〈8.3〉Ramp-function generator
p50303[D] Ramp-up time 1 (in seconds)
p50304[D] Ramp-down time 1 (in seconds)
p50305[D] Initial rounding 1 (in seconds)
p50306[D] Final rounding 1 (in seconds)
〈9〉Complete quick commissioning

Set p3900 = 3.
This triggers the calculation of the motor data (Ra, La, Lf) as well as the calculation of the
controller parameters resulting from the data that was entered in the previous steps.
p3900 is then reset to 0 and quick commissioning is ended, i.e. p0010 is reset to 0.

Commissioning
〈10〉Execute optimization runs

Perform the optimization runs one after the other:
p50051 = 23 Optimization of closed-loop armature current control for inductive load

p50051 = 24 Optimization of closed-loop field-current control
p50051 = 25 Optimization of closed-loop armature current control
p50051 = 26 Optimization of closed-loop speed control
p50051 = 27 Optimization of closed-loop EMF control (incl. field characteristic recording)
p50051 = 28 Recording the friction characteristic
p50051 = 29 Optimization of closed-loop speed control for drives with a mechanical system
capable of oscillation
For further details, see Chapter “Drive optimization (Page 308)”.
If an optimization run is not carried out, the motor control uses the motor characteristic
values calculated from the rating plate data instead of the measured values.
WARNING
Unexpected motor movement during optimization runs
Optimization runs cause movement of the drive which can result in death, severe injury or
material damage.
• Ensure that the EMERGENCY STOP functions are fully functional when commissioning the
drive.
〈11〉Checking and potential fine adjustment of maximum speed

Once the optimization runs have been executed, the maximum speed needs to be checked and,
if necessary, the setting for it corrected.
If the maximum speed has now shifted by more than around 10%, the control response
of the speed control loop will need to be checked; it may be necessary to repeat the
optimization run for the speed controller or carry out re-optimization manually.
The optimization run for field weakening and for friction and moment of inertia
compensation must be repeated if there is any change to the maximum speed.
〈12〉Checking the drive settings

The optimization runs do not produce the best results for every application, so in all cases it is
necessary to check the controller settings using the appropriate tools (oscilloscope, STARTER
trace, and so on). Some cases may require manual re-optimization.
〈13〉Manual (re-)optimization (where required)

If the result of the optimization runs is not satisfactory, then manual post or new optimization
can be performed.

Commissioning
8.4 Commissioning using the AOP30 Operator Panel
The procedure is described in Chapter "Manual optimization (Page 315)".
〈14〉Saving non-volatile set values

Previously, all changes in the set values were made in the RAM (Random Access Memory). If the
device is switched off in this state, all settings made previously are lost. To permanently store the
settings in the ROM (non-volatile memory), a RAM to ROM must be triggered by setting p0977
to 1 (p0977 is allocated to the DO 1). While data is being saved, the BOP20 flashes (and the
RDY‑LED on the CUD also flashes); this takes approx. 45 s. After the save operation the settings
are backed up in the ROM.
The drive can now be switched off (POWER OFF) without losing the settings that have been
made. See also Chapter "Memory card functions (Page 329)".
〈15〉Documentation of set values

The following facilities are available to document the executed settings outside the device:
• External memory card was inserted during the RAM to ROM (p0977 = 1). The parameters
were therefore also transferred to the external CompactFlash Card.
• Write the parameters to a CompactFlash Card (p0804).
• Document the parameters in a STARTER project (load to PG). See also Chapter "Memory card
functions (Page 329)" and "Commissioning with the STARTER commissioning tool
(Page 259)".
8.4.1 First commissioning
Note
To operate the AOP30, p2030=3 must be set.

Commissioning
8.4.1.1 Running-up for the first time
Start screen
When the system is switched on for the first time, the Control Unit (CUD) is initialized
automatically. The following screen is displayed:
Figure 8-2 Splash screen
While the system is powering up, the parameter descriptions are loaded to the operator
panel (remark: The memory card does not have to be inserted)
127(
/RDGSDUDPHWHUGHVFULSWLRQ
0% 50% 100%
3/($6(:$,7
) ) ) ) )
Figure 8-3 Loading of the parameter description during the system power-up
Selecting the language

When the system is first powered up, a screen for selecting the language appears.
You can select the language in the dialog

6SUDFKDXVZDKO/DQJXDJHVHOHFWLRQ screen.
(QJOLVK
'HXWVFK
)UDQ©DLV
(VSD³RO
To change the language, use <F2> or <F3>.
,WDOLDQR To select the language, use <F5>.
5XVVLDQ
) ) ) ) )
Once the language has been selected, the powering-up process continues.
Once the system has successfully powered up, the drive has to be commissioned when the
system is switched on for the first time after it has been delivered. The converter can then be
switched on.

Commissioning
When the system is then powered up again, it can be operated immediately.
Navigation within the dialog screens

Within a dialog screen, the selection boxes can usually be selected using the <F2> and/or <F3>
keys. Selection boxes are generally texts surrounded by a frame. When they are selected, they
are highlighted by means of white text on a black background.
The current value of a highlighted selection box can usually be changed by pressing <F5> "OK"
and/or "Change". Another entry field then appears; the value you want can be entered directly
in this using the numerical keypad or can be selected from a list.
In the wizard, you can change from a dialog screen to the next or previous screen by
selecting the "Continue" or "Back" selection boxes and then confirming by pressing <F5> "OK".
If a screen contains particularly important parameters, the selection box "Continue" only
appears at the bottom of the screen. This is because every single parameter in this dialog
screen has to be checked thoroughly and/or corrected before the next screen can be accessed.
8.4.1.2 Full drive commissioning
Entering power unit data
p51819[0] Transformation ratio for armature voltage transformer

p51819[1] Transformation ratio for field voltage transformer
p51820 Rated armature supply voltage
p51821[0] Connection of line measurement cables
p51821[1] Connection of armature measurement cables
p51822 Rated armature DC current
p51823 Load voltage at rated armature current
p51824 Current transformer configuration
p51825 Type of power unit
p51826[0] Length of first pulse
p51826[1] Length of other pulses
p51829 Heat sink temperature threshold
p51830 Sensor for heat sink temperature
p51831 Fuse monitoring
p51832 Monitoring of unit fan
p51833 External fault
p51834 Source of fan relay output
p51835[0] Monitoring of unit fan's ON delay
p51835[1] Fault involving unit fan's ON delay
p51835[2] Alarm involving unit fan's ON delay

Commissioning
Adjust the rated device currents

The rated armature DC current for the device must be adjusted by setting p50076[0] (in %)
or p50067 if:
Maximum armature current < 0.5 × rated armature DC current for the device
The rated field DC current for the device must be adapted by setting p50076[1] (in %) if:
Maximum field current < 0.5 × rated field DC current for the device
Adapt to the actual device supply voltage
p50078[0] Rated value for armature supply voltage (in volts)

p50078[1] Rated value for field supply voltage (in volts)
Acquiring the motor data

The motor data can be taken from the motor rating plate.
'&02725 **1*99=
1R1 92 (1
:¦UPHNO7+&/ + ,3 ,0% *HZ:7 W
9 $ PLQ N:

S S
)UHPGHUU6(3$5$7((;&,79$ S
)UHPGN¾KOXQJ6(3$5&22/,1*P V /XIWULFKWXQJ
'LURI9HQWLODWLRQ
1'('(
%¾UVWHQ%586+(625'(5&2'(10$
%&a+=9
0$'(,1*(50$1<'18(51%(5*
Figure 8-4 Example of a rating plate
p2003 Rated torque = (kW x 9555) / rated speed

p50100[D] Rated armature current
p50101[D] Rated armature voltage
p50102[D] Rated excitation current
p50103[D] Minimum excitation current (optional)
p50114[D] Thermal time constant for motor
See the section titled "Thermal overload protection for the DC motor (I2t mon‐
itoring of the motor)"
When you have finished entering the motor data, select "Next" below the final parameter
value and activate with <F5> (OK).

Commissioning
Encoder selection
p50083[D] Speed controller actual value selection
Analog tachometer screen
p50741[D] Tachometer voltage at maximum speed

p2000 Reference speed
Pulse encoder screen
p0400[E] Encoder type selection

p0404[E] Encoder configuration active
p0405[E] Square-wave encoder A/B
p0408[E] Rotary encoder pulse no.
EMF controlled screen
p50115[D] EMF at maximum speed

Freely wired screen
p50609[C] Speed controller actual value signal source

DRIVE-CLiQ encoder screen
p0400[E] Encoder type selection

p0404[E] Encoder configuration active
p0405[E] Square-wave encoder A/B
p0408[E] Rotary encoder pulse no.
Data on field
p50081 Field weakening

p50082 Field operating mode

Commissioning
Basic commissioning
p50171 Current limit, torque direction I

p50172 Current limit, torque direction II
p50180 Torque limit I
p50181 Torque limit II
p50303 Ramp-up time 1
p50304 Ramp-down time 1
p50305 Initial rounding 1
p50306 Final rounding 1
Final confirmation
Confirm the parameters you have entered to save them. Once you have selected "Next" and
activated your entries with <F5>, the parameters you entered will be permanently saved and the
calculations required for closed-loop control carried out.
Optimization runs
Perform the optimization runs one after the other:
To navigate through the selection boxes, choose <F2> or <F3>.
To activate a selection, choose <F5>.

p50051 = 27 Optimization of closed-loop EMF control (incl. field characteristic recording)
p50051 = 29 Optimization of closed-loop speed control for drives with a mechanical system
capable of oscillation
For further details, see Chapter "Drive optimization (Page 308)".
If an optimization run is not carried out, the motor control uses the motor characteristic
values calculated from the rating plate data instead of the measured values.
WARNING
material damage.
• When commissioning, carefully ensure that all shutdown functions and (if available) STO-/
SS1-t functions are fully functional.

Commissioning
8.5 Commissioning with the STARTER commissioning tool
8.4.2 Status after commissioning
LOCAL mode (control via operator panel)

• You switch to LOCAL mode by pressing the "LOCAL/REMOTE" key.
• Control (ON/OFF) is carried out via the "ON" and "OFF" keys.
• You can set the setpoint using the "Increase" and "Decrease" keys or by entering the
appropriate numbers on the operation screen using the numeric keypad.
8.4.3 Parameter reset to factory settings
The factory settings represent the defined original status of the device on delivery.
Resetting the parameters to the factory settings means that all the parameter settings made
since the system was delivered are reset.
Setting the parameter filter to "Parameter reset"

<MENU> <Commissioning/Service> <OK> <Device commissioning> <OK> <30: Parameter
Reset> <OK>
Restoring all parameters to their factory settings

All of the unit parameters are reset to their factory settings. The AOP30 is powered down and
back up again during this process.
8.5.1 STARTER commissioning tool
Description
You can use the STARTER commissioning tool to configure and commission your SINAMICS drives
or drive systems. The drive configuration can be performed with the aid of the STARTER wizard
for drive configuration.
Note
This chapter described how to commission with STARTER. STARTER has a comprehensive online
help that explains in detail all of the sequences and setting options in the system. This is the
reason that this chapter is restricted to the individual commissioning steps.

Commissioning
Prerequisites for installing STARTER

STARTER is installed on a PG / PC. The hardware and software preconditions are described in the
readme file for STARTER.
Note
The SIMOTION SCOUT engineering tool includes the STARTER functionality to commission drives.
From version V4.2, SCOUT has also been released for commissioning SINAMICS DCM.
8.5.1.1 Installing the STARTER commissioning tool

Download STARTER here: STARTER download (https://
support.industry.siemens.com/cs/de/en/ps/13437/dl).
STARTER is installed using the "setup" file. When you double-click the "Setup" file, the
installation wizard guides you through the process of installing STARTER.
8.5.1.2 Layout of the STARTER user interface

STARTER provides these 4 operating areas:
Figure 8-5 STARTER operating areas
Operating area Explanation

① Toolbars In this area, you can access frequently used functions by clicking icons.
② Project navigator The elements and objects contained in the project are displayed in this area.
③ Working area Changes to the drive units are made in this area.
④ Detail view This area displays detailed information, for instance about faults and alarms.

Commissioning
8.5.2 Procedure for commissioning with STARTER
Basic procedure when using STARTER

STARTER uses a series of interactive screens to enter the data required for the drive unit.
Note
The interactive screens are pre-assigned defaults that you need to adapt to your application and
configuration under certain circumstances.
This is a deliberate procedure!
Target: By taking time to consider what configuration data you enter, you can prevent
inconsistencies between the project data and drive unit data (identifiable in online mode).
8.5.2.1 Creating the project
Click the STARTER icon on the desktop, or select the menu command Start > Simatic > STEP 7 >
STARTER in the Microsoft Windows Start menu to open the STARTER commissioning tool.
The first time you run the software, the main screen shown below appears with the dialog
screen forms:
• STARTER Getting Started Drive Commissioning
• STARTER Project Wizard
The commissioning steps are listed below as numbered step sequences.

Commissioning
Accessing the STARTER project wizard
Figure 8-6 Main screen of the STARTER parameter assignment and commissioning tool
⇒ Hide "STARTER Getting Started Drive Commissioning" with HTML Help > Close
Note
When you deactivate the Display wizard during start checkbox, the project wizard is no longer
displayed the next time you start STARTER.
You can call up the project Wizard by choosing Project > New with Wizard.
To deactivate the Getting Started online help, follow the information provided in help.
Online help can be restarted at any time via Help > Getting Started.
STARTER features a detailed online help function.

Commissioning
The STARTER project wizard
Figure 8-7 STARTER project wizard
⇒ Click Arrange drive units offline... in the STARTER project wizard
Figure 8-8 Creating a new project
⇒ Enter a project name and, if necessary, the author, memory location and a comment.
⇒ Click Next > to set up the PG/PC interface.

Commissioning
Figure 8-9 Setting up the interface
⇒ Click PG/PC… and set up the interface according to your device configuration.
Buttons Properties..., Diagnostics... and Copy... are now available.
Set S7ONLINE as access point.
Note
Connection via PROFINET IO with CBE20
To establish the connection via the additional module CBE20, see Chapter "General information
about PROFINET IO (Page 464)".

Commissioning
Figure 8-10 Setting up the interface
Note
To parameterize the interface, you must install the appropriate interface card; e.g.: PC Adapter
(PROFIBUS).
We recommend that the Siemens USB PROFIBUS CP5711 adapter is used, order number
6GK1571-1AA00.

Commissioning
Figure 8-11 Setting the interface - properties
Note
PG/PC is the only master on bus must be activated if no other masters (PC, S7, etc.) are available
on the bus.
Note
Even if no PROFIBUS interface is installed in the PC, projects can be generated and PROFIBUS
addresses for the drive objects can be assigned.
Only the bus addresses available in the project will be offered. That prevents double bus address
assignments.
When required, a manual address entry can also be used to enter an already assigned address.
⇒ After completion, click OK to confirm the setup and to return to the project wizard.

Commissioning
Figure 8-12 Complete setting the interface
⇒ Click Next > to set up a drive unit in the project wizard.
Figure 8-13 Inserting a drive unit
⇒ Select the following data from the list fields:

Unit: SINAMICS
Type: DCM Standard CUD for one standard CUD in the left-hand slot
DCM Advanced CUD for one Advanced CUD in the left-hand slot
DCM Standard CUD [2] for a Standard CUD in the right-hand slot
DCM Advanced CUD [2] for an Advanced CUD in the right-hand slot
Version: actual version

Commissioning
Target device ad‐ the corresponding bus address of the drive (126 is preset in the drive
dress: device)
Name: Any desired name can be entered in the name box
Note
For a download, the bus address assigned here is transferred to the device, but is not transferred
to parameter p0918.
To keep p0918 consistent with the project, after a "Load to target device" a "Load to PG" must still
be performed – and must be repeated after every change to p0918 using BOP20 or AOP30.
Note
A second CUD for expanding the computing capacity is created in the STARTER as an
independent device, type "DCM Standard (Advanced) CUD [2]".
Explanation: "[2]" is the SINAMICS nomenclature for indexed data. In this case, it is used as a
name - independent of any language for a second CUD inserted in the right-hand slot.
⇒ Click Insert
The selected drive unit is displayed in the project wizard preview window.
Figure 8-14 Drive unit inserted
⇒ Click Next >

A summary of the project is displayed.

Commissioning
Figure 8-15 Summary
⇒ Click Complete to complete the creation of a new project for the drive unit.
8.5.2.2 Configuring a drive unit
Note
The STARTER must be offline for the sequence described below.
As a general rule, the drive unit can also be added to the project in online mode of the STARTER
via “Browse accessible nodes”.
In the project navigator, open the tree element that contains your drive unit.

Commissioning
Figure 8-16 Configuring the project navigator drive unit
⇒ In the project navigator, click the plus sign next to the drive unit that you want to
configure. The plus sign changes into a minus sign and the options for configuring the drive
unit appear as a directory tree under the drive unit.
⇒ Double click Configure drive unit

Commissioning
Activating the option module
Figure 8-17 Activating the option modules
⇒ If you have inserted a PROFINET CBE20 module (option G20), then the module needs to
be activated here (see Chapter "CBE20 Communication Board Ethernet (Page 306)").
⇒ Click Next >

Commissioning
Configuring the drive unit properties
Figure 8-18 Configuring the drive unit properties
Under Drive properties, you can enter optional information about the drive/project.
⇒ Click Next >

Commissioning
Selecting the function modules
Figure 8-19 Selecting the function modules
⇒ When required, select the function module that you wish to activate.
⇒ Click Next >

Commissioning
Selecting the device
Figure 8-20 Selecting the device
With the fields Supply voltage: and Range selection: (2-quadrant operation/4-quadrant
operation), you can filter the list under Select power unit: ...
You can find SINAMICS DCM Control Modules under 1000 V / 10000 A with article number
6RA8000-0MV62-0AA0.
⇒ Select the device.
⇒ Click Next >

Commissioning
Entering additional power unit data
Figure 8-21 Entering additional power unit data
⇒ Enter the required power unit data here.

⇒ Click Next >

Commissioning
Adapting device data and entering motor data
Figure 8-22 Adapting device data and entering motor data
⇒ Adapt the rated armature DC current for the unit by making a setting at p50076[0] (in %)
or p50067 if:
Maximum armature current < 0.5 × rated armature DC current for the unit
⇒ Adapt the rated armature DC current field for the unit by making a setting at p50076[1]
(in %) if:
Maximum field current < 0.5 × rated field DC current for the unit
⇒ Enter the actual supply voltage for the unit p50078.

Commissioning
⇒ Here, enter the motor data as a stamped on the motor rating plate.
Note
For 2Q devices, the rated DC voltage of the SINAMICS DCM specified in the technical data, can
only be achieved if the αG limit (p50150) is set to 5°. The factory setting is 30°. In order to reach
the rated motor voltage (p50101[D]), the αG limit must also be changed to 5°.
⇒ If you select speed-dependent current limiting, then in another setting form you can set
the required values (parameters p50104 ... p50109).
⇒ Click Next >
NOTICE
Ensure protection against overload
The data are very important for protecting against overload and must be entered correctly.

Commissioning
Configuring a motor brake
Figure 8-23 Configuring a motor brake
⇒ Under Configuration of the motor brake: select the appropriate setting for your device
configuration:
• [0] No brake
• [1] Holding brake
• [2] Operating brake
⇒ When selecting a motor brake, additionally set the opening time and the closing time.
⇒ Click Next >

Commissioning
Defining the actual value source
Figure 8-24 Defining the actual value source
"Encoder 1" is the encoder evaluation on the CUD.

"Encoder 2" is the evaluation of an optional encoder using SMC10 or SMC30.
⇒ Under n-controller act. val. selection, select the encoder type or the other actual value
source:
• [0] Selection deactivated
• [1] Analog tachometer
• [2] Pulse encoder
• [3] EMF actual value internal

Commissioning
• [4] Free interconnection via p50609

• [5] DRIVE-CLiQ encoder
The drive cannot be operated if no selection is made.
⇒ Enter the reference speed. To display on the AOP30 or to transfer the speed factors via
PROFIdrive, the physical speed at 100% is specified here.
The following settings are required, depending on the n-controller act. val. selection.
[1] Analog tachometer

The analog tachometer is connected to the CUD via terminals XT1-103, XT1-104.
⇒ Enter the tachometer voltage at maximum speed.
⇒ Click Continue >
[2] Pulse encoder

The pulse encoder is connected to the CUD via terminals X177:41 ... 48.
⇒ To select a predefined encoder configuration click on the radio button Select standard
encoder from list, and select one of the encoders that is listed.
The following encoder types can be evaluated via the CUD:
• [3001] 1024 HTL A/B R
• [3002] 1024 TTL A/B R
• [3003] 2048 HTL A/B R
• [3005] 1024 HTL A/B
• [3006] 1024 TTL A/B
• [3007] 2048 HTL A/B
• [3008] 2048 TTL A/B
• [3009] 1024 HTL A/B unipolar
⇒ To enter special encoder configurations, click the Enter data radio button and then the
Encoder data button. The following input screen is displayed for you to enter the required
data.

Commissioning
Figure 8-25 Entering encoder data - pulse encoder via CUD
⇒ Appropriately set the measuring system (predominantly "incremental HTL/TTL"), the

incremental tracks, the level and the zero marks.
NOTICE
Pulse encoder power supply at terminal X177.41 of the CUD
Terminal X177.41 always provides +15 V to supply the incremental encoder. This is
independent of the setting selected under voltage supply.
⇒ Click on OK
⇒ Click on Next >
[3] EMF actual value internal

⇒ Enter the EMF at maximum speed.
(the EMF should be specified as the percentage of the voltage specified in the screen form).
⇒ Click on Next >
[4] Free interconnection via p50609

⇒ Enter the source with the actual value via the BICO interconnection.

Commissioning
⇒ Click on Next >
[5] DRIVE-CLiQ encoder: Resolver via Sensor Module Cabinet SMC10

The resolver is connected via the Sensor Module Cabinet SMC10.
⇒ Select encoder 2 to activate the evaluation of the encoder via the Sensor Module Cabinet
SMC10.
The following resolvers can be evaluated via the Sensor Module Cabinet SMC10:
• [1001] resolver 1-speed
• [1002] Resolver 2-speed
data.
Figure 8-26 Entering encoder data - resolver via SMC10
⇒ Enter the pole pair number.

Commissioning
⇒ Click on OK
Note
Encoder configuration using the expert list
If the existing encoder type is not in the selection list, then the encoder must be manually
configured using the Expert list:
p0400[1] = 9999 (user-defined)
p0404[1] = (bit field)
⇒ Click on Next >
[5] DRIVE-CLiQ encoder: Pulse encoder via Sensor Module Cabinet SMC30
The pulse encoder is connected via the Sensor Module Cabinet SMC30.
⇒ Select encoder 2 to activate the evaluation of the encoder via the Sensor Module Cabinet
SMC30.
The following resolvers can be evaluated via the Sensor Module Cabinet SMC30:
• [3001] 1024 HTL A/B R
• [3002] 1024 TTL A/B R
• [3003] 2048 HTL A/B R
• [3005] 1024 HTL A/B
• [3006] 1024 TTL A/B
• [3007] 2048 HTL A/B
• [3008] 2048 TTL A/B
• [3020] 2048 TTL A/B R, with sense
• [3081] SSI, singleturn, 24 V
• [3082] SSI, multiturn 4096, 24 V
• [3088] 1024, HTL, A/B, SSI, singleturn
• [3090] 4096, HTL, A/B, SSI, singleturn
data.

Commissioning
Figure 8-27 Entering encoder data - pulse encoder via SMC30
⇒ Select the encoder connection (SUB-D /terminal).

⇒ Enter the required encoder data.
⇒ Click on OK
NOTICE
Material damage when selecting the incorrect encoder supply voltage
Once the encoder has been commissioned, the supply voltage (5 V / 13.5 - 30 V) set for the
encoder is activated on the SMC30 Module. If a 5 V encoder is connected and the supply voltage
has not been set correctly, the encoder may be damaged.
• Set the correct supply voltage for the connected encoder.
⇒ Click on Next >

Commissioning
Data on field
Figure 8-28 Data on field
⇒ Select the field control:

• [0] No field
• [1] Field also switched with the main contactor
• [2] Standstill field at >= o7.0 (factory setting)
• [3] Field is continuously switched on
• [4] Field also switched with signal auxiliaries ON
• [21] External field device, otherwise the same as position 1

Commissioning

⇒ Select whether the EMF-dependent field weakening should be activated or deactivated.
Note
If Field weakening is activated, then a valid field characteristic must be available (p50117 = 1),
otherwise, the optimization run for field weakening (p50051 = 27) must be carried out.
⇒ Depending on the selection under Field control, the values for field supply voltage,
standstill field (%) and delay time can be set.
⇒ Click Next >

Commissioning
Selecting process data exchange
Figure 8-29 Selecting process data exchange
⇒ Select the PROFIdrive telegram type.

• 1: Standard telegram 1, PZD-2/2
• 20: SIEMENS telegram 20, PZD-2/6

Commissioning

• 999: Free telegram configuration with BICO (default setting)
Note
If a standard telegram is selected, BICO interconnections are triggered which cannot be re-
parameterized. If, e.g. p0840 is to be changed again, a switchover to free telegram
configuration has to be made first.
⇒ Click Next >

Commissioning
Entering important parameters
Figure 8-30 Entering important parameters
⇒ If necessary, enter important technological parameters.
Note
Tooltips
STARTER provides tooltips if you position your cursor on the required field without clicking in
the field.
⇒ Click Next >

Commissioning
Summary
Figure 8-31 Summary
⇒ Use Copy text to clipboard to insert the summary of the data of your drive unit displayed
in the window for later use in text processing.
⇒ Click Finish.
⇒ Save your project on the hard disk with Project > Save.
8.5.2.3 Starting the drive project

You have generated a project and saved it to your hard disk. The next step is to transfer your
project configuration data to the drive unit.

Commissioning
Transferring a STARTER project to the drive unit

The following steps are required to transfer the STARTER project created offline to the drive unit:
• Step 1
Select the menu command Project > Connect to target system
Selection in the toolbar:
• Step 2
Select DCM_ADVANCED_CUD as drive unit in the following screen and confirm with OK:

Commissioning
Figure 8-32 Target device selection

Commissioning
• Step 3
Select the menu command Download:
Figure 8-33 Online/offline comparison
• Step 4
Activate the checkboxes if the DCC charts are also to be stored in the device and Copy RAM
to ROM is to be performed after the download.
Figure 8-34 Downloading to the target device

Commissioning
8.6 Activating function modules
Alternatively, the download to the target system can also be performed as follows:
• Step 1
Select the menu command Target system > Download > Project to target system
Selection in the toolbar
Note
Your project data has now been transferred to the drive unit. Presently, this data is only in the
volatile memory (RAM) of the drive unit, however, neither saved in the non-volatile memory
(ROM) nor on an optionally inserted memory card (see also Chapter “Memory card functions
(Page 329)”).
To save your project data in the ROM and on the optionally available memory card of your
drive unit so that it is protected against power failure, carry out the following steps.
• Step 2
Select the menu command Target system > Target system > Copy RAM to ROM
Selection in the toolbar
Note
The button for copying RAM to ROM can only be activated if the drive unit has been marked
in the project navigator.
Results of the preceding steps

• You have generated a project for your drive unit using the STARTER offline
• You have saved your project data to your PC hard drive
• You have transferred your project data to the drive unit
• You have saved your project data in your drive unit's FLASH memory so that it is backed up
in the event of a power failure

Subfunctions can be activated in the SINAMICS family drives as function modules.
Through activation, the parameters of the corresponding functionalities are also displayed.
Function modules can be individually activated / deactivated on every drive object.

Commissioning
For SINAMICS DCM, the following subfunctions are modeled as function module.
• Technology controller
• Free function blocks
• PROFINET interface
8.6.1 Offline activation via STARTER

Function modules can be set for all DOs by using the properties dialog (activate by right-clicking
the DO in the project navigator). Example shown for the closed-loop control DO “Drive_1”:
Figure 8-35 Properties
The function modules can be reached in the "Function modules" tab in the opening dialog.

Commissioning
Figure 8-36 Selecting the function modules
Accept the settings by clicking OK.

The function modules are also correspondingly set in the drive by connecting online and
downloading.
8.6.2 Online activation via parameters
Note
This process is not supported by STARTER because it uses its own mechanisms.

Commissioning
8.7 Commissioning optional additional modules
Activation is through p0108. r0108 and is available at each DO as a display parameter for the
activated function modules.
The setting is made on p0108[i] in the Control Unit. Here the index corresponds to the DO.
• Index 0 stands for the CU
• Index 1 stands for the first DO – in the default setting, for the closed-loop control DO DC_CTRL
• Index 2 stands for the optional first TMxx, etc.
Sub-function p0108 bit

Technology controller 16
Free function blocks 18
PROFINET interface 31
The function modules are activated/deactivated by setting the bits to "1" or "0".
On BOP20 or AOP30 parameter assignment is made at DO1 (CU_DC)
• p0009 = 2
• p0108[i] Set bits corresponding to "1" or "0"
• p0009 = 0
This triggers the firmware to reboot, therefore activating the function modules that have
been set - together with the associated parameters.
Note
Changing the parameter quantity structure is copied to the optional AOP30 by "relearning"
existing parameters. This takes a few minutes.

Additional modules can be integrated via DRIVE-CLiQ (TM15, TM31, TM150, SMC10, SMC30) -
or via the option slot of the Control Unit CUD (CBE20).
The components must be logged in to the firmware during a first commissioning.
That can be done:
• Offline by inserting the components into the project in STARTER and loading the project into
the drive
• By adding the components through the parameter assignments on BOP20 / AOP30

Commissioning
8.7.1 Terminal Modules (TM31, TM15, TM150)
8.7.1.1 Commissioning with STARTER
Requirement
The project must be consistent with the drive before adding the TMxx. Carry out "Load to the
PG" and then go offline.
An input/output component can only be inserted in the offline state.
Figure 8-37 Inserting input/output components
• Double-click "Insert input/output component".

Commissioning
Figure 8-38 Selecting input/output components
• Select the desired type.

• Overwrite the text in the "Name:" field with the name selected for the I/O component (e.g.
TM31_1).

Commissioning
• In the topology view, check at which interface of the Control Unit input/output components
should be connected, and connect them there.
[0] = X100, [1] = X101.
Figure 8-39 Topology
• Re-connect to the target device.

• Load the project into the drive with “Load to target device”.
• Persistently save with RAM→ROM.
• The LED on the Terminal Module now lights up green and you can access the parameters of
the additional DOs.
8.7.1.2 Commissioning via parameter assignment

With the electronics power supply switched-off, plug in the Terminal Module with DRIVE-CLiQ at
X100 or X101.

Commissioning
Accept the additional components by writing the following parameter to the CU.
Note
When powering up on a drive for the first time, the firmware will, if required, be loaded into the
Terminal Module. After successful loading, the LED on the TMxx flashes red/green and alarm
A1007 is output. A power ON is required before the components can be used.
p0009 = 1
p9910 = 1 (= accept component)
p0009 = 0
This triggers the firmware to reboot, and the additional components are accepted.
If you then go online with an old STARTER project, the different topologies will be displayed
offline and online. With "Load to PG" the changed topology can also be accepted by STARTER
8.7.2 Encoder evaluation (SMC10, SMC30)
When using the optional Sensor Module Cabinet SMC10, a resolver can be used as motor
encoder or as second encoder.
When using the optional Sensor Module Cabinet SMC30, a pulse encoder can be used as
motor encoder or as second encoder.
Subsequently adding or deleting an SMC10 or SMC30 to/from an existing project is only
possible with the STARTER commissioning tool.

Commissioning
8.7.2.1 Add/commissioning (with STARTER)

An encoder evaluation can only be inserted in the offline state.
• Double-click on "Configuration".
The drive configuration is shown in the operating area of Starter.
Figure 8-40 Configuration - drive data sets
EDS and DDS can be set and DDS copied in the lower part of the Drive data sets tab.
• CDS can be selected and copied under the Commander data sets tab:

Commissioning
Figure 8-41 Configuration - command data sets

Commissioning
• Click on button Configure DDS, the drive Wizard is displayed.

Continue to the "Encoder" screen and there activate encoder 2.
SMC10: Resolver
Figure 8-42 Selecting the resolver
SMC30: Pulse encoder

Commissioning
Figure 8-43 Selecting the pulse encoder
• To enter special encoder configurations, click the Enter data radio button followed by
the Encoder data button - and then enter the encoder data.
• If the encoder connected at the SMC10 or SMC30 is also used as actual value for the closed-
loop speed control, then under n-controller act. val. selection, select entry "[5] DRIVE-CLiQ
encoder".
• Work through the wizard up to the end and load the expanded project into the drive.

Commissioning
8.7.2.2 Removal (with STARTER)

An encoder evaluation can only be inserted in the offline state.
• Start the drive wizard via "Configuration" -> "Configure DDS..."
• Work through the wizard with Continue > to the "Encoder" screen form and there, select
encoder 2
• Work through the remainder of the wizard up to the end
• Withdraw the encoder evaluation SMC10 or SMC30
• Go online
• Load the project to the drive
8.7.3 CBE20 Communication Board Ethernet
8.7.3.1 Adding online into the drive

The CBE20 is automatically detected when plugged into the slot and is integrated into the
system.
Before the module can also be addressed in the network, an IP address and device name
must be assigned, see Chapter “Communication via PROFINET IO (Page 458)”.
Note
If PROFINET is to be used only as a commissioning interface but process control is through
PROFIBUS, after commissioning the CBE20, the process data interface needs to be set back to
PROFIBUS (p8839 = 1).

Commissioning
8.7.3.2 Adding offline in STARTER

In Starter, CBE20 is added when working through the drive wizard.
Figure 8-44 Activating the CBE20 option module
• Select the option module CBE20.

• Work through the wizard up to the end and load the expanded project into the drive.
• You can then access the parameters for the CBE20.
You can also subsequently activate option module CBE20.
• Start the configuration wizard via "Control Unit" -> Configuration" -> "Wizard..."
• In the "Option module" screen form, select CBE20

Commissioning
8.8 Drive optimization
• Go online
8.7.3.3 Deleting from the drive online

Removing a CBE20 without STARTER always leads to the loss of the parameter assignments
which are replaced by the factory settings.
p0009 = 30
p0976 = 1
(recent commissioning)
8.7.3.4 Deleting offline with STARTER

CBE20 can only be removed in the offline state.
• Start the configuration wizard via "Control Unit" -> Configuration" -> "Wizard..."
• In the "Option module" screen form, deselect CBE20
• Remove the CBE20 option board from the Control Unit
• Go online
Basic information
The individual control loops must be optimized when commissioning a drive.
4 control loops must be set or optimized:
• Field current closed-loop control
• Armature current closed-loop control
• Speed control
• EMF closed-loop control

Commissioning
SINAMICS DCM supports this task in 2 ways.

• Quick commissioning
The controller parameters are calculated from the rated data of the motor and the power
unit. No measurements are made. Only the parameters for the field current closed-loop
control, the armature current closed-loop control and the speed closed-loop control are
determined. The parameters set during the quick commissioning allow reliable drive
operation in the majority of cases.
• Optimization runs
The controller parameters are determined from the rated data of the motor and the power
unit and by evaluating measurement results. The parameters of all 4 control loops are
determined. The parameters set using the optimization runs can be kept in the majority of
cases. In exceptional cases, manual post-optimization is necessary (see the following
Chapter "Manual optimization").
Quick commissioning
NOTICE
Both drive optimization types assume that all of the parameters are at their factory
settings before the drive is optimized.
This is the case when the device is originally shipped. If the parameters have already been
changed, or if you are not certain that all of the parameters are at their factory settings, then
run the "Restore factory setting" function!
With the basic operator panel BOP20:
(1)p0009 = 30
(1)p0976 = 1
SINAMICS DCM resets all of the parameters to the factory setting, and executes a power on. The
parameters must then be permanently saved by pressing the P key for a longer period of time
(at least 3 seconds, however until the display starts to flash).
Procedure
• Start the quick commissioning with p0010 = 1 (= factory setting)
• Set all of the important parameters (see e.g. commissioning steps in Chapter
"Commissioning using the BOP20" operator panel)
• Complete the quick commissioning with p3900 = 3 (calculations are performed, p0010 and
p3900 are reset to 0)
Commissioning using the BOP20 operator panel:
This procedure is explicitly explained for the commissioning steps in Chapter "Commissioning
using the BOP20 Operator Panel (Page 246)".
Commissioning using the AOP30 operator panel:
Quick commissioning is completed (p3900 = 3) as part of the final confirmation. (See Chapter
"Full drive commissioning (Page 255)").
Commissioning using the STARTER commissioning tool:
The completion of quick commissioning (p3900 = 3) is selected as part of "Complete" of
the Wizard "Configuring the drive unit". (See Chapter "Configuring a drive unit (Page 269)").

Commissioning
After successfully "Loading the project into the target system" (see Chapter “Starting the drive
project (Page 290)”), quick commissioning is completed in the SINAMICS DCM.
Optimization runs
WARNING
material damage.
• When commissioning, carefully ensure that all shutdown functions and (if available) STO-/
SS1-t functions are fully functional.
Procedure
〈1〉 The drive must be in operating state o7.0 or o7.1 (enter SHUTDOWN!).
〈2〉 p50051 = 23 Optimization of closed-loop armature current control for inductive load
p50051 = 27 Optimization of closed-loop EMF control (incl. field characteristic re‐
cording)
p50051 = 29 Optimization of closed-loop speed control for drives with a mechanical
system capable of oscillation
〈3〉 The SINAMICS DCM Control Module goes into operating state o7.4 for a few seconds,
and then goes into o7.0 or o7.1 and waits for SWITCH ON and OPERATION ENABLE to
be entered.
Enter the commands SWITCH ON and OPERATION ENABLE!
If the switch-on command is not entered within 30 s, this wait state is exited and fault
message F60052 is output.
〈4〉 Execution of the optimization run starts once operating state <o1.0 (OPERATION) is
reached.
〈5〉 When the optimization run has been completed, the drive goes into operating state
o8.0
Note
The optimization runs should be performed in the order specified previously.

Commissioning
Details on the individual optimization runs

This optimization run sets the same parameters as for p50051 = 25. The opti‐
mization run uses an algorithm that is more suitable when it comes to feeding
large inductances than for the algorithm used with p50051 = 25. As a conse‐
quence, for applications where the SINAMICS DCM does not feed a motor - but
instead a lifting solenoid or the field of the synchronous generator - it is rec‐
ommended that instead of p50051 = 25 this optimization run is executed.
(duration of up to 1 min.)
This optimization run may also be executed without a mechanical load con‐
nected.
The following parameters are set automatically:
p50112, field resistance (Rf)
p50116, field inductance (Lf)
p50255, P gain of field-current controller (Kp)
p50256, integral time of field-current controller (Tn)
p51597 field inductance reduction factor
(takes about 1 min.)
The current controller optimization run may also be executed without a me‐
chanical load connected; if necessary, the drive should be locked.
p50110, armature resistance (Ra)
p50111, armature inductance (La)
p51591, non-linearity factor of armature inductance (La_fak)
p51592, armature commutation inductance (Lk)
p51594, filter inductance for 12-pulse operation (Ls)
p51595, filter inductance reduction factor (Ls_fak)
p51596 filter resistance in 12-pulse operation (Rs)
p50155 P gain of the armature current controller (Kp)
p50156, integral time of armature-current controller (Tn)
p50191 current setpoint filter time
WARNING
Electric shock during optimization run
The current limits set are not active during the current controller optimization run. 75 % of the
rated armature current of the motor flows for approximately 0.7 s.
If live components are touched then this can result in severe injury or death.
NOTICE
Lock motors
Motors with a permanent field, with a very high level of retentivity or a series field must be
locked during this optimization run.

Commissioning
Note
The parameters determined are dependent on the motor temperature. The values set with the
motor in the cold state can serve as a good default setting. For drives with a high dynamic
performance, the optimization run p50051=25 should be repeated after operating the drive
with a load (e.g. with the motor at the operating temperature).

(takes at least 6 s)
The dynamic response of the speed control loop can be selected using
p50236, whereby lower values represent a softer closed-loop control.
Before carrying out the speed controller optimization run, p50236 must be set
and influences the setting of p50225, p50226, p50228 and p50540.
Where possible, the final mechanical load should be connected to the motor
for the purpose of optimizing the speed controller, as the parameters set
depend on the measured moment of inertia.
The following parameters are automatically set:
p50225, P gain of speed controller (Kp)
p50226, integral time of speed controller (Tn)
p50228, speed setpoint smoothing time constant
p50540, speed controller acceleration time
Remark:
The speed controller optimization run only takes into account the filtering, set
using p50200, of the actual speed controller value and - if p50083 = 1 - the
filtering, set using p50745, of the main actual value.
p50225 (gain) is limited to a value of 30.00. The speed controller optimization
run always sets p50228 (speed setpoint filtering) to 0. If a Kp of 30.0 was
determined by the optimization run, manual re-optimization is recommended
(see Chapter "Optimizing the speed controller (Page 319)").
WARNING
Unexpected movement of the motor during optimization run
During the speed controller optimization run, the motor is accelerated at a maximum of 45%
of its rated armature current. The motor can reach speeds of up to approximately 20% of the
maximum speed.
The movements of the drive can result in death, severe injury or material damage.

Commissioning
p50051 = 27 Optimization of closed-loop EMF control (incl. field characteristic record‐

ing)
(duration, approx. 1 min)
This optimization run must be executed if field-weakening operation has been
selected (p50081 = 1), if closed-loop torque control (p50170 = 1) or torque
limiting (p50169 = 1) has been selected, or if a variable field current setpoint
has been entered.
This optimization run may also be started without a mechanical load. The
following parameters are set automatically:
p50120 to Field characteristic (magnetization characteristic) of motor
p50139
p50275 P gain of EMF controller (Kp)
p50276 Integral time of EMF controller (Tn)
Remark:
In order to determine the magnetization characteristic, during this optimization run the field-
current setpoint is reduced to a minimum value of 8% (starting from 100% of the motor's
rated excitation current as specified in p50102). Setting p50103 to values < 50% of p50102
for the duration of this optimization run limits the value entered for the field-current setpoint
to the minimum value specified in p50103. This may be necessary for uncompensated
motors with an extremely high armature response.
The magnetization characteristic approaches 0 along a linear path (starting from the
measuring point), with the minimum field-current setpoint.
To execute this optimization run, the minimum excitation current for the motor (p50103)
must be set to a lower value than 50% of the motor's rated excitation current (p50102).
WARNING
During this optimization run, the drive accelerates to approx. 80% of the rated motor speed.
The maximum armature voltage is 80% of the rated armature voltage of the motor (p50101).

Commissioning

(duration, approx. 1 min)
p50520 to Friction characteristic
p50530
Remark 1:
The friction characteristic is only active in operation if it is manually activated
with p50223 = 1!
Remark 2:
In order to execute this optimization run, the speed controller must not be
parameterized as a pure P controller or as a controller with droop.
WARNING
During this optimization run, the drive accelerates up to its maximum speed.
p50051 = 29 Optimization of closed-loop speed control for drives with a mechanical

system capable of oscillation
(duration up to 10 min)
p50225 P gain of the speed controller (Kp)
p50226 Integral time of the speed controller (Tn)
p50228 Speed setpoint, smoothing time constant
p50540 Speed controller acceleration time
The frequency response of the controlled system for frequencies between 1
and 100 Hz is recorded during this optimization run.
For this purpose, the drive is first accelerated to a basic speed (p50565, factory
setting = 20%). A sinusoidal speed setpoint with a low amplitude (p50566,
factory setting = 1%) is then switched in. The frequency of this additional
setpoint is changed in 1 Hz increments from 1 to 100 Hz. For each frequency,
an average is generated over a specific time (p50567, factory setting = 1 s).
The value set at p50567 essentially defines the duration of this optimization
run. For a setting of 1 s it takes about 3 to 4 min.
The measured frequency response of the controlled system forms the basis for
determining its optimal speed controller setting.

Commissioning
8.9 Manual optimization
WARNING
Uncontrolled motor movement
For motors with a suspended or drawing load, uncontrolled movement can occur during the
optimization run which can lead to death, serious injury or property damage.
• The optimization run must not be executed if the motor is connected to a mechanical load
that is able to move it while it is in a torque-free state (e.g. a suspended or drawing load).
Notes regarding optimization runs

For drives with limited travel distance, the optimization run for field weakening (p50051 = 27)
should be interrupted by entering the SHUTDOWN command at the earliest after the 1st field
weakening measuring point has been plotted or the friction characteristic has been plotted
(p50051 = 28) and at the earliest after determining the measuring point at 10% of the maximum
speed - without fault message F60052 being initiated. Once the optimization run in question
(p50051 = 27 or p50051 = 28) has been restarted, it will resume at a more advanced point,
meaning that it can be completed in several stages even in cases where the travel distance is
limited.
In the following cases, each optimization run is completely executed again after a restart:
• If a fault occurs during the optimization run
• If the electronic supply is switched off prior to restarting the optimization run in question
• If a different drive data set from the previous one is selected
• If a different optimization run is started in the meantime
The parameters for the drive data set that has been selected in each case are optimized.
The drive data set selection must remain the same throughout the optimization runs to avoid
a fault being output.

Manual optimization is best performed using the STARTER commissioning tool.
STARTER provides the following functions for this purpose:
• Function generator
• Trace

Commissioning
8.9.1 Optimization of closed-loop armature current control
Determining the armature circuit parameters (3 options)
1. Determining the armature-circuit parameters according to the motor list

Take the armature circuit resistance (p50110) and armature circuit inductance (p50111)
from the motor manufacturers data.
Disadvantage: The data is very imprecise and/or the actual values deviate significantly.
Feeder cable resistances are not taken in the armature-circuit resistance. Additional
smoothing reactors and feeder cable inductances are not taken into account in the arma‐
ture-circuit inductance.
2. Roughly estimating the armature-circuit parameters from the rated data for the mo‐
tor and line supply
S p50110 = Armature-circuit resistance [Ω]
S
[S p50101 = Rated armature voltage for motor [V]
p50100 = Rated armature current for motor [A]
The basis of this formula is that for the rated armature current, there is a drop of 10% of
the rated armature voltage across the armature circuit resistance Ra.
[U p50111 = Armature-circuit inductance [mH]
S
S r50071 = Rated armature supply voltage for units [V]
p50100 = Rated armature current for motor [A]
This formula is based on the empirical value: The transition point from discontinuous to
continuous current is approximately 30% of the rated motor armature current.
3. Determining the armature circuit parameters by measuring the current/voltage
• Establish closed-loop current controlled operation
- p50084 = 2: Select closed-loop current controlled operation
- p50153 = 0: Precontrol disabled
- p50082 = 0: Switch-off the field to prevent motor from moving and, where necessary,
lock the rotor of the DC motor if retentiveness is too high.
- p50354 = 5 %: Threshold for overspeed protection
- Enter 0 for the main setpoint.
- If "OPERATION ENABLE" has been applied and the "SHUTDOWN" command is entered,
an armature current of approximately 0% will now flow.
• Calculate the armature circuit resistance p50110 from the armature current and
armature voltage
- Gradually increase the main setpoint (shown at r52011) until the actual armature
current value (r50019 as a % of the unit's rated armature current) reaches approxi‐
mately 70% of the motor's rated armature current.
- Calculate the armature circuit resistance:
Ra[Ω] = r50038 / (r50019 × p50100) = armature voltage [V] / armature current [A]
• Calculate the armature circuit inductance p50111 from the armature current at
the transition point from discontinuous to continuous current
- Make an oscilloscope trace of the armature current.

Commissioning
- Starting from 0, gradually increase the main setpoint (shown at r52011) until the
armature current reaches the transition point from discontinuous to continuous cur‐
rent.
- Calculate the armature circuit inductance using the following formula:
La[mH] = 0.4 × r50015 / (r50019 × p50100)
= armature voltage [V] / armature current at the transition point from discontinuous
to continuous current [A]
Overall optimization of the armature circuit
• Checking the precontrol characteristic

Procedure
- Set the function generator to a triangular waveform (0 % to 100 %), period = 10000 ms
- Supply point: p50601[4] (see function diagram 6855)
- Set p50082 = 0 (field off)
- p50153 = 3 (influence of EMF disabled)
- Record signals r52121 (output, precontrol) and r52110 (output, armature current
controller)
- The parameters of the precontrol (Ra [p50110], La [p50111] and λa [p51591]) are
correctly set if the armature current controller output has the lowest possible value
(e.g. less than 5 %) over the complete setpoint range.
• Checking the step response
Procedure
- Set the function generator to a squarewave, with
step height = e.g. 5 %
offset = various values, e.g. 80 %
period = 1000 ms
pulse width = 500 ms
- Set p50082 = 0 (field off)
- Record signals r52118 (Ia-set) and r52117 (Ia-act)
- Change controller parameters Kp (p50155) and Tn (p50156) until the step response
provides a satisfactory result.
- In order to eliminate the influence of non-linearity of the armature circuit inductance
and gating unit, the armature current controller adaptation can be activated (see
function chart 6855).

Commissioning
8.9.2 Optimization of closed-loop field-current control
Determining the field circuit resistance (2 options)
1. Roughly estimate the field circuit resistance from the rated motor data
p50112 = rated excitation voltage/rated excitation current of motor
2. Determine the field-circuit resistance by comparing the field current setpoint and
actual value
- p50112 = 0: Results in a 180° field precontrol output and, therefore, field current
actual value = 0
- p50082 = 3: So that the field remains permanently switched on, even when the line
contactor drops out
- p50254 = 0 and p50264 = 0: Only field precontrol active; field-current controller
disabled
- Set p50102 to rated excitation current.
- Increase p50112 until the actual field current (r50035 converted to amperes using
r50073[1]) equals the required setpoint (p50102).
- Set p50082 back to the system's operating value.
Overall optimization of closed-loop field-current control
• Checking the precontrol characteristic

Procedure
- Set the function generator to a triangular waveform (0 % to 100 %), period = 10000 ms
- Set p50082 = 3 (field continuously on)
- Record the signals r52271 (output, precontrol) and r52260 (output, field current
controller)
- The parameters of the precontrol (Rf [p50112], Lf [p50116] and λf [p51597]) have
been correctly set if the output of the field controller has the lowest possible value
(e.g. less than 5 %) over the complete setpoint range.
• Checking the step response
Procedure
- Set the function generator to a squarewave, with
step height = e.g. 5 %
offset = various values, e.g. 80 %
period = 1000 ms
- Set p50082 = 3 (field continuously on)
- Record signals r52268 (If-set) and r52265 (If-act)

Commissioning
- Change controller parameters Kp (p50255) and Tn (p50256) until the step response
provides a satisfactory result.
- The field current controller adaptation can be activated (see function chart 6908) to
eliminate the influence of non-linearity of the field inductance and gating unit.
8.9.3 Optimizing the speed controller
Basic information
The objective of the closed-loop control is to compensate the system deviation as a result of
changes to the setpoint and disturbances.
The evaluation is performed in the time domain:
• The control loop fulfills the requirement for steady-state accuracy, if the system deviation as
a result of a setpoint step (reference input) converges towards zero. The rise time tan and
settling time taus specify the speed.
• The overshoot defines the damping. For a step change of the setpoint or disturbance
variable, the controlled variable must not excessively overshoot the steady-state final value.
'HFODUHG
WROHUDQFHEDQG 6\VWHP
2YHUVKRRW
GHYLDWLRQ
6HWSRLQW
&RQWUROOHGYDULDEOH
WDQ ULVHWLPH
WDXV VHWWOLQJWLPH
WDQ WDXV
Figure 8-45 Setpoint step to evaluate a controller
Controller optimization
Procedure
• Set the function generator to a triangular waveform with
step height = 5 %
offset = 10 %
period = 1000 ms
• Supply point: p50625[C] (see function diagram 6810)
• Record signals r52174 (n-set) and r52167 (n-act)
Assessment

Commissioning
If the step response of the speed controller is recorded after performing the optimization run
for the speed controller, then the significant increase of the setpoint step can be clearly seen
- which is characteristic for optimization according to the symmetrical optimum.
A controller adjusted according to the symmetrical optimum has a significant overshoot,
however, a favorable response to disturbances.
This optimization has especially established itself in drive technology as many systems
require a good disturbance variable compensation. This is the reason why the optimization
run for the speed controller sets the controller parameters according to the symmetrical
optimum.
An improved response to setpoint changes with the response to disturbances remaining
the same can be achieved using the reference model. See Chapter "Function descriptions",
Section "Speed controller".

Operation 9
9.1 Basic information
9.1.1 Parameter
Parameter types
The following adjustable and display parameters are available:
• Adjustable parameters (can be written and read)
These parameters have a direct effect on how a function responds.
Example: Ramp-up and ramp-down time of a ramp-function generator
• Display parameters (can only be read)
These parameters are used to display internal variables.
Example: Actual motor current
3DUDPHWHUV
UHDG U UHDGZULWH S
%,&2RXWSXW QRUPDO %,&2LQSXW QRUPDO

UHDGSDUDPHWHUV UHDGZULWHSDUDPHWHUV
Figure 9-1 Parameter types
All these drive parameters can be read via PROFIBUS and changed by means of p parameters
using the mechanisms defined in the PROFIdrive profile.
Parameter categories
The parameters of the individual drive objects are categorized into data sets as follows:
• Data set independent parameters
These parameters exist only once per drive object.
• Data set dependent parameters
These parameters can exist several times for each drive object and can be addressed via the
parameter index for reading and writing. A distinction is made between various types of data
set:
– CDS: Command Data Set
By parameterizing several command data sets and switching between them, the drive can
be operated with different pre-configured signal sources.
– DDS: Drive Data Set
The drive data set contains the parameters for switching between different automatic
speed control configurations.

Operation
The CDS and DDS can be switched over during normal operation. Additional types of data set
also exist, but these can only be activated indirectly by means of a DDS changeover.
• EDS - Encoder Data Set
7HUPLQDO0RGXOH
'ULYH
GDWDVHWLQGHSHQGHQW
GULYHSDUDPHWHUV
&'6&RPPDQG'DWD6HW
''6'ULYH'DWD6HW

(QFRGHUVHOHFWLRQ
(QFRGHUVHOHFWLRQ

('6(QFRGHU'DWD6HW
Figure 9-2 Parameter categories
Saving parameters in a non-volatile memory

The modified parameter values are stored in the volatile RAM. When the drive system is switched
off, this data is lost.
The data must be saved in the non-volatile memory, as described below, so that the changes
are available the next time the drive is switched on.
There are various methods:
• Save parameters using the BOP20:
press the P button on the BOP20 until the display flashes.
Flashing stops once the parameters have been saved.
• Saving parameters with STARTER
See "Copy RAM to ROM" function
• Saving parameters
p0977 = 1; automatically reset to 0
Note
The power supply to the Control Unit may first be switched off only after saving has finished
(i.e. after saving has started, wait until the parameter has the value 0 again).

Operation
Resetting parameters
The (loaded to the RAM) parameter values can be reset to the factory setting as follows:
p0009 = 30 Parameter reset

p0976 = 1 Start restoring all parameters to their factory settings
After this has been done, p0976 is automatically set to 0 and p0009 is set to 1.
The parameter values are reset in the volatile memory (RAM). If the reset parameter values
are also to be transferred into the ROM, then "Save parameters in a non-volatile memory"
must be executed.
Deleting all user data

User data includes:
• parameter values
• additional parameter data sets (see p0802, p0803, p0804)
• the DCC block library
• DCC charts
This data is saved in the non-volatile memory (ROM). All user data is deleted from the ROM
as follows:
p0009 = 30 Parameter reset

p0976 = 200 Start to delete all user data
The operation may take several minutes. The device automatically powers up during this
time. As a result, the device in STARTER goes offline. Re-connect with the drive. After this has
been done, p0976 is automatically set to 0 and p0009 is set to 0.
Note
Data on the memory card is not deleted by setting p0976 = 200. In spite of this, when deleting
all user data, it is not permissible that a memory card is inserted. An inserted memory card would
mean that for an automatic ramp-up after p0976 = 200, as usual, the data would be read from
the memory card (see also Chapter "Memory card functions"). The device would power-up with
the parameter assignment from the memory card.

Operation
Access level
The parameters are subdivided into access levels. The SINAMICS DCM List Manual specifies the
access level at which the parameter can be displayed and modified. The required access levels 0
to 4 can be set in p0003.
Table 9-1 Access levels
Access level Remark

0 User-defined Parameter from the user-defined list (p0013)
1 Standard Parameters for the simplest possible operations (e.g. p50303 = ramp-function
generator ramp-up time)
2 Extended Parameters for handling the basic functions of the device
3 Expert Expert knowledge is already required for these parameters (e.g. knowledge of
assigning BICO parameters).
4 Service Please contact your sales partner for the password for parameters with access
level 4 (Service). It must be entered into p3950.
9.1.2 Data sets
CDS: Command data set

The BICO parameters (binector and connector inputs) are grouped together in a command data
set. These parameters are used to interconnect the signal sources of a drive.
By parameterizing several command data sets and switching between them, the drive can be
operated with different pre-configured signal sources.
A command data set contains the following (examples):
• Binector inputs for control commands (digital signals)
– ON/OFF, enable signals (p0844, etc.)
– Jog (p1055, etc.)
• Connector inputs for setpoints (analog signals)
– Speed setpoint (p50433)
– Torque setpoints (p50500, p50501)
A drive object can manage two command data sets.
The following parameters are available for selecting command data sets and for displaying
the currently selected command data set:
• Binector input p0810 BI: Command data set (CDS) selection
• r0836: Displays selected data set

Operation
Example: Switching between command data set 0 and 1
&'6 U U &'6VHOHFWHG

S

W
6ZLWFKRYHUWLPH
&'6HIIHFWLYH U U
W
Figure 9-3 Switching the command data set (example)
DDS: Drive data set

A drive data set contains various adjustable parameters that are relevant for open-loop and
closed-loop drive control:
• Numbers of the assigned encoder data sets:
– p0187 and p0188: Up to 2 assigned encoder data sets (EDS)
• Various control parameters, e.g.:
– Speed limits min./max. (p50512, p50513)
– Characteristic data of ramp-function generator (p50295 ff)
– Characteristic data of controller (p50540 ff)
– ...
The parameters that are grouped together in the drive data set are identified in the
SINAMICS DCM List Manual by "DDS" and are provided with index [0...n].
It is possible to parameterize several drive data sets. You can switch easily between different
drive configurations (control type, motor, encoder) by selecting the corresponding drive data
set.
A drive object can manage 4 drive data sets.
Binector inputs p0820 and p0821 are used to select a drive data set. They represent the
number of the drive data set (0 to 3) in binary format (where p0821 is the most significant
bit).
• p0820 BI: Drive data set selection DDS, bit 0

Operation
EDS: Encoder data set

An encoder data set contains various adjustable parameters for the connected encoder that are
relevant for configuring the drive.
• Adjustable parameters, e.g.:
– Encoder interface component number (p0141)
– Encoder component number (p0142)
– Encoder type selection (p0400)
The parameters that are grouped together in the encoder data set are identified in the
parameter list by "EDS" and are provided with index [0...n].
A separate encoder data set is required for each encoder controlled by the Control Unit. Up to
2 encoder data sets are assigned to a drive data set via parameters p0187 and p0188.
It is only possible to switch an encoder data set by means of a DDS switchover. When a drive
data set is selected, the assigned encoder data sets are selected automatically.
Example of data set assignment
Table 9-2 Example, data set assignment
DDS Encoder 1 (p0187) Encoder 2 (p0188)

DDS 0 EDS 0 EDS 1
DDS 1 EDS 0 EDS 0
DDS 2 EDS 0 EDS 0
DDS 3 EDS 1 -
9.1.2.1 Function diagrams and parameters
Function diagrams (see the SINAMICS DCM List Manual)

• 8560 Command data sets (CDS)
• 8565 Drive data sets (DDS)
• 8570 Encoder data sets (EDS)
Overview of important parameters (refer to the SINAMICS DCM List Manual)

Adjustable parameters
• p0140 Encoder data sets (EDS) number
• p0170 Command data sets (CDS) number
• p0180 Drive data sets (DDS) number
• p0187 Encoder 1 encoder data set number
• p0188 Encoder 2 encoder data set number

Operation
• p0809 Copy command data set (CDS)

• p0810 BI: Command data set CDS bit 0
• p0819[0...2] Copy drive data set DDS
9.1.2.2 Handling data sets
Copying a command data set

Set parameter p0809 as follows:
1. p0809[0] = Number of the command data set to be copied (source)
2. p0809[1] = Number of the command data to which the data is to be copied (target)
3. p0809[2] = 1
Starts copying.
Copying is finished when p0809[2] = 0.
Copying a drive data set

Set parameter p0819 as follows:
1. p0819[0] = Number of the drive data set to be copied (source)
2. p0819[1] = Number of the drive data set to which the data is to be copied (target)
3. p0819[2] = 1
Starts copying.
Copying is finished when p0819[2] = 0.
Uncommissioned data sets

Drive commissioning can be completed even if uncommissioned data sets (EDS, DDS) are
available.
Uncommissioned data sets are marked as "uncommissioned".
The attributes are displayed in STARTER or in the expert list or OPs.
Activating of these data sets is not permitted and will be rejected with an error.
Assigning these data sets to a drive data set (DDS) is only possible with a commissioning step
(p0009 ≠ 0, p0010 ≠ 0).
Note
If there is no DDS dataset with the attribute "commissioned", the drive remains in a controller
inhibit state.

Operation
9.1.3 Drive objects

A drive object is a self-contained software function with its own parameters and potentially its
own faults and alarms. Drive objects can be provided as standard (e.g. automatic speed control),
or can be added individually or in groups times (e.g. TM31).
Properties of a drive object:
• Separate parameter space
• Separate window in STARTER
• Separate fault/alarm system
• Separate PROFIdrive telegram for process data
Drive objects in SINAMICS DCM
'ULYHREMHFWV
&RQWURO8QLW 'ULYHFRQWURO 7HUPLQDO 7HUPLQDO

(YDOXDWLRQRQERDUG,2 0RGXOH 0RGXOH
HYDOXDWLRQ HYDOXDWLRQ
SRZHUXQLW 7HUPLQDO 7HUPLQDO

0RGXOH 0RGXOH
Figure 9-4 Drive objects
• Automatic speed control (DC_CTRL)

Automatic speed control handles closed-loop control of the motor. The I/Os on the CUD are
evaluated within this drive object.
• Control Unit (CU_DC)
This drive object contains a variety of different system parameters.
• Evaluation of optional Terminal Module
An independent drive object handles evaluation of each optional Terminal Module.
Configuring drive objects

If, after first commissioning, additional drive objects are configured or deleted, they must be
added or deleted in STARTER or activated through parameters (see Chapter "Commissioning
optional additional modules (Page 297)").
Note
Each installed drive object is allocated a number between 0 and 63 during first commissioning
so that they can be identified internally.

Operation

Adjustable parameters
• p0101 Drive object numbers
• p0107 Drive object type
• p0108 Drive object configuration
Display parameters
• r0102 Number of drive objects
Standard drive objects

• Automatic speed control
• Control Unit
9.1.4 Memory card functions

This chapter describes the basic functions of the memory card in the SINAMICS DCM system.
Basic information
The CUD (Control Unit for the SINAMICS DCM) manages three memory areas:
• A volatile memory, the RAM, also called work memory
• A non-volatile memory, the ROM, also called flash memory
• An optionally available portable memory card
Note
Memory cards can be ordered as an option (S01/S02) or as accessories, see Chapter "Ordering
information for options and accessories (Page 32)".
The functionality in SINAMICS DCM is not guaranteed for memory cards from other
manufacturers.
SINAMICS DCM does not evaluate the position of the write protection slide switch.
Before removing the memory card from the slot, it is recommended that the "Safely remove
memory card" function is selected using p9400 = 2. Wait for p9400 = 3 ("Card can be safely
removed"). P9400 is set to 0 after the memory card has been removed ("No memory card
inserted").
The work memory receives all project information and application programs while the device
is being operated. To save the current data from the work memory, you must copy it to
non-volatile memory before switching off, see Chapter "Commissioning", "Copy RAM to ROM"
function.

Operation
An optional memory card is used:

• For saving various parameter data sets
• For transferring the parameter data sets to additional SINAMICS DCM drives
• For series commissioning
The memory card is required for the following applications:
• To install firmware updates
• To load the DCC block library into the drive
• To load additional languages to the AOP30 (with the exception of German, English and
Chinese)
• To store time-limited, triggered trace recordings (offline long-term trace)
• To save diagnostics file Diagstor.spd
• To communicate via Modbus TCP (see Chapter "Communication via MODBUS TCP
(Page 517)")
• To communicate via SINAMICS Link (see Chapter "Communication via SINAMICS Link
(Page 484)")
NOTICE
Undesirable response or data loss if the memory card is improperly handled
For disturbance-free operation of the control electronics (CUD), the memory card
recommended by Siemens must only be inserted in the device when the SINAMICS DCM is
switched-off and in a no voltage condition. Inserting the card when operational can result in
undefined states of the device with the corresponding effects.
Ideally, the memory card is ordered when purchasing the SINAMICS DCM, and is installed
before commissioning.
If the memory card is not inserted from the very beginning, and is only inserted after being
requested to do so, for example by Technical Support, then it must first be completely cleared.
This prevents that data possibly saved on the memory card overwrites the actual parameter
assignment of the DCM.
To avoid data loss when removing the memory card, it must be logged off from the device as
described in Section "Safely removing the memory card".
Note
The memory card supplied from Siemens as option S01 or S02 includes, when supplied, a dump
of the internal device firmware. These files are required to update the firmware as well as to use
the "SINAMICS Link" function. These files can be deleted for other applications.
Before you use the card for the functions described in this chapter, copy these files to a local
folder of your PG/PC and delete the files on the memory card.
Safely removing the memory card

Removing the memory card must be requested using p9400.

Operation
Procedure:
p9400 = 2 Request "Safe removal" of the memory card

p9400 = 3 Feedback signal: "You can safely remove the memory card"
Remove the memory card
p9400 = 100 Feedback signal: "It is not possible to safely remove the memory card"
SINAMICS DCM is accessing the memory card. Leave the memory card in the unit and try again
later.
p9400 = 0 Message: no memory card inserted
Note
If the memory card is removed without a request being made, this can destroy the file system on
the memory card.
Parameter data sets

Parameter data sets represent all of the parameters of a project - including the DCC charts and
the project itself. Parameter data sets differ on the basis of drive configuration (power unit,
motor, encoder, etc. used) and application (e.g. function modules, control mode).
Different data volumes can be saved in the three memory areas:
• ROM: Four parameter data sets with the indices 0, 10, 11, and 12
• The parameter data set with the index 0 is active in the RAM
• Memory card: Depending on the free storage space, up to 101 parameter data sets (indices
0 to 100)
Note
The DCC library itself is not saved as a part of the parameter data set.

Operation
Copying parameter data sets to the memory card

There are three options for copying parameter data sets to the memory card:
• The electronics power supply is switched off
– Insert the memory card that does not contain a parameter data set with index 0 into the
CUD.
– Switch on the electronics power supply
– The parameter data set with index 0 is loaded from the ROM into the RAM
– Then the complete and updated parameter data set with the index 0 is automatically
copied to the memory card without a prompt.
• The electronics power supply is switched on
– Execute command "RAM to ROM" (using p0977 = 1 - or by pressing the "P" key on the
BOP20 operator panel until the display starts to flash). The actual parameter data set is
copied automatically, first to the ROM and then to the memory card with index 0. If the
memory card already contains a parameter data set with the index 0, this will be
overwritten without a prompt appearing.
– The save operation is initiated via parameter:
p0802 = 0 ... 100: Target on the memory card
p0803 = 0/10/11/12: Source in the device memory
p0804 = 2: Start data transfer
Note
If when switching on, a memory card with a parameter data set with index 0 is inserted in the
CUD, the parameter data set with index 0 in the non-volatile memory of the CUD is overwritten
with the parameter data set with index 0 on the memory card.
Note
When a memory card is inserted, the RAM to ROM command (p0977 = 1) will copy the parameter
data set with the index 0 from the ROM to the memory card. A parameter data set that might
have been previously saved on the memory card is overwritten.
Note
While saving (BOP20 flashes, RDY LED flashes), the electronic power supply must NOT be
switched off. Switching off while saving leads to the loss of the most recently performed and not
yet saved device parameterization.
Note
When options are being used (DCC, SMC10, SMC30, TM15, TM31, TM150 etc.) and with certain
device configurations, storage can take several minutes.

Operation
Copying parameter data sets from the memory card to non-volatile memory
There are two ways of copying parameter data sets from the memory card to non-volatile
memory:
• The electronics power supply is switched off
– Insert a memory card containing a parameter data set with the index 0 into the CUD.
– Switch on the system. The new parameter data is copied to the RAM, and then "RAM to
ROM" is automatically executed. The parameter data set with the index 0 which was
previously in the ROM will be overwritten.
– The system will then boot with the new parameter data set.
– The save operation is initiated via parameter:
p0802 = 0 ... 100: Source on the memory card
p0803 = 0/10/11/12: Target in the device memory (ROM)
p0804 = 1: Start data transfer
&RQWURO8QLW&8'
520 3RZHU 5$0
2Q
3'6 6DYH
,PSRUW
6DYH
3RZHU2Q

([SRUW 3'6

3RZHU2Q 3'6

① Memory card available: PDS 0 is copied to the card in parallel

② p0802 = 20; p0803 = 0; p0804 = 1
③ p0802 = 20; p0803 = 0; p0804 = 2
④ For POWER ON, no PDS 0 on the card: PDS 0 is copied from the ROM to the memory card
⑤ At POWER ON, PDS 0 on the card: PDS 0 is copied to the ROM
⑥ Memory card
PDS = parameter data set
Figure 9-5 Copying parameter data sets

Operation
Note
The parameter data set in the ROM is overwritten when the system starts. If a memory card with
a parameter data set is inserted when the system is switched on, the parameter data set with the
index 0 in the ROM will be overwritten by the new one with the index 0 on the memory card.
Using the memory card for series commissioning

The memory card can also be used for series commissioning of several devices with the same
parameter assignment.
Procedure:
1. Completely commission a "sample" drive. As soon as all of the parameters have been correctly
set, carry out "RAM to ROM".
2. Switch off the system and insert an empty memory card into the CUD. Switch on the system.
3. The parameter assignment is saved on the memory card. If DCC charts are activated in the
system, then these as well as the DCC library are also saved on the memory card.
4. Remove the card.
5. Insert the card into a CUD that is switched-off and has still not been parameterized. Switch on
the system (POWER ON).
6. When running up, the parameter assignment is transferred into the CUD and copied into the
ROM as well as into the RAM. If DCC charts and the DCC library were saved on the memory
card, then these are also copied.
7. The card can be removed once the system has run up. The CUD that was still not
parameterized now has the same parameter assignment as the original "sample" drive.
Note
The Article number of the device, from which the parameter data set originated, is also saved in
a parameter data set. If the parameter data set is loaded to a device with a different article
number (POWER ON with the memory card inserted), then the device signals an inconsistent
topology (running up stops with display "33" on the BOP, alarm A01420 is output). This occurs,
if e.g. a parameter set that was generated from a 30 A device is loaded into a 60 A device. In this
state, the user can accept the parameter set by setting p9906 = 3. Ramp-up is continued.
The same procedure also applies if a parameter data set from a standard CUD is loaded into an
Advanced CUD - or vice versa. The power-up procedure stops with display "33" on the BOP; the
parameter set is accepted using p9906 = 3 and the system continues to run up.
When using an Advanced-CUD, the IP address of the CBE20 is not accepted. This must be
subsequently set and assigned, e.g. using Proneta or STARTER "Accessible nodes", context "Edit
Ethernet node".

Operation
Important parameters
p0977: Save all parameters, for details see the SINAMICS DCM List Manual.
p0802: Data transfer of parameters [0,10,11,12], memory card as source or target
p0803: Data transfer of parameters [0...100], non-volatile device memory as source or tar‐
get
p0804: Start of parameter data transfer and specification of transfer direction:
p0804 = 1: Transfer from the memory card to non-volatile device memory
p0804 = 2: Transfer from non-volatile device memory to memory card
9.1.5 BICO technology: Interconnecting signals
Every drive contains a large number of interconnectable input and output variables and internal
control variables.
The drive unit can be adapted to a wide range of requirements using BICO technology
(Binector Connector Technology).
Digital and analog signals, which can be interconnected as required by means of BICO
parameters, are identified by the prefix BI, BO, CI, or CO in their parameter name.
These parameters are identified accordingly in the parameter list or in the function diagrams.
Note
The STARTER commissioning tool is recommended when using BICO technology.
9.1.5.1 Binectors, connectors
Binectors, BI: Binector input, BO: Binector output

A binector is a digital (binary) signal without a unit which can assume the value 0 or 1.
Binectors are subdivided into binector inputs (signal sink) and binector outputs (signal
source).
Table 9-3 Binectors
Abbreviation Symbol Name Description

BI Binector input Can be interconnected to a binector output as
source.
(signal sink) The number of the binector output must be en‐
tered as a parameter value.
BO Binector output Can be used as a source for a binector input.
(signal source)

Operation
Connectors, CI: Connector input, CO: Connector output

A connector is a digital signal, e.g. in 32-bit format. It can be used to emulate words (16 bits),
double words (32 bits) or analog signals. Connectors are subdivided into connector inputs
(signal sink) and connector outputs (signal source).
Table 9-4 Connectors
Abbreviation Symbol Name Description

CI Connector input Can be interconnected to a connector output as
source.
(signal sink) The number of the connector output must be
entered as a parameter value.
CO Connector output Can be used as a source for a connector input.
(signal source)
9.1.5.2 Interconnecting signals using BICO technology

To interconnect two signals, a BICO input parameter (signal sink) must be assigned to the desired
BICO output parameter (signal source).
The following information is required to connect a binector/connector input to a binector/
connector output:
• Binectors: Parameter number, bit number, and drive object ID
• Connectors with no index: Parameter number and drive object ID
• Connectors with index: Parameter number, index, and drive object ID
• Data type (signal source for connector output parameter)
%2%LQHFWRURXWSXW %,%LQHFWRULQSXW
&2&RQQHFWRURXWSXW &,&RQQHFWRULQSXW
6LJQDOVRXUFH 6LJQDOVLQN
%,
%2 S[[[[\
U
&,
&2 ZLWKRXWLQGH[ S[[[[\
U
&2 ZLWKLQGH[
,QGH[ >@ U &,
>@ U S[[[[\
>@ U >@
>@ U
>@ U
Figure 9-6 Interconnecting signals using BICO technology

Operation
Note
A connector input (CI) cannot be just interconnected with any connector output (CO, signal
source). The same applies for binector input (BI) and binector output (BO).
For each CI and BI parameter, the parameter list shows under "data type" the information on the
data type of the parameter and the data type of the BICO parameter.
For CO parameters and BO parameters, only the data type of the BICO parameter is shown.
Notation:
Data types BICO input: Data type parameter/Data type BICO parameter
Example: Unsigned32 / Integer16
Data types BICO output: Data type BICO parameter
Example: FloatingPoint32
The possible interconnections between the BICO input (signal sink) and BICO output (signal
source) are listed in the table titled "Possible combinations for BICO interconnections", which can
be found in the "Explanations on the parameter list" section of the SINAMICS DCM List Manual.
The BICO parameter interconnection can be implemented in different command data sets
(CDS). The different interconnections in the command data sets are activated by switching
data sets. Interconnections across drive objects are also possible.
9.1.5.3 Internal encoding of the binector/connector output parameters

Internal encoding is required for writing BICO input parameters via PROFIBUS, for example.
'ULYH
3DUDPHWHUQXPEHU ,QGH[QXPEHU
REMHFW
%LW ಹ ಹ ಹ
'HYLFHVSHFLILF &8'
REMHFW
([DPSOHVRIVLJQDOVRXUFHV
ELQ ELQ ELQ
)&KH[ൺ&2>@
GHF GHF GHF
ELQ ELQ ELQ KH[ൺ)HVWHರರ
ELQ ELQ ELQ KH[ൺ)HVWHರರ
Figure 9-7 Internal encoding of the binector/connector output parameters

Operation
9.1.5.4 Example: Interconnecting digital signals

A drive should be operated via terminals DI 0 and DI 3 on the CUD using jog 1 and jog 2.
%2%LQHFWRURXWSXW %,%LQHFWRULQSXW
6LJQDOVRXUFH 6LJQDOVLQN
9
S&
; ', -RJJLQJ
U
S&
; ', -RJJLQJ
U
9
S&
; ', ,QWHUQDO -RJJLQJ
U
S&
; ', ,QWHUQDO -RJJLQJ
U
Figure 9-8 Interconnecting digital signals (example)
9.1.5.5 Notes on BICO technology
Binector-connector converters and connector-binector converters
Binector-connector converter
• Several digital signals are converted to a 32-bit integer double word or to a 16-bit integer
word.
• p2080[0...15] BI: PROFIdrive PZD send bit-serial
Connector-binector converter
• A 32-bit integer double word or a 16-bit integer word is converted to individual digital signals.
• p2099[0...1] CI: PROFIdrive PZD selection receive bit-by-bit
Fixed values for interconnection using BICO technology

The following connector outputs are available for interconnecting any fixed value settings:
• p2900[0...n] CO: Fixed value_%_1
• p2901[0...n] CO: Fixed value_%_2
• p2930[0...n] CO: Fixed value_M_1
Example:
These parameters can be used to interconnect the scaling factor for the main setpoint or to
interconnect an additional torque.

Operation
9.2 Parameterizing using the BOP20 (Basic Operator Panel 20)
9.2.1 General information on BOP20

The BOP20 can be used to power drives up and down during the commissioning phase as well
as display and modify parameters. Faults can be diagnosed as well as acknowledged.
Overview of displays and keys

'ULYH1R
581
6 3 &
Figure 9-9 Overview of displays and keys
Information on the displays
Table 9-5 Displays
Display Meaning
Top left The active drive object of the BOP is displayed here.
2 digits The displays and key operations always refer to this drive object.
RUN Is displayed, if at least one drive in the drive line-up is in the RUN state (in operation).
RUN is also displayed via bit r0899.2 of the drive.
Top right The following is displayed in this field:
2 digits • More than 6 digits: Characters that are still present but invisible (e.g. "r2" ––> 2 characters to the
right are invisible, "L1" ––> 1 character to the left is invisible)
• Faults: Selects/displays other drives with faults
• Marking of BICO inputs (bi, ci)
• Marking of BICO outputs (bo, co)
• Source object of a BICO interconnection with a drive object different than the active one
S Is displayed if at least one parameter was changed and the value has not yet been transferred to the
non-volatile memory.
P Is displayed if, for a parameter, the value only takes effect after the P key is pressed.
C Is displayed if at least one parameter was changed and the calculation for consistent data manage‐
ment has still not been initiated.
Bottom 6 digits Displays. parameters, indices, faults, and alarms, for example
The currently displayed Saving "RAM to ROM" is active (e.g. initiated by p0977 = 1 or by pressing the P key for a longer period
characters flash at 1 Hz of time (3 s))

Operation
Note
• The RDY LED flashes (see the "Description of functions" chapter, "Description of the LEDs on
the CUD" section)
Interrupting the electronic power supply while saving can lead to the loss of the actual device
parameter assignment. Also refer to Chapter "Operation", Section "Memory card functions".
For certain user actions (e.g. restore factory setting) a two-digit number is displayed on the
BOP20. This number provides information about the drive state. The significance of these
numbers is provided in Appendix B.
Information on the keys
Table 9-6 Keys
Key Name Meaning

ON Power up the drives for which the "ON/OFF1" command should come from the BOP.
Binector output r0019.0 is set using this key.
OFF Switch off the drives for which the "ON/OFF1", "OFF2", or "OFF3" commands should come from the
BOP.
Binector outputs r0019.0, .1 and .2 are simultaneously reset when this key is pressed. After the key
has been released, binector outputs r0019.1 and .2 are again set to a "1" signal.
Note:
Whether these keys are active can be defined by assigning appropriate BICO parameters (e.g. it is
possible to use these keys to control all of the existing drives at the same time).
Functions The meaning of these keys depends on the current display.
Note:
The effectiveness of this key to acknowledge faults can be defined via BICO parameterization.
Parameter The meaning of these keys depends on the current display.
If this key is pressed for 3 s, the "Copy RAM to ROM" function is executed. The "S" displayed on the BOP
disappears.
Increase The keys depend on the current display and are used to either increase or decrease values.
Decrease

Operation
BOP20 functions
Table 9-7 Functions
Name Description
Backlighting The backlighting can be set using p0007 in such a way that it switches itself off automatically after
the set time if no actions are carried out.
Switch active drive From the BOP perspective, the active drive is defined using p0008 or using the keys "FN" and
"Arrow up".
Units The units are not displayed on the BOP.
Access level The access level for the BOP is defined using p0003.
The higher the access level, the more parameters can be selected using the BOP.
Parameter filter Using the parameter filter in p0004, the available parameters can be filtered according to their
particular function.
Select status display Actual values and setpoints are displayed on the status display.
The status display can be set via p0006.
User parameter list Parameters can be selected for access using the user parameter list in p0013.
Hot swapping The BOP can be unplugged and plugged while energized.
• The ON and OFF keys have a function.
When unplugging, the drives are stopped.
After plugging, the drives must be switched on again.
• The ON and OFF keys have no function
Unplugging and plugging has no effect on the drives.
Key operation The following applies to the "P" and "FN" keys:
• When used in a combination with another key, "P" or "FN" must be pressed before the other key.
All drive objects

• p0005 BOP status display selection
• p0006 BOP status display mode
• p0013 BOP user-defined list
• p0971 Drive object, save parameters
Drive object, Control Unit (CU_DC)

• r0002 Control Unit status display
• p0003 BOP access level
• p0004 BOP display filter
• p0007 BOP backlighting
• p0008 BOP drive object selection
• p0009 Device commissioning, parameter filter
• p0011 BOP password input (p0013)
• p0012 BOP password confirmation (p0013)

Operation
• r0019 CO/BO: Control word, BOP

• p0977 Save all parameters
Drive object (DC_CTRL)

• p0010 Commissioning, parameter filter
9.2.2 Displays and operation with the BOP20
Features
• Status display
• Changing the active drive object
• Displaying/changing parameters
• Displaying/acknowledging faults and alarms
• Controlling the drive using the BOP20
Operating display
The operating display for each drive object can be set using p0005 and p0006. Using the
operating display, you can change into the parameter display or to another drive object. The
following functions are possible:
• Changing the active drive object
– Press the "FN" and "Arrow up" keys -> the drive object number at the top left flashes
– Select the required drive object using the arrow keys
– Confirm with the "P" key
• Parameter display
– Press the "P" key
– The required parameter can be selected using the arrow keys
– Press the "FN" key -> "r00000" is displayed
– Press the "P" key -> returns to the status display

Operation
Parameter display
The parameters are selected in the BOP20 b their number. The parameter display is reached from
the operating display by pressing the "P" key. Parameters can be searched for using the arrow
keys. The parameter value is displayed by pressing the "P" key again. You can toggle between the
drive objects by simultaneously pressing the "FN" key and an arrow key. You can toggle between
"r00000" and the parameter that was last displayed by pressing the "FN" key in the parameter
display.
6WDWXVGLVSOD\

RU
9DOXHGLVSOD\
3DUDPHWHUGLVSOD\
3$GMXVWDEOHSDUDPHWHUV
LQLQGH[HG
U0RQLWRULQJ
SDUDPHWHU
%LQHFWRUSDUDPHWHU
EL%LQHFWRULQSXW
ER%LQHFWRURXWSXW
FL&RQQHFWRULQSXW
FR&RQQHFWRURXWSXW
<RXFDQVZLWFKEHWZHHQUDQGWKHSDUDPHWHUWKDWZDVODVWGLVSOD\HGE\SUHVVLQJ
WKH)1NH\LQWKHSDUDPHWHUGLVSOD\
Figure 9-10 Parameter display

Operation
Value display
To switch from the parameter display to the value display, press the "P" key. In the value display,
the values of the adjustable parameters can be increased and decreased using the arrow. The
cursor can be selected using the "FN" key.
'HFLPDOQXPEHU
HJS
,QWHJHU
HJS

'HFLPDOQXPEHU
HJU
7LPH
HJU
KPVPV
++H[DGHFLPDOQXPEHU
[$)%
FKDQJLQJWKHFRPSOHWHQXPEHU
&XUVRU FKDQJLQJDQLQGLYLGXDOGLJLW
GLVSOD\LQJWKHRULJLQDOYDOXH
Figure 9-11 Value display

Operation
Example: Changing a parameter

Requirement: The appropriate access level is set
(for this particular example, p0003 = 3).
[
3DUDPHWHUGLVSOD\
[ [
9DOXHGLVSOD\
Figure 9-12 Example: Changing p0013[4] from 0 to 300

Operation
Example: Changing binector and connector input parameters

For the binector input p0840[0] (OFF1) of drive object 2 binector output r0019.0 of the Control
Unit (drive object 1) is interconnected.
[

Figure 9-13 Example: Changing indexed binector parameters

Operation
9.2.3 Displaying faults and alarms

Displaying faults
$FNQRZOHGJH
DOOIDXOWV
))DXOW
2QHIDXOWIURPWKH
GULYHREMHFW
1H[W
IDXOW
0RUHWKDQRQHIDXOW
IURPWKHGULYHREMHFW
2QHIDXOWIURPDGLIIHUHQWGULYH
REMHFWWKDQWKHDFWLYHRQH
'ULYHQR
0RUHWKDQRQHIDXOWIURPWKH IODVKLQJ
GULYHREMHFWDQGIURPDQRWKHU
GULYHREMHFW FKDQJH
Figure 9-14 Faults
Displaying alarms
$$ODUP 0RUHWKDQRQHDODUP
IURPWKHDFWLYHGULYH
DQGIURPDQRWKHU
GULYH
1HZDODUPVRUDODUPVDUH
SUHVHQWDQGQREXWWRQKDVEHHQ
SUHVVHG
IRUDSSUR[VHFRQGV DIWHUVHFRQGV
$ODUPVDUH DIWHUVHFRQGV
DXWRPDWLFDOO\F\FOHGWKURXJK
DIWHUVHFRQGV
Figure 9-15 Alarms

Operation
9.3 Controlling via the AOP30 operator panel
9.2.4 Controlling the drive using the BOP20

When commissioning the drive, it can be controlled via the BOP20. A control word is available
on the Control Unit drive object (r0019) for this purpose, which can be interconnected with the
appropriate binector inputs of e.g. the drive.
The interconnections do not function if a standard PROFIdrive telegram was selected as its
interconnection cannot be disconnected.
Table 9-8 BOP20 control word
Bit (r0019) Name Example, interconnection parame‐

ters
0 ON / OFF (OFF1) p0840
1 No coast down/coast down (OFF2) p0844
2 No fast stop/fast stop (OFF3) p0848
7 Acknowledge fault (0 → 1) p2102
13 Motorized potentiometer, raise p1035
14 Motorized potentiometer, lower p1036
Note
For simple commissioning, only bit 0 should be interconnected. When interconnecting bits
0 ... 2, the system is switched off according to the following priority: OFF2, OFF3, OFF1.
WARNING
The OFF button on the AOP30 operator panel does not comply with the requirements relating
to Emergency Stop, Emergency Off or STO function (functional safety)!
Note
To operate the AOP30, p2030 = 3 must be set.
An operator panel is located in the cabinet door of the cabinet unit for operating, monitoring,
and commissioning tasks. It has the following features:
• Graphical, backlit LCD for plain-text display and a "bar display" of process variables
• LEDs for displaying the operating states
• Help function describing the causes of and remedies for faults and alarms
• Keypad for controlling a drive under normal operating conditions

Operation
• LOCAL/REMOTE switchover for selecting the control terminal (master control assigned to
operator panel or customer terminal block/PROFIBUS)
• Numeric keypad for entering setpoints or parameter values
• Function keys for prompted navigation through the menus
• Two-stage safety concept to protect against accidental or unauthorized changes to settings
• IP54 degree of protection (when installed)
2SHUDWLQJVWDWXV 'LVSOD\
/('V
21 JUHHQ
$ODUP \HOORZ
)DXOW UHG
IXQFWLRQNH\V
&RQWUROSULRULW\
0HQXNH\ VHOHFWLRQ
'LUHFWLRQUHYHUVDO
.H\ERDUGLQWHUORFN
,QFUHDVHGHFUHDVH
1XPHULFNH\ERDUG 212)) -RJ
Figure 9-16 Components of the cabinet unit operator panel (AOP30)
9.3.1 Overview and menu structure
Description
The operator panel can be used for:
• Assigning parameters (commissioning)
• Monitoring status variables
• Controlling the drive
• Diagnosing faults and alarms
All the functions can be accessed via a menu.

Operation
Your starting point is the main menu, which you can always call up using the yellow MENU
key:
0$,10(18 Dialog screen for the main menu:

2SHUDWLQJVFUHHQIRUP This can be accessed with the "MENU" key.
3DUDPHWHUL]DWLRQ Press "F2" or "F3" to navigate through the
)DXOWDODUPPHPRU\ menu options in the main menu.
&RPPLVVLRQLQJVHUYLFH
/DQJXDJHVHOHFWLRQ
+HOS p q 2.
) ) ) ) )

Operation
Menu structure of the operator panel
'LDJQRVWLFV &XUUHQWIDXOWV !

0DLQPHQX 2SHUDWLQJVFUHHQIRUP
&XUUHQWDODUPV
2OGIDXOWV
0(18
2OGDODUPV
3DUDPHWHUL]LQJ ,QGLYLGXDO'2 '2

$OO'2 '2
'DWDVHWVHOHFWLRQ
'2Q
3HUPDQHQWSDUDPHWHU
WUDQVIHU
!
)DXOWPHPRU\ 2YHUYLHZRI)DXOWV
)DXOWVDODUPV'2
DODUPPHPRU\ $ODUPV
! )DXOWVDODUPV'2
)DXOWVDODUPV'2Q
&RPPLVVLRQLQJ 'ULYH
%DVLFFRPPLVVLRQLQJ
6HUYLFH FRPPLVVLRQLQJ
&RPSOHWHFRPPLVVLRQLQJ
'HYLFH
FRPPLVVLRQLQJ 2SWLPL]DWLRQUXQ
'ULYHGLDJQRVWLFV )DQPRQLWRULQJ
7K\ULVWRUFKHFN
$23VHWWLQJV &RQWUROVHWWLQJV
'LVSOD\VHWWLQJV
'HILQHRSHUDWLRQVFUHHQ
6HWGDWHWLPH
'DWHIRUPDW
56EXVWHUPLQDWLRQDFWLYH
'LVSOD\PRGH'2QDPH
5HVHW$23VHWWLQJV
$23GLDJQRVWLFV 6RIWZDUHGDWDEDVHYHUVLRQ
'DWDEDVHFRQWHQWV
6HOHFWLQJWKHODQJXDJH %DWWHU\VWDWXV
/DQJXDJH
/DQJXDJHVHOHFWLRQ .H\ERDUGWHVW
/DQJXDJH
/('WHVW
/DQJXDJHQ 'DWDEDVHVWDWLVWLFV
6DIHW\ORFNV
2SHUDWLQJLQKLELW
3DUDPHWHUL]DWLRQORFN
$FFHVVOHYHO
! +HOSWH[WVFDQEHFDOOHGIRUDOODODUPVDQGIDXOWV
Figure 9-17 Menu structure of the AOP30 operator panel

Operation
9.3.2 Operation screen menu
Description
The operation screen displays the most important status variables for the drive unit:
In the factory setting, it displays the operating state of the drive, the direction of rotation, the
time, as well as four drive variables (parameters) in numerical format and two values in the
form of a bar display for continuous monitoring.
You can call up the operation screen in one of three ways:
1. Automatically after ramping-up is complete
2. From the main menu, by selecting the "Operation screen" menu command and F5 ("OK")
3. From the "Fault/alarm overview" screen, by selecting F4 ("Tools+"/"Back") and F5 ("OK") if the
jump is from the operation screen into this screen
^'&B&75/`23(5$7,21 6
p
16(7 USP 67$7

(0) ,B)
1B$&7>USP@

,B$&7>$@

+HOS QVHW 7RROV 6HOSDU 'LDJ
) ) ) ) )
Figure 9-18 Operation screen
If a fault was registered during ramping-up, the system automatically branches from the
operation screen into which the jump was made following the ramping-up process into the
fault screen. This also happens if the system is on the operation screen and the first fault is
registered here.
You can use F2 in the LOCAL state to enter the setpoint via the numeric keypad, if the drive is
in the OPERATION state or the system setting "Save AOP setpoint" is set to YES.
You can switch to an alternative operation screen with F3 "Tools." It is used to display
technological variables and can be defined or changed at “Menu” - “Commissioning / service”
- “AOP settings” - “Define operation screen”.
The individual parameters of the operation screen can be selected using F4 ("Sel. par"). F1
("Help+") can be used to display the corresponding parameter number of the short identifier
and call up a description of the parameter.
Setting options
When you choose Commissioning / service – AOP settings – Define operation screen, you can
adjust the display type and the values displayed as required (see "AOP settings (Page 356)
“ Chapter).

Operation
9.3.3 Parameterization menu

You can adjust the unit settings in the Parameterization menu.
Two display types can be selected in the AOP:
1. All parameters
All the parameters present in the unit are listed with this option. The DO to which the
parameter currently selected belongs (inverted) is displayed in curly brackets in the top left
of the screen. With this display type, the response time for turning a page is dependent on
the number of DOs and is generally longer than with parameter lists that only display one DO.
2. DO selection
With this display type, you can pre-select a DO so that only the parameters for this DO are
listed. (The expert list in STARTER is only displayed in this DO view.)
In both cases, the set access level governs which parameters are displayed. You can set the
access level in the menu for safety inhibits, which can be called up using the key button.
The parameters for access levels 1 and 2 are sufficient for simple applications.
At access level 3 ("Expert"), you can change the structure of the function by interconnecting
BICO parameters.
The Parameterization menu offers four options:
• Individual DO
Shows the parameters of a DO to be selected in advance
• All DOs
Shows the parameters of all DOs in list format (as described previously)

Operation
• Data set selection

'DWDVHWVHOHFWLRQ
7\SH 0D[ 'ULYH $23
&RPPDQG'6 F
'ULYH'6 G
6SHHGHQFRGHU'6 H
+HOS p q EDFN FKDQJH
) ) ) ) )
Figure 9-19 Data set selection
In the "AOP" column of the "Data set selection" screen, you can choose which of the data sets
selected is currently displayed on the operator panel. The data set numbers that are set in the
drive (i.e. are currently active) are displayed in the "Drive" column. The "Max" column shows
the maximum data set number to be entered for the AOP30 display.
In parameter lists, data set parameters are indicated by the letter c, d, or e between the
parameter number and parameter designator. The number at the right of the first row from
the top shows which data set a highlighted parameter comes from.
In the commissioning wizard, the drive is commissioned using the data set selected on this
screen in the AOP column.
The data set selection dialog appears whenever a data set parameter is changed in the
parameter list. The data set selected in the data set selection screen is a default setting.
• Permanent parameter transfer
Parameter changes in the SINAMICS DCM are only made temporarily in the RAM. If a
parameter assignment is intended to be permanent, it is possible to trigger a save process at
this point. Depending on the configuration, this can take from 45 s to several minutes.
See also Chapter "Memory card functions (Page 329)".
9.3.4 Fault/alarm memory menu

When you select this menu, a screen appears containing an overview of faults and alarms that
are present.
For each drive object, the system indicates whether any faults or alarms are present. ("Fault"
or "Alarm" appears next to the relevant drive object).

Operation
In the graphic below, you can see that at least one active fault/alarm is present for the
"DC_CTRL" drive object. No faults or alarms are indicated for the other drive two objects.
)DXOWDODUPRYHUYLHZ Overview of Faults / Alarms

When you navigate to the line with active
&8B'& alarms/faults and then press the F5 <Diag> key,
'&B&75/ )DXOW $ODUP the system displays a screen in which you may
70 select the current or old alarms/faults.
p q 2SWLRQV 'LDJ
) ) ) ) )
^'&B&75/`'LVSOD\GLDJQRVWLFV Display diagnostics

&XUUHQWIDXOWV When you navigate to the required line and
&XUUHQWDODUPV then press the F5 <OK> key, the corresponding
2OGIDXOWV faults/alarms are displayed. The list of current
2OGDODUPV faults is selected here as an example.
p q EDFN 2.
) ) ) ) )
^'&B&75/`)DXOWV Current faults display

) ([WHUQDOIDXOW A maximum of eight current faults are dis‐
played along with their fault number and a de‐
scription of the fault.
To display additional help regarding the cause
of the problem and how to solve it, choose F1
+HOS EDFN $FN
p q <Help>.
) ) ) ) ) To acknowledge the faults, choose F5 <Ack>. If
a fault cannot be acknowledged, the fault re‐
mains.
9.3.5 Commissioning/service menu
9.3.5.1 Drive commissioning

Selecting this option enables you to re-commission the drive from the main menu, using the AOP
wizard.
Basic commissioning
A few key parameters (such as the maximum speed, ramp-up time, and ramp-down time) are
requested. The changes can then be permanently saved in the final confirmation screen.

Operation
Complete commissioning
Complete commissioning, with entry of the motor and encoder data, is carried out.
Following this, key motor parameters are recalculated on the basis of the motor data.
The parameter values calculated during the previous commissioning process are lost. The
calculated values are then overwritten during a subsequent optimization run.
Optimization run
The selection screen for the optimization runs appears.
9.3.5.2 Device commissioning

In this menu, you can enter the device commissioning status directly. This is the only way to reset
parameters to the factory setting, for example.
9.3.5.3 AOP settings
Control settings
This defines the settings for the control keys in LOCAL mode (see the section titled "Operation/
Operation via the operator panel") as well as additional settings that are relevant for drive
control.
Display settings
In this menu, you set the lighting, brightness, and contrast for the display.
Define operation screen

In this menu, you can switch between five operation screens. You can set the parameters to be
displayed.
'HILQHRSHUDWLRQVFUHHQ 2SHUDWLQJVFUHHQIRUP
6FUHHQ QRWBDFWLYH U 16(73RXWSIRU5)*
q q
q q
2SHUVFUHHQW\SH YDOXHVEDUV U 67$7RSHUDWLQJGLVSOD\

)
2SHUDWLRQVFUHHQYDOXHV U (0)$FWXDO(0)YDOXH
6FUHHQW\SH YDOXHVEDU U ,B),IBUHJ$FWYRXWS
q
q
+HOS p q EDFN FKDQJH +HOS p q EDFN FKDQJH
) ) ) ) ) ) ) ) ) )
Figure 9-20 Define operation screen
The following screenshot shows how entries are assigned to the screen positions:

Operation
^'&B&75/`23(5$7,21 6 ^'&B&75/`23(5$7,21 6
p
(QWU\ (QWU\ (QWU\ (QWU\
(QWU\ (QWU\ (QWU\

^'&B&75/`23(5$7,21 6 ^'&B&75/`23(5$7,21 6
p
(QWU\ (QWU\ (QWU\

(QWU\ (QWU\
(QWU\
(QWU\

(QWU\ (QWU\

^'&B&75/`23(5$7,21 6
p
(QWU\ (QWU\
Figure 9-21 Positions of entries on the operation screen
Lists of signals for the operating screen form

The following tables list some important signals for the operation screen form along with their
associated reference variables and default settings for quick commissioning.
DC_CTRL object
Table 9-9 List of signals for the operating screen form - object DC_CTRL
Signal Parameter Short name Unit Scaling (100%=...) see

table below
Factory setting (entry no.)
N setpoint after limiting (1) r50029 NSET rpm p2000
Operating display (2) r50000 STAT - -
EMF actual value (3) r52287 EMF % -
Field current actual value (4) r52265 I_F % -
Actual speed value (5) r00021 N_ACT rpm p2000
Armature current actual value (6) r00027 I_ACT A p2002
Armature firing angle (7) r50018 ALF_A ° -
Field firing angle (8) r50034 ALF_F ° -
Motor temperature rise (9) r50014.0 TEMP % -
Thyristor temperature rise (10) r50014.1 TEMP1 % -
for diagnostic purposes
Speed setpoint smoothed r0020 NSET rpm p2000

Operation
Signal Parameter Short name Unit Scaling (100%=...) see

table below
Speed actual value motor encoder r0061 N_ACT rpm p2000
Speed actual value after smoothing r0063 N_ACT rpm p2000
for advanced diagnostics
Setpoint from PROFIBUS r2050 PBSET rpm p2000
Scalings for object DC_CTRL
Table 9-10 Scalings for object DC_CTRL
Variable Scaling parameter Default for quick commissioning

Reference speed 100 % = p2000 p2000
Reference voltage 100 % = p2001 p2001 = 1000 V
Reference current 100 % = p2002 p2002 = Current limit (p0640)
Reference torque 100 % = p2003 p2003 = 2 × rated motor torque
Reference power 100 % = r2004 r2004 = (p2003 × p2000 × π) / 30
Reference temperature 100 % = 100 °C -
TM31 object
Table 9-11 List of signals for the operation screen - TM31 object
Signal Parameter Short name Unit Scaling (100% = ...)

Analog input 0 [V, mA] r4052[0] AI_UI V, mA R: 100 V / mA: 100 mA
Analog input 1 [V, mA] r4052[1] AI_UI V, mA R: 100 V / mA: 100 mA
Analog input 0, scaled r4055[0] AI_% % R: 100 V / mA: 100 mA
Analog input 1, scaled r4055[1] AI_% % R: 100 V / mA: 100 mA
Setting date/time
Settings: MENU – Commissioning / Service – AOP settings

For stamping faults and alarm messages with date, and for AOP time display on the
operation screen form
The AOP30 includes a battery-buffered realtime clock.
You set the date and time in this screen form.
Synchronization

Operation
You can also set whether and/or how the AOP30 and drive unit are to be synchronized.
Synchronizing the AOP → Drive enables fault and alarm messages to be stamped with date
and time. (in the default setting, the time stamp is with the CU runtime).
• None (factory setting)
The AOP30 and drive unit times are not synchronized.
• AOP → drive
– If you activate this option, the AOP and drive unit are synchronized immediately, whereby
the current AOP time is transferred to the drive unit.
– The current AOP30 time is transferred to the drive unit every time the AOP30 is started.
– At 02:00 (AOP time) every day, the current AOP30 time is transferred to the drive unit.
– The drive unit has the internal time again after it restarts (POWER ON).
• Drive → AOP
– If a time-of-day master is connected to the drive, then activating this option enables the
AOP and drive unit to be synchronized immediately, whereby the current drive unit time
is transferred to the AOP30.
– The current drive unit time is transferred to the AOP30 every time the AOP30 is restarted.
– At 02:00 (AOP time) every day, the current drive unit time is transferred to the AOP30.
Date format
The date format can be set in this menu:
• DD.MM.YYYY: European date format
• MM/DD/YYYY: North American date format
RS485 bus termination active

Settings are not effective. The RS485 bus termination is continuously active.
DO name display mode

A user-definable DO name can be activated/deactivated in the screen form.
In the drive, there is the option of entering a user-defined, 25-character DO name for each
DO, using the configuration software.

Operation
Depending on the screen form, the possible number of characters of the DO name display is
limited:
1. DO name in screen forms where the actual DO is displayed
Examples of screen forms in this category are: Operation screen form, parameter lists, quick
commissioning wizard screens, etc.
The maximum text length is 7 characters. Example {2:DC_CTRL}
Texts up to 7 characters long are displayed in full. The first six characters of texts that are 8
to 25 characters long are displayed with "..." as the 7th character.
2. DO names in the overview of faults and alarms (alarm overview)
The maximum text length is 12 characters. Example 2:HOIST 1234
For texts up to 12 characters long are displayed in full.
The first 11 characters of texts that are 13 to 25 characters in length are displayed with "..."
as the 12th character.
Texts that have been shortened can be displayed in full for around 3 seconds by pressing the
"+/-" button, provided that the "User-definable DO name" function is activated.
Reset AOP settings

When you choose this menu option, the AOP factory settings for the following are restored:
• Language
• Display (brightness, contrast)
• Operation screen
• Control settings
Note
When you reset parameters, all settings that are different to the factory settings are reset
immediately. Under certain circumstances, this may result in an unwanted operating state. This
is the reason that you should always take great care when resetting parameters.
9.3.5.4 AOP30 diagnostics
Software/database version
This menu command shows the versions of the software and database.
The database version must be compatible with the drive software version (refer to parameter
r0018).
Database contents
Shows detailed information on the drive objects (DOs) present in the system
Battery status
This menu displays the battery voltage (in volts and as a bar chart). The battery ensures that
the data in the database and the current time are retained.

Operation
When the battery voltage is represented as a percentage, a battery voltage of ≤ 2 V is equal

to 0%, and a voltage of ≥ 3 V to 100%.
The data is secure up to a battery voltage of 2 V.
• If the battery voltage is ≤ 2.45 V, the message "Replace battery" is displayed in the status bar.
• If the battery voltage is ≤ 2.30 V, the system displays the following message: "Alarm, weak
battery".
• If the battery voltage is ≤ 2 V, the system displays the following message: "Caution: The
battery is dead".
• If the time and/or database is/are unavailable due to an undervoltage condition after being
in a switched off state for a longer period of time, the loss is determined using a CRC check
when the system is switched on again. This triggers a message instructing the user to replace
the battery and then load the database and/or set the time.
For instructions on how to change the battery, see "Maintenance and servicing".
Keyboard test
On this screen, you can check that the keys are functioning properly. Keys that you press are
represented on a symbolic keyboard on the display. You can press keys in any order you wish.
You cannot exit the screen (F4 – "Back") until you have pressed each key at least once.
Note
Alternatively, you can exit the keyboard test screen by pressing any key and holding it down.
LED test
On this screen, you can check that the 4 LEDs are functioning properly.
Database statistics
Data related to the database is displayed here (e.g. free memory for additional DOs).
9.3.6 Sprachauswahl / Language Selection

The operator panel downloads the texts for the different languages from the drive.
In the delivery condition without a memory card, you can toggle between German and
English. With memory card (from V1.2), French, Italian, Spanish and Russian are also
automatically available. The memory card must remain inserted for operation with these
languages. The software provided for the update also includes all of the language packages
that are available.
You can change the language of the operator panel via the "Sprachauswahl/Language
selection" menu.
Note
Languages in addition to those that are currently available for the operator panel are available
on request.

Operation
9.3.7 Operation via the operator panel (LOCAL mode)
You activate the control keys by switching to LOCAL mode. If the green LED in the LOCAL/
REMOTE key does not light up, the key is not active.
Note
If the "OFF in REMOTE" function is activated, the LED in the LOCAL/REMOTE key flashes.
All supplementary setpoints are deactivated for LOCAL master control.

After the master control has been transferred to the operator panel, the BICO
interconnections at bit 0 to bit 10 of the control word of the sequence control are not active
(refer to function diagram 2501).
9.3.7.1 LOCAL/REMOTE key

Activate LOCAL mode: Press the LOCAL key
LOCAL mode: LED lights up
REMOTE mode: LED does not light up; the ON, OFF, JOG, direction reversal, faster, and
slower keys are not active.
Settings: Menu – Commissioning / Service – AOP settings – Control settings

Save LOCAL mode (factory setting: Yes)
• Yes: The "LOCAL" or "REMOTE" operating state is saved when the supply voltage is switched
off, and restored when the power supply is switched back on.
• No: The "LOCAL" or "REMOTE" operating state is not saved. "REMOTE" is activated when the
power supply is switched on.
OFF in REMOTE (factory setting: No)
• Yes: The OFF button functions in REMOTE mode even if the drive is being controlled from
external sources (PROFIBUS, customer terminal strip, NAMUR terminal strip).
WARNING
The OFF button on the AOP30 operator panel does not comply with the requirements
relating to Emergency Stop, Emergency Off or STO function (functional safety)!
• No: The OFF button only functions in LOCAL mode.

Operation
LOCAL/REMOTE also during operation (factory setting: No)

• Yes: You can switch between LOCAL and REMOTE when the drive is switched on (motor is
running).
• No: Before switching to LOCAL, a check is carried out to determine whether the drive is in the
"Operation" status. If it is, switchover is prevented and the error message "Local mode during
operation not possible" is output. Before the system switches to REMOTE, the drive is
switched off and the setpoint is set to 0.
9.3.7.2 ON key / OFF key

ON key: Active in LOCAL if no operator inhibit lock is activated
OFF key: Always active in LOCAL; active in REMOTE under certain conditions (if the system
setting "OFF in REMOTE" is set to "Yes")
OFF key acts as
• OFF1: Ramp-down on the down ramp (p50303)
At speed 0: Disconnection (only if line contactor is present)
• OFF2: Immediate pulse inhibit, motor coasts down
• OFF3: Ramp-down on the quick stop ramp (p50296)
Factory setting: OFF1
9.3.7.3 CCW/CW changeover

CCW/CW changeover (factory setting: No)
• Yes: CCW/CW changeover by means of the CCW/CW key functions in LOCAL mode
• No: The CCW/CW key is inactive.
For safety reasons, the CCW/CW key is disabled in the factory setting (normally pumps and
fans must only be operated in one direction).
The direction of rotation that is currently selected is indicated on the operation screen by
means of an arrow next to the operating state.
9.3.7.4 Jogging

JOG key active (factory setting: No)
• Yes: In "LOCAL" mode, the JOG key is active in the state "Ready for Switching On" (not in
"Operation").
• No: The JOG key is not active.
See also function diagram 3125 in the SINAMICS DCM List Manual.

Operation
The speed for the JOG function is entered using parameter p50436.
9.3.7.5 Increase setpoint / decrease setpoint

You can use the Increase and Decrease keys to enter the setpoint with a resolution of 1% of
the maximum speed.
Alternatively, the setpoint can also be entered via the numeric keypad. To do this, press F2
while on the operation screen. The system displays an inverted edit field for entering the
required speed. Enter the required value using the numeric keypad. Press F5 ("OK") to confirm
the setpoint.
Any speed between 0 and the maximum speed (p2000) can be entered using the numeric
keypad.
Setpoint entry in LOCAL mode is unipolar. You can change the direction of rotation by
pressing the key that allows you to switch between CCW/CW rotation.
• CW rotation and "Raise key" mean:
The displayed setpoint is positive and the speed is increased.
• CCW rotation and "Increase" key mean:
The setpoint displayed is negative and the speed is increased.
9.3.7.6 AOP setpoint
Settings: MENU – Commissioning / Service – AOP Settings – Control Settings

Save AOP setpoint (factory setting: No)
• Yes: In LOCAL mode, the last setpoint (once you have released the Increase or Decrease key or
confirmed a numeric entry) is saved.
The next time you switch the system ON in LOCAL mode, the saved value is selected. This is
also the case if you switched to REMOTE in the meantime or the power supply was switched
off.
When the system is switched from REMOTE to LOCAL mode while the drive is switched on
(motor is running), the actual value that was last present is set as the output value for the
motorized potentiometer setpoint and saved.
If the system is switched from REMOTE to LOCAL mode while the drive is switched off, the
motorized potentiometer setpoint that was last saved is used.
• No: On power-up in LOCAL mode, the speed is always set to the value entered under "AOP
starting setpoint". When the system is switched from REMOTE to LOCAL mode while the drive
is switched on (motor is running), the actual value that was last present is set as the output
value for the AOP setpoint.
AOP setpoint ramp-up time (factory setting: 20 s)
Defines the speed at which the setpoint specified by the AOP is increased when the "+" key is
pressed.
AOP setpoint ramp-down time (factory setting: 30 s)
Defines the speed at which the setpoint specified by the AOP is decreased when the "-" key is
pressed.

Operation
AOP starting setpoint (factory setting: 0.000 rpm)

The AOP starting setpoint is the speed setpoint which is active when the drive is switched on
(with the "ON" key on the AOP30); The "Save setpoint" system setting must be set to "No" for
this purpose (see also the description of the "Save AOP setpoint" system setting).
Note
The internal drive ramp-function generator is always active.
9.3.7.7 Inhibiting AOP Local mode

Inhibit AOP local mode (factory setting: No)
• Yes: Deactivates the "Control via operator panel" function, thereby disabling the LOCAL/
REMOTE key.
• No: Activates the LOCAL/REMOTE key.
Note
LOCAL functionality can also be inhibited on the drive by means of the p0806 parameter (BI:
Inhibit master control).
9.3.7.8 Acknowledging errors at the AOP

Acknowledge fault from the AOP (factory setting: Yes)
• Yes: Errors can be acknowledged via the AOP.
• No: Faults cannot be acknowledged via the AOP.
9.3.7.9 Timeout monitoring

In "LOCAL" mode or if "OFF in REMOTE" is active, the drive is shut down after 1 s. if the data cable
between the AOP and drive is disconnected.
9.3.7.10 Operating lock / Parameterization inhibit

To prevent the control keys from being operated and parameters from being changed
unintentionally, you can activate an operator inhibit lock/parameters disable using a key-

Operation
operated pushbutton. Two key icons appear at the top right of the display when these safety
inhibits are enabled.
Table 9-12 Operator inhibit lock/parameters disable
Inhibit type Online mode Offline mode

No safety inhibit
Operator lock
Parameter disable
Operator inhibit lock + parameters disable
Settings
,QKLELWIXQFWLRQV 3DUDPHWHUL]DWLRQORFN
2SHUDWLQJLQKLELW QRWBDFWLYH 3DVVZRUG

q
q
)
3DUDPHWHUL]DWLRQORFN QRWBDFWLYH FKDQJH
$FFHVVOHYHO 6WDQGDUG FKDQJH (QWHUSDVVZRUGDJDLQ
+HOS EDFN 2. & &DQFHO 2.

q
p q q
) ) ) ) ) ) ) ) ) )
Figure 9-22 Setting safety inhibits
The "Operator inhibit lock" setting can be changed directly via <F5> ("Change") once you
have selected the selection box.
When "Parameters disable" is activated, you may enter a numeric password (twice). You must
also enter this password when deactivating "Parameters disable".
Operator inhibit lock (factory setting: Not active)
• Active: The parameters can still be viewed, but a parameter value cannot be saved (message:
"Note: Operator inhibit lock active"). The OFF key (red) is enabled. The LOCAL/REMOTE, ON
(green), JOG, CW/CCW, INCREASE, and DECREASE keys are disabled.
Parameters disable (factory setting: Not active)
• Active: Parameters cannot be changed unless a password is entered. Parameters are
assigned in the same way as in the operator inhibit lock state. If you try to change parameter
values, the message "Note: Parameters disable active" is displayed. All the control keys,
however, remain enabled.
Access level (factory setting: Expert):
The different parameters required for this complex application are filtered so that they can be
displayed as clearly as possible. You select them according to the access level.
An expert level, which must only be used by expert personnel, is required for certain actions.

Operation
9.3.8 Faults and alarms
Displaying faults and alarms

If a fault occurs, the drive displays the fault(s) and/or alarm(s) on the operator panel. Faults are
indicated by means of the red "FAULT" LED lighting up.
The "Fault/alarm overview" also appears automatically in the following two cases:
1. When a fault is registered while the system is ramping up
2. If the first fault is registered on the operation screen
You can use the F1 (Help) function on the screen to call up information about the cause of
the fault and how to remedy it. You can use F5 (Ack.) to acknowledge a stored fault.
Any alarms that are pending are indicated by means of the yellow "ALARM" LED lighting up.
Additionally, a note relating to the cause of the alarm is displayed in the status bar of the
operator panel.
What is a fault?
A fault is a message from the drive indicating an error or other exceptional (unwanted) status.
This could be caused by a fault within the converter or an external fault triggered, for example,
by the winding temperature monitoring function for the motor. The faults are displayed and can
be reported to a higher-level control system via PROFIBUS.
What is an alarm?
An alarm is the response to a fault condition identified by the drive. It does not result in the drive
being switched off and does not have to be acknowledged. Alarms are "self-acknowledging";
that is, they are reset automatically when the cause of the alarm has been eliminated.
Displaying faults and alarms

Every fault and alarm is entered in the fault/alarm buffer along with the time at which it occurred.
This time stamp can take two forms:
• Number of days, hours, minutes, and seconds since the AOP was first switched on
(format DDDD: HH:MM:SS) (no "AOP→ Drive" time synchronization)
• System time (format YY:MM:DD HH:MM:SS = Year:Month:Day Hour:Minute:Second), in
cases where a time-of-day master is present in the system (if "AOP → Drive" time
synchronization is active, for example).
You can call up an overview screen that displays the current status of faults and/or alarms for
every drive object in the system by choosing MENU – Fault/alarm memory.
A shortcut menu offering the "Back" and "Ack." options appears when you press F4 ("Tools+").
(You can use F4 to exit the shortcut menu.) The function required can be selected using F2
and F3 and executed by pressing F5 ("OK").
The "Ack." function sends an acknowledgement signal to each drive object.
The red FAULT LED goes out once all the faults have been acknowledged.

Operation
^'&B&75/`)DXOWV ([WHUQDOIDXOW

) ([WHUQDOIDXOW )DXOWYDOXH[ KH[
&DXVH
) 7KH%,&2VLJQDOIRU([WHUQDOIDXOW
ZDVWULJJHUHG
5HPHG\
+HOS p q EDFN $FN EDFN p q
) ) ) ) ) ) ) ) ) )
Figure 9-23 Fault screen
You can use F5 (Ack.) to acknowledge a stored fault.
^'&B&75/`DODUPV ([WHUQDODODUP
$ 0RWRUGDWD,' DFWLYH $ODUPYDOXH[ KH[
$ ([WHUQDODODUP DFWLYH &DXVH
) 7KH%,&2VLJQDOIRU([WHUQDODODUP
KDVEHHQWULJJHUHG
7KHFRQGLWLRQIRUWKLVH[WHUQDO
+HOS p q %DFN &OHDU %DFN p q 0RUH
) ) ) ) ) ) ) ) ) )
Figure 9-24 Alarm screen
Alarms that are no longer active are removed from the alarm memory with F5 (Clear).
The screen can be updated via a submenu with F4 (More+).
9.3.9 Saving the parameters permanently
Description
If parameters are changed using the operator panel (confirm with OK in the Parameter editor),
the new values are initially stored in the volatile memory (RAM) of the converter. An "S" flashes
in the top right of the AOP display until they are saved permanently. This indicates that at least
1 parameter has been changed and not yet stored permanently.
2 methods are available for permanently saving parameters that have been changed:
• To store the parameters permanently, choose <MENU> <Parameterization> <OK>
<Permanent parameter transfer>.
• When confirming a parameter setting with the OK key, press it for > 1 s. The system displays
a message asking you whether the setting is to be saved in the EEPROM.
If you press "Yes", the system saves the setting in the EEPROM. If you press "No", the setting
is not saved permanently and the "S" starts flashing to indicate this fact.
In both cases, all changes that have not yet been saved permanently are stored in the
EEPROM. Depending on the configuration, this can take from 45 s to several minutes. Also
refer to the "CompactFlash Card functions" chapter.

Operation
Note
• The RDY-LED flashes (see Chapter "Description of the LEDs on the CUD (Page 609)")
Interrupting the power supply while saving can lead to the loss of the current device parameter
assignments. See also Chapter "Memory card functions (Page 329)".
9.3.10 Parameterization error

If an error is made when reading or writing parameters, a popup window explaining the cause
of the problem in plain text appears.
Example: Parameter write error

Value limit exceeded
9.3.11 Assigning parameters to make AOP30 time-of-day master

The AOP30 contains an integrated real-time clock. The SINAMICS DCM system time can be
synchronized with this real-time clock.
Activate this function:
• On the AOP30 in the “Menu” - “Commissioning / Service” - “AOP settings” - “Date and Time”
menu command activate to "AOP sets clock in SINAMICS".
The current time in the AOP30 is then written into the drive.
In the display for faults and alarms, the time stamp is now displayed in the format YY-MM-DD
hh:mm in real-time. The time stamp mode and the current time can be read from the
parameters p3100, p3102 and p3103. For details, please see the SINAMICS DCM List Manual.
The current time is resynchronized at each power-up. (The AOP30 must be switched on
together with the drive). During uninterrupted duty, synchronization takes place every day at
02:00.

Operation

Descriptions of functions 10
10.1 Inputs/outputs
10.1.1 Overview of inputs/outputs
Table 10-1 Overview of inputs and outputs
Component Digital Analog

CUD • 4 inputs • 7 inputs
(2 inputs freely available, 2 inputs with ON/ • 2 outputs
OFF1 and controller enable pre-assigned)
• 1 temperature sensor input
• 4 bidirectional inputs/outputs
• 4 outputs
• 1 incremental encoder input
Power interface • 1 E-Stop input • 1 analog tachometer input
• 1 line contactor relay output • 2 temperature sensor inputs
• 1 fan control relay output • 2 current transformer inputs
• 1 fan monitoring input
• 1 external fault input
TM15 • 24 bidirectional inputs/outputs -
TM31 • 8 inputs • 2 inputs
• 4 bidirectional inputs/outputs • 2 outputs
• 2 relay outputs • 1 temperature sensor input
TM150 - • 12 inputs for max. 12 temperature sensors
(PT100, PT1000, KTY84, PTC, bimetal con‐
tact)
Number depending on connection type
Technical data for inputs and outputs:
• For the CUD and power unit, see Chapter “Connecting (Page 67)”.
• For the TM15, TM31 and TM150, see Chapter “Additional system components (Page 169)”

Descriptions of functions
10.1 Inputs/outputs
10.1.2 Digital inputs/outputs
Function diagrams in the SINAMICS DCM List Manual
2050 Digital inputs DI 0 ... DI 3

2055 Digital outputs DO 0 ... DO 3
2060 Digital inputs/outputs, bi-directional DI/DO 4 and DI/DO 5
2065 Digital inputs/outputs, bi-directional DI/DO 6 and DI/DO 7
2070 E-Stop (XS1)
8047 Unit fan (XV1, XV2, XV3)
10.1.3 Analog inputs
Properties
Table 10-2 Properties of the analog inputs
Inputs Properties
AI 0, AI 1 • Differential inputs
• Voltage inputs -10 to +10 V or
Current inputs -20 to +20 mA or 4 to 20 mA
• Hardware input filter: T = 1 ms
• Integrating measuring procedure. Averaging time = 1 ms. The average value determined during this
time is provided in BICO format.
AI 2 • Differential input
• Voltage input -10 to +10 V
An external armature current actual value can also be connected to this input (see FP6902).
The 3 inputs AI 0, AI 1 and AI 2 of a CUD on the left and the 3 inputs AI 0, AI 1 and AI 2 of a CUD on the right can be operated
so that they are averaged during the same measuring interval. The 6 mean values are provided on 6 BICOs (see FP2083).
AI 3, AI 4, AI 5, AI 6 • Differential inputs
• Voltage inputs -10 to +10 V
• Hardware input filter: T = 100 µs
• Sampling measuring procedure. Sampling time = 250 µs. The mean value taken from 4 sampling
values is provided in BICO format.
An external actual armature current value can also be connected to these inputs (see FP6850).

10.2 Communication, IT security
Inputs Properties
Power interface • Input referred to ground
tachometer input • High-voltage input -270 V .. +270 V
XT1.103/104
This input is designed for connecting an analog tachometer, but can also be used in other ways.
XT5, XT6 • Connection, NTC 6.8 kΩ, NTC 10 kΩ
X7, X8 • Current transformer connection
• Internal 10 Ω load resistors
Function diagrams
2075 Analog inputs, AI 0 and XT1.103/104

2080 Analog inputs, AI 1 and AI 2
8048 Internal unit monitoring functions (XT5,XT6)
10.1.4 Analog outputs
See function diagram 2095 in the SINAMICS DCM List Manual
Note
IT Security (Industrial Security)
In order to ensure the safe operation of your systems, you must take suitable measures, e.g.
industrial security or network segmentation. You can find more information on Industrial
Security on the Internet at:
IT Security (www.siemens.com/industrialsecurity)

10.2.1 SINAMICS network settings

SINAMICS converters support the communication protocols listed in the following table. The
address parameters, the relevant communication layer, as well as the communication role and
the communication direction are decisive for each protocol. You require this information to
match the security measures for the protection of the automation system to the used protocols
(e.g. firewall). The security measures are restricted to Ethernet or PROFINET networks.
The following table shows the various layers and protocols that are used.
PROFINET protocols
PROFINET protocols Port number (2) Link layer Function Description

(4) Transport layer
DCP Not relevant (2) Ethernet II and Accessible nodes, DCP is used by PROFINET to de‐
Discovery and Config‐ IEEE 802.1Q and Ether‐ PROFINET Discov‐ termine PROFINET devices and
uration Protocol type 0x8892 (PROFINET) ery and configura‐ to make basic settings.
tion DCP uses the special multicast
MAC address:
xx-xx-xx-01-0E-CF,
xx-xx-xx = Organizationally
Unique Identifier
LLDP Not relevant (2) Ethernet II and PROFINET Link Lay‐ LLDP is used by PROFINET to de‐
Link Layer Discovery IEEE 802.1Q and Ether‐ er Discovery proto‐ termine and manage neighbor‐
Protocol type 0x88CC (PROFINET) col hood relationships between
PROFINET devices.
LLDP uses the special multicast
MAC address:
01-80-C2-00-00-0E
MRP Not relevant (2) Ethernet II and PROFINET medium MRP enables the control of re‐
Media Redundancy IEEE 802.1Q and Ether‐ redundancy dundant routes through a ring
Protocol type 0x88E3 (PROFINET) topology.
MRP uses the special multicast
MAC address:
xx-xx-xx-01-15-4E,
Unique Identifier
PTCP Not relevant (2) Ethernet II and PROFINET PTC allows the delay time be‐
Precision Transparent IEEE 802.1Q and Ether‐ send clock and time tween RJ45 ports to be meas‐
Clock Protocol type 0x8892 (PROFINET) synchronisation, ured – and as a consequence,
based on IEEE 1588 send cycle synchronization and
time synchronization to be im‐
plemented.
PTCP uses the special multicast
MAC address:
xx-xx-xx-01-0E-CF,
Unique Identifier

PROFINET protocols Port number (2) Link layer Function Description

(4) Transport layer
PROFINET IO data Not relevant (2) Ethernet II and PROFINET Cyclic IO The PROFINET IO telegrams are
IEEE 802.1Q and Ether‐ data transfer used to cyclically transfer IO da‐
type 0x8892 (PROFINET) ta between the PROFINET IO
controller and IO devices via
Ethernet.
PROFINET Context 34964 (4) UDP PROFINET connec‐ The PROFINET context manag‐
Manager tion less RPC er provides an endpoint map‐
per in order to establish an ap‐
plication relationship (PROFI‐
NET AR).
Connection-oriented communication protocols
Connection-orien‐ Port number (2) Link layer Function Description

ted communication (4) Transport layer
protocols
DHCP 68 (4) UDP Dynamic Host Con‐ Is used to query an IP address.
Dynamic Host Config‐ figuration Protocol Is closed when delivered, and is
uration Protocol opened when selecting the
DHCP mode.
ISO on TCP 102 (4) TCP ISO-on-TCP protocol ISO on TCP (according to RFC
(according to 1006) is used for the message-
RFC 1006) oriented data exchange to a re‐
mote CPU, WinAC, or devices of
other suppliers.
Communication with ES, HMI,
etc.
Is open in the delivery state and
is always required.
SNMP 161 (4) UDP Simple network SNMP enables the reading out
Simple Network Man‐ management pro‐ and setting of network man‐
agement Protocol tocol agement data (SNMP managed
Objects) by the SNMP manager.
Is open in the delivery state and
is always required.
Internal protocol 5188 (4) TCP Server/ Communication with commis‐
incoming sioning tools for downloading
project data.
Reserved 49152...65535 (4) TCP - Dynamic port area that is used
(4) UDP for the active connection end‐
point if the application does
not specify the local port.

EtherNet/IP protocols
EtherNet/IP proto‐ Port number (2) Link layer Function Description

cols (4) Transport layer
Explicit messaging 44818 (4) TCP - Is used for parameter access,
(4) UDP etc.
Is closed when delivered, and is
opened when selecting Ether‐
Net/IP.
Implicit messaging 2222 (4) UDP - Is used for exchanging I/O data.
opened when selecting Ether‐
Net/IP.
Modbus TCP protocols (server)
Modbus TCP proto‐ Port number (2) Link layer Function Description
cols (server) (4) Transport layer
Request & Response 502 (4) TCP - Is used for exchanging data
packages.
opened when selecting Mod‐
bus TCP.
10.2.2 Time synchronization
10.2.2.1 Overview
In the factory setting, SINAMICS drives use an operating hours counter. Based on the operating
hours, the SINAMICS drive saves alarms and warnings that occur. Using this method, it is not
possible to have a comparable timestamp between various converters.
In order to obtain a comparable timestamp between several converters, you must change
over the operating hours counting to time in the UTC format and synchronize with the time
master (control system).
This means that the events of all bus nodes, which are synchronized with the control system
time, can be referenced with one another.
Benefits: Improved diagnostic options by having a comparable time stamp of the bus nodes
involved.
Converters provide the following options to synchronize the time:
Synchronization type Accuracy

Basic synchronization approx. 100ms
Synchronization using ping compensation for non-isochronous communication approx. 10 ms

Principle of operation of time synchronization
Basic synchronization
The control system transfers the time to the converter at time intervals that you specify in
the control system. Transfer is realized acyclically in the UTC format. The converter accepts
this time as soon as transfer has been completed without correcting the transfer duration.
The converter logs alarms and warnings based on this time.
Time synchronization with ping compensation

At intervals that you specify in the control system, the control system cyclically sends a "ping"
(a positive signal edge) to the converter. Simultaneously, in acyclic operation, the device
sends the time in the UTC format in what is known as "snap".
As soon as the ping has been received in the drive, a timer starts which measures the time
until the snap has been completely transferred. The drive accepts the time that the snap
transfers. It then corrects it by the time that has expired between receiving the ping and the
complete transfer of the snap.
If the snap has not been transferred within 5 s after receiving the ping, then this
synchronization cycle is not used.
&RQWURO 3LQJ
W
3LQJ
&RQYHUWHU W
6QDSWLPH
W
73LQJ 7VQDS
&\FOHIRUWLPHV\QFKURQL]DWLRQ
Figure 10-1 Ping snap
You can influence the accuracy of the ping compensation using the PZD sampling time
(p2048).

10.2.2.2 Setting SINAMICS time synchronization
Setting time synchronization

1. Using p3100, changeover the time format from operating hours into the UTC format (see
"Changing the time format").
2. Set the synchronization technique:
– Basic synchronization (p3103 = 2)
– Time synchronization with ping compensation (p3103 = 0)
3. Using p3104, set the ping source:
– If you implement a customized solution for the time synchronization, then interconnect
the source of the ping (p3104) with the cyclic fieldbus interface via BICO.
– If you use the following blocks, interconnect the source of the ping (p3104) with the
receive PZD 1, bit 1 of the CUD (r2090.1).
- LAcycCom_RTCSinamics of library LAcycCom (see application example 1 further below)
- SYNC_SINAMICS_CU_TIME (see application example 2 further below)
As parameter, the blocks expect the basis address of the cyclic telegram to the CU.
Result:
After time synchronization, the current time is obtained from the time transferred by the
time master plus the necessary delay time associated with the transfer (ping-snap time).
The actual UTC time is displayed in the drive system using r3102.
At certain intervals, synchronization (according to the same technique) is repeated
(depending on the setting in the time master).
If a previously defined tolerance window is exceeded, then alarm A01099 is output. Define
the tolerance window for time synchronization using p3109. If alarm A01099 occurs, then
generally the synchronization interval is too long.
In this case, reduce the synchronization interval in your control system.
Changing the time format

The time format is entered via parameter p3100. This parameter cannot be changed online To
change the value, proceed as follows:
1. Connect STARTER ONLINE with the converter.
2. Carry out an upload ("Load drive unit to PG").
3. Exit the online mode in STARTER.
4. Offline, make the setting p3100 = 1.
5. Reactivate the ONLINE mode.
6. Carry out a parameter download ("Load drive unit to target device").
7. Save the settings in a non-volatile fashion on the memory card of the drive.
You have now changed over the converter time format to the UTC format.

10.3 Communication according to PROFIdrive
Application examples
Application examples for SINAMICS time synchronization are provided in the SIEMENS "Industry
Online Support" (SIOS):
1. SIMATIC S7-1200/S7-1500 and SIMOTION: Acyclic communication
Time synchronization via LAcycCom_RTCSinamics / LAcycCom_RTCSinamicsAcyclic
Time synchronization via LAcycCom_RTCSinamics (https://
support.industry.siemens.com/cs/de/en/view/109479553)
2. SINAMICS S: Time synchronization between S7-300/400/1200/1500 and S120
time synchronization via SYNC_SINAMICS_CU_TIME
Time synchronization via SYNC_SINAMICS_CU_TIME (https://
10.2.2.3 Messages and parameters
Faults and alarms (see SINAMICS DCM List Manual)
• A01099 UTC synchronization tolerance violated
Overview of important parameters (see SINAMICS DCM List Manual)
• p2048 IF1 PROFIdrive PZD sampling time

• p3100 RTC time stamp mode
• p3101[0...1] Set UTC time
• r3102[0...1] Display UTC time
• p3103 UTC synchronization technique
• p3104 BI: UTC PING synchronization
• r3107[0...3] UTC synchronization time out of tolerance
• r3108[0...1] UTC synchronization deviation
• p3109 UTC synchronization tolerance
• p3116 BI: Suppress automatic acknowledgment

PROFIdrive is the PROFIBUS and PROFINET profile for drive technology with a wide range of
applications in production and process automation systems.

PROFIdrive is independent of the bus system used (PROFIBUS, PROFINET).
Note
PROFINET for drive technology is standardized and described in the following document:
• PROFIdrive – Profile Drive Technology
PROFIBUS User Organization e. V.
Haid-und-Neu-Straße 7, D-76131 Karlsruhe, Germany
http://www.profibus.com
• IEC 61800-7
PROFIdrive device classes
Table 10-3 PROFIdrive device classes
PROFIdrive PROFIBUS DP PROFINET IO

Peripheral device (P device) DP device (I devices) IO Device
Controller (higher-level controller Class 1 DP master IO Controller
or host of the automation system)
Supervisor (engineering station) Class 2 DP master IO Supervisor
Properties of the Controller, Supervisor and drive units
Table 10-4 Properties of the Controller, Supervisor and drive units
Properties Controller Supervisor Drive unit

As bus node Active Passive
Send messages Permitted without external re‐ Only possible on request by the
quest controller
Receive messages Possible without any restrictions Only receive and acknowledge
permitted
• Drive unit (PROFIBUS: Device, PROFINET IO: IO Device)

Example: Control Unit CUD
• Controller (PROFIBUS: Master Class 1, PROFINET IO: IO Controller)
A controller is typically a higher-level controller in which the automation program runs.
Example: SIMATIC S7 and SIMOTION
• Supervisor (PROFIBUS: Master Class 2, PROFINET IO: IO Supervisor)
Devices for configuring, commissioning, operating control and monitoring while the bus is
operational.
Devices that only exchange data with drive units and controllers acyclically.
Examples: Programming devices, human machine interfaces

Communication services
Two communication services are defined in the PROFIdrive profile; namely, cyclic data exchange
and acyclic data exchange.
• Cyclic data exchange via a cyclic data channel:
Motion control systems require cyclically updated data in operation for open-loop and closed-
loop control tasks. This data must be sent to the drive units in the form of setpoints or
transmitted from the drive units in the form of actual values, via the communications system.
Transmission of this data is usually time-critical.
• Acyclic data exchange via an acyclic data channel:
An acyclic parameter channel for exchanging parameters between the controller/supervisor
and drive units is additionally available. Access to this data is not time-critical.
• Alarm channel
Alarms are output on an event-driven basis, and show the occurrence and expiry of error
states.
Interface IF1 and IF2

The Control Unit CUD can communicate via two separate interfaces (IF1 and IF2).
Table 10-5 Properties of IF1 and IF2
IF1 IF2
PROFIdrive Yes No
Standard telegrams Yes No
Isochronous mode No No
Drive object types All All
Can be used for PROFINET IO, PROFIBUS DP PROFINET IO, PROFIBUS DP
Cyclic operation possible Yes Yes
PROFIsafe possible No No
Note
For additional information on the IF1 and IF2 interfaces, see Chapter “Parallel operation of
communication interfaces (Page 410)”.
10.3.1 Application classes
There are different application classes for PROFIdrive according to the scope and type of the
application processes. PROFIdrive features a total of six application classes, two of which are
discussed here.

Application class 1 (standard drive)

In the most basic case, the drive is controlled via a speed setpoint by means of PROFIBUS/
PROFINET. In this case, speed control is fully handled in the drive controller. Typical application
examples include simple frequency converters for controlling pumps and fans.
$XWRPDWLRQ
7HFKQRORJ\
352),%86352),1(7
6SHHGVHWSRLQW 6SHHGDFWXDOYDOXH
'ULYH 'ULYH 'ULYH

2SHQ/RRS6SHHG&RQWURO 2SHQ/RRS6SHHG&RQWURO 2SHQ/RRS6SHHG&RQWURO
&ORVHG/RRS6SHHG&RQWURO &ORVHG/RRS6SHHG&RQWURO &ORVHG/RRS6SHHG&RQWURO
(QFRGHU (QFRGHU (QFRGHU

M RSWLRQDO M RSWLRQDO
M RSWLRQDO
Figure 10-2 Application class 1

Application class 2 (standard drive with technology function)

The total process is subdivided into a number of small subprocesses and distributed among the
drives. This means that the automation functions no longer reside exclusively in the central
automation device but are also distributed in the drive controllers.
Of course, this distribution assumes that communication is possible in every direction, i.e. also
cross-communication between the technology functions of the individual drive controllers.
Specific applications include setpoint cascades, winding drives, and speed synchronization
applications for continuous processes with a continuous web.
$XWRPDWLRQ
7HFKQRORJ\
352),%86352),1(7
7HFKQRORJLFDO5HTXHVWV6HWSRLQWV 7HFKQRORJLFDO$FWXDO9DOXHV3URFHVV6WDWHV
'ULYH 'ULYH 'ULYH
7HFKQRORJ\ 7HFKQRORJ\ 7HFKQRORJ\
&ORVHG/RRS6SHHG&RQWURO &ORVHG/RRS6SHHG&RQWURO &ORVHG/RRS6SHHG&RQWURO
3HULSKHUDOV ,2 3HULSKHUDOV ,2 3HULSKHUDOV ,2
M M M
(QFRGHU (QFRGHU (QFRGHU
Figure 10-3 Application class 2
Selection of telegrams as a function of the application class

The telegrams listed in the table below (see also Chapter “Telegrams and process data
(Page 384)”) can be used in the following application classes:
Table 10-6 Selection of telegrams as a function of the application class
Telegram Description Class 1 Class 2

(p0922 = x)
1 Speed setpoint, 16-bit x x
3 Speed setpoint, 32-bit with 1 position encoder x
4 Speed setpoint, 32-bit with 2 position encoders
20 Speed setpoint, 16-bit VIK-NAMUR x x
220 Speed setpoint, 32-bit for metal industry x
352 Speed setpoint, 16-bit, PCS7 x x
999 Free telegrams x x

10.3.2 Cyclic communication
Cyclic communication is used to exchange time-critical process data.
10.3.2.1 Telegrams and process data
The process data (PZD) that is to be transferred is defined by appropriately configuring the drive
unit (Control Unit).
For every drive object (CU_DC, DC_CTRL, TM15DI_DO, TM31, TM150) of the SINAMICS DCM,
process data can be defined that is to be sent or received.
From the perspective of the drive unit, the received process data represents the receive
words and the process data to be sent the send words.
The receive and send words comprise the following elements:
• Receive words: Control words or setpoints
• Send words: Status words or actual values
PROFIdrive telegrams
• Standard telegrams
The standard telegrams are structured in accordance with the PROFIdrive profile. The internal
process data links are set up automatically in accordance with the telegram number setting.
The following standard telegrams can be set via p0922:
– 1 Speed setpoint, 16-bit
– 3 Speed setpoint, 32-bit with 1 position encoder
– 4 Speed setpoint, 32-bit with 2 position encoders
– 20 Speed setpoint, 16-bit VIK-NAMUR
• Manufacturer-specific telegrams
The manufacturer-specific telegrams are structured in accordance with internal company
specifications. The internal process data links are set up automatically in accordance with the
telegram number setting.
The following vendor-specific telegrams can be set via p0922:
– 220 Speed setpoint, 32-bit for metal industry
– 352 Speed setpoint, 16-bit, PCS7
– 390 Control Unit with digital inputs/outputs
• Free telegrams (p0922 = 999)
The send and receive telegrams can be configured as required by using BICO technology to
interconnect the send and receive process data.
DC_CTRL CU_DC TM31, TM15DI_DO,

TM150
Receive process data
DWORD connector out‐ r2060[0 ... 62] - -
put

DC_CTRL CU_DC TM31, TM15DI_DO,

TM150
WORD connector output r2050[0 ... 63] r2050[0 ... 19] r2050[0 ... 4]
Binector output r2090.0 ... 15 r2090.0 ... 15
r2091.0 ... 15 r2091.0 ... 15
r2092.0 ... 15
r2093.0 ... 15
Free binector-connector p2080[0 ... 15], p2081[0 ... 15], p2082[0 ... 15], p2083[0 ... 15],
converter p2084[0...15] / r2089[0 ... 4]
Send process data
DWORD connector input p2061[0 ... 62] - -
WORD connector input p2051[0 ... 63] p2051[0 ... 24] p2051[0 ... 4]
Free connector-binector p2099[0 ... 1] / r2094.0 ... 15, r2095.0 ... 15
converter
Notes on telegram interconnections

• When you change p0922 = 999 (factory setting) to p0922 ≠ 999, the telegrams are
interconnected and blocked automatically.
• Exceptions to this are the telegrams 20, 220, and 352. Here, selected PZDs can be freely
interconnected in the send/receive telegram.
• When you change p0922 ≠ 999 to p0922 = 999, the previous telegram interconnection is
retained and can be changed.
• If p0922 = 999, a telegram can be selected in p2079. A telegram interconnection is
automatically made and blocked. The telegram can also be extended.
This is an easy method for creating extended telegram interconnections on the basis of
existing telegrams.
Notes on the telegram structure

• The parameter p0978 contains the drive objects that use a cyclic PZD exchange. A zero is used
to demarcate the drive objects that do not exchange PZD.
• If the value 255 is written to p0978, this drive object is visible to the PROFIdrive controller and
empty (without actual process data exchange). This permits cyclic communication of a
PROFIdrive controller in the following cases:
– With unchanged configuration to drive units that have a different number of drive objects.
– With deactivated drive objects, without having to change the project
• The following must apply to ensure conformity with the PROFIdrive profile:
– Interconnect PZD receive word 1 as control word 1 (STW1).
– Interconnect PZD send word 1 as status word 1 (ZSW1).
– The WORD format should be used for PZD1.
• A PZD corresponds to a data word (16 bit).
• Only one of the interconnection parameters (p2051 or p2061) can have the value ≠ 0 for a
PZD word, as the assignment of word and double word to the PZDs overlap.

Scaling process data in telegrams

• Physical word and double word variables are transferred in the telegram as reference
variables in the value range ‑200.00% ... +199.99%.
The following definitions apply:
– Word interconnection (via p2051[...] or r2050[...])
Value in PZD (fieldbus) Reference variable

WORD UINT INT
0000 hex 0 0 0.000%
0001 hex 1 +1 +0.006%
... ... ... ...
4000 hex 16,384 +16,384 +100.000%
... ... ... ...
7FFF hex 32,767 +32,767 +199.994%
8000 hex 32,768 -32,768 -200.000%
... ... ... ...
C000 hex 49,152 -16,384 -100.000%
... ... ... ...
FFFF hex 65,535 -1 -0.006%

KH[
KH[
,QFUHDVLQJYDOXHLQ
3='
KH[ )))KH[
))))KH[ KH[
'HFUHDVLQJYDOXHLQ
3='
&KH[

Figure 10-4 The value range and assignment of the value in PZD and reference variable (16 bit / WORD /
UINT / integer)

– Double word interconnection (via p2061[...] or r2060[...])
Value in PZD (fieldbus) Reference variable

DWORD UDINT DINT
0000 0000 hex 0 0 0.000000000 %
0000 0001 hex 1 +1 +0.000000093%
... ... ... ...
4000 0000 hex 1,073,741,824 +1,073,741,824 +100.000000000%
... ... ... ...
7FFF FFFF hex 2,147,483,647 +2,147,483,647 +199.999999907%
8000 0000 hex 2,147,483,648 -2,147,483,648 -200.000000000%
... ... ... ...
C000 0000 hex 3,221,225,427 -1,073,741,824 -100.000000000%
... ... ... ...
FFFF FFFF hex 4,294,967,295 -1 -0.000000093%

KH[
KH[
,QFUHDVLQJYDOXHLQ
3='
KH[ )))))))KH[
))))))))KH[ KH[
'HFUHDVLQJYDOXHLQ
3='
&KH[

Figure 10-5 The value range and assignment of the value in PZD and reference variable (32 bit / DWORD /
UDINT / DINT)
Remark: However, you must take into account the internal scaling of individual physical
variables, e.g. r0080 torque, see SINAMICS DCM List Manual.
• The reference variable is specified in the parameter list for every BICO.
Process data are always scaled to parameters p2000 to r2004.
However, for SINAMICS DCM, most BICOs have unit "%", and are directly transferred into the
telegram as described above.

• Temperatures in the drive (drive object DC_CTRL):

– 0 °C is transferred as 0.00%.
– 100 °C is transferred as 100.00%.
• Temperatures for TM31, TM150:
Temperatures are referred to reference temperature (p2006).
For a display or setting value of 100.00%, the temperature therefore corresponds to
reference temperature of the TM31 or the TM150.
• Electrical angle:
An electrical angle of 90° corresponds to 100%.
Structure of the telegrams

You can find the structure of the telegrams in the SINAMICS DCM List Manual in the following
function diagram:
• 2420: PROFIdrive - telegrams and process data
Drive object Telegrams (p0922)

DC_CTRL 3, 4, 999
TM15DI_DO No predefined telegram.
TM31 No predefined telegram.
TM150 No predefined telegram.
CU_DC 390, 999
Depending on the drive object, the following maximum number of process data can be
transferred for a user-defined telegram structure:
Drive objects Maximum number of PZD

Send Receive
DC_CTRL 64 64
TM15DI_DO 5 5
TM31 5 5
TM150 5 5
CU_DC 25 20
• 2410 PROFIdrive - PROFIBUS (PB) / PROFINET (PN), addresses and diagnostics

• 2498 PROFIdrive - I_DIGITAL interconnection

10.3.2.2 Description of control words and setpoints
Overview of control words and setpoints
Table 10-7 Overview of control words and setpoints, see function diagram [2440]
Abbreviation Name Signal Data type 1) Interconnection

number parameter 2)
STW1 Control word 1 for telegram 1, 3, 4, 20, 352 1 U16 (bit-by-bit)
STW2 Control word 2 for telegram 3, 4 3 U16 (bit-by-bit)
NSET_A Speed setpoint A (16-bit) 5 I16 p1070
NSET_B Speed setpoint B (32-bit) 7 I32 p50621
G1_STW Encoder 1 control word 9 U16 p0480[0]
G2_STW Encoder 2 control word 13 U16 p0480[1]
A_DIGITAL Digital output (16-bit) 22 U16 (bit-by-bit)
M_LIM Torque limit 310 U16 p50605[0]
p50500[0]
M_ADD Supplementary torque 311 U16 p50619
STW1_BM Control word 1, variant for BM 322 U16 (bit-by-bit)
STW2_BM Control word 2, variant for BM 324 U16 (bit-by-bit)
CU_STW1 Control word 1 for Control Unit 500 U16 (bit-by-bit)
1)
Data type to PROFIdrive Profile V4:
I16 = Integer16, I32 = Integer32, U16 = Unsigned16, U32 = Unsigned32
2)
Bit-by-bit interconnection: Refer to the following pages
STW1 (control word 1)

See function diagram [2442].
Table 10-8 Control word 1 (STW1)
Bit Meaning Explanation Operating BICO

condition
0 0 = OFF1 (OFF1) 0: Deceleration on the down ramp, then pulse in‐ 1 BI: p0840
hibit, line contactor (if present) is opened
0 → 1 = ON Pulse enable possible
1 0 = Coast down (OFF2) 0: Pulse inhibit, line contactor (if present) is opened 1 BI: p0844 BI:
p0845
1 = Do not coast down Enable possible
Note: Control signal OFF2 is generated by ANDing BI: p0844 and BI: p0845.
2 0 = Quick stop (OFF3) 0: Deceleration on the quick stop ramp, then pulse 1 BI: p0848
inhibit, line contactor (if present) is opened.
1 = No quick stop Enable possible
Note: Control signal OFF3 is generated by ANDing BI: p0848 and BI: p0849.

Bit Meaning Explanation Operating BICO

condition
3 0 = Inhibit operation 0: Pulse inhibit. The motor coasts down. The 1 BI: p0852
"Ready for Operation" state remains set.
1 = Enable operation 1: Pulse enable, ramp-up with active setpoint
4 0 = Inhibit ramp-function 0: The ramp-function generator output is set to 1 BI: p1140
generator setpoint "0".
1 = Enable ramp-function
generator
5 0 = Stop ramp-function gen‐ 0: The current setpoint is frozen at the ramp-func‐ 1 BI: p1141
erator tion generator output.
1 = Start ramp-function gen‐
erator
6 1 = Enable speed setpoint 1: The speed setpoint at the input of the ramp- 1 BI: p1142
function generator is enabled.
0 = Inhibit speed setpoint 0: The speed setpoint at the input of the ramp-
function generator is set to zero. The drive brakes
in accordance with the set ramp-down time.
7 0 → 1 = Acknowledge fault A positive edge change acknowledges all the cur‐ - BI: p2103
rent faults.
Note: Acknowledgement is realized with a 0/1 edge via BI: p2103 or BI: p2104 or BI: p2105.
8 Reserved - -
9 Reserved - -
10 1 = Control via PLC 1: PROFIBUS control words and setpoints are ana‐ 1 BI: p0854
lyzed.
0: PROFIBUS control words and setpoints are not
analyzed.
Note: This bit should not be set to "1" until the PROFIBUS device has returned an appropriate status via ZSW1.9 = "1".
11 1 = setpoint inversion 1: Setpoint is inverted - BI: p1113
0: The setpoint is not inverted
12 Reserved - -
13 1 = Motorized potentiome‐ Only when p0922 = 1 or 352, otherwise reserved - BI: p1035
ter, higher
14 1 = Motorized potentiometer, Only when p0922 = 1 or 352, otherwise reserved - BI: p1036
lower
Note:
If "Motorized potentiometer, higher" and "Motorized potentiometer, lower" are both 0 or 1 at the same time, the
current setpoint is frozen.
15 1 = CDS bit 0 1: Command data set changeover (CDS) bit 0 is - BI: p0810
(only with telegrams p0922 active.
= 20!) 0: Command data set changeover (CDS) bit 0 is
inactive.
Reserved When p0922 = 1 or 352 - -

STW2 (control word 2)

Table 10-9 Control word 2 (STW2)
Bit Meaning Interconnection parameter

0 Drive data set selection DDS, bit 0 p0820[0] = r2093.0
1 Drive data set selection DDS, bit 1 p0821[0] = r2093.1
2 to 11 Reserved -
12 Master sign-of-life bit 0 p2045 = r2050[3]
13 Master sign-of-life bit 1
STW1_BM (control word 1, metal industry)

Table 10-10 Description of STW1_BM (control word 1, metal industry)

0 0 = OFF (OFF1) p0840[0] = r2090.0
= ON
1 0 = OFF2 (immediate pulse cancellation with switching on inhibited) p0844[0] = r2090.1
1 = No OFF2 (enable is possible)
2 0 = OFF3 (braking along the OFF3 ramp, then pulse suppression with p0848[0] = r2090.2
switching on inhibited)
1 = No OFF3 (enable is possible)
3 0 = Inhibit operation p2816[0] = r2090.3
1 = Enable operation
4 0 = Set ramp-function generator zero p1140[0] = r2090.4
1 = Enable ramp-function generator
5 0 = Freeze ramp-function generator p1141[0] = r2090.5
1 = Continue ramp-function generator
6 0 = Speed setpoint = 0 p1142[0] = r2090.6
1 = Speed setpoint enable
7 = Acknowledge fault p2103[0] = r2090.7
8 Reserved -
9 Reserved -
10 1 = Control via PL 1)
p0854[0] = r2090.10
11 to 15 Reserved 2) -
1)
STW1.10 must be set in order for the drive object to accept the process data (PZD).
2)
Interconnection is not disabled.

STW2_BM (control word 2, metal industry)

Table 10-11 Description of STW1_BM (control word 1, metal industry)

0 Command data set selection CDS bit 0 p0810 = r2093.0
1 Reserved -
2 Drive data set selection, CDS bit 0 1)
p0820[0] = r2093.2
3 Drive data set selection, CDS bit 1 1) p0821[0] = r2093.3
4 Reserved -
5 1 = Bypass ramp-function generator p50641[0] = r2093.5
6 Reserved -
7 1 = Speed controller integration value set p50695[0] = r2093.7
8 1 = Enable droop p50684[0] = r2093.8
9 1 = Enable speed controller 1)
p0856[0] = r2093.9
10 Reserved 1) -
11 0 = Speed-controlled mode p50687[0] = r2093.11
1 = Torque-controlled mode
12 Reserved 1) -
13 Reserved 1)
-
14 Reserved 1) -
15 Controller sign-of-life toggle bit p2081[15] = r2093.15
1)
NSET_A (speed setpoint A (16-bit))

• Speed setpoint with a 16-bit resolution with sign bit.
• Bit 15 determines the sign of the setpoint:
– Bit = 0 → Positive setpoint
– Bit = 1 → Negative setpoint
• The speed is normalized via p2000.
NSET_A = 4000 hex or 16384 dec ≐ speed in p2000

NSET_B (speed setpoint B (32-bit))

• Speed setpoint with a 32-bit resolution with sign bit.
• Bit 31 determines the sign of the setpoint:
– Bit = 0 → Positive setpoint
– Bit = 1 → Negative setpoint
• The speed is normalized via p2000.
NSET_B = 4000 0000 hex or 1 073 741 824 dec ≐ speed in p2000
Q
S
KH[ 16(7B$
KH[ 16(7B%
Figure 10-6 Speed scaling
Note
Operation of motors in the field-weakening range
If the motors are to be operated in the field-weakening range > 2:1, the value of parameter
p2000 must be set ≤ 1/2 x maximum speed of the drive object.
Gn_STW (encoder n control word)

This process data belongs to the encoder interface.
A_DIGITALCU_STW1
This process data is part of the central process data.
10.3.2.3 Description of status words and actual values
Overview of status words and actual values
Table 10-12 Overview of status words and actual values, see function diagram [2450]

number parameter
ZSW1 Status word 1 2 U16 r2089[0]
ZSW2 Status word 2 4 U16 r2089[1]
NACT_A Speed setpoint A (16-bit) 6 I16 r0063
G1_ZSW Encoder 1 status word 10 U16 r0481[0]
G1_XIST1 Encoder 1 actual position value 1 11 U32 r0482[0]


number parameter
G2_ZSW Encoder 2 status word 14 U16 r0481[1]
E_DIGITAL Digital input (16-bit) 21 U16 r2089[2]
IAIST_GLATT Absolute actual current value, smoothed 51 I16 r0027
MIST_GLATT Actual torque value, smoothed 53 I16 r0080
PIST_GLATT Active power, smoothed 54 I16 r0032
NACT_A_GLATT Actual speed value, smoothed 57 I16 r0021
MELD_NAMUR VIK-NAMUR message bit bar 58 U16 r3113
FAULT_CODE Fault code 301 U16 r2131
WARN_CODE Alarm code 303 U16 r2132
ZSW1_BM Status word 1, variant for BM 323 U16 r2089[0]
ZSW2_BM Status word 2, variant for BM 325 U16 r2089[1]
CU_ZSW1 Status word 1 for Control Unit 501 U16 r2089[1]
1)
Data type according to PROFIdrive profile V4:
I16 = Integer16, I32 = Integer32, U16 = Unsigned16, U32 = Unsigned32
ZSW1 (status word 1)

Table 10-13 Description of status word 1 (ZSW1)
Bit Meaning Explanation Parameter

0 Ready for switching on 1 Ready for switching on BO: r0899.0
Power supply on, electronics initialized, line contactor re‐
leased if necessary, pulses inhibited
0 Not ready for switching on
1 Ready for operation 1 Ready for operation BO: r0899.1
Line voltage applied, i.e. line contactor closed (if present),
field being built up
0 Not ready for operation
Reason: No ON command has been issued.
2 Operation enabled 1 Operation enabled BO: r0899.2
Enable electronics and pulses, then ramp up to active set‐
point
0 Operation disabled
3 Fault active 1 Fault active BO: r2139.3
The drive is faulty and, therefore, out of service. The drive
switches to "switching on inhibited" once the fault has
been acknowledged and the cause has been remedied.
The active faults are stored in the fault buffer.
0 No fault active
There are no faults in the fault buffer.

Bit Meaning Explanation Parameter

4 Coasting down not active 1 Coasting down (OFF2) not active BO: r0899.4
(OFF2 inactive) 0 Coasting down active (OFF2)
An OFF2 command is active.
5 Quick stop not active 1 Quick stop (OFF3) not active BO: r0899.5
(OFF3 inactive) 0 Quick stop active (OFF3)
An OFF3 command is active.
6 Switching on inhibited active 1 Switching on inhibited BO: r0899.6
Switching back on is only possible by means of OFF1 and
then ON.
0 No switching on inhibited
Switching on is possible.
7 Alarm active 1 Alarm active BO: r2139.7
The drive is operational again. No acknowledgement nec‐
essary.
The active alarms are stored in the alarm buffer.
0 No alarm active
No alarms in the alarm buffer.
8 Speed setpoint/actual value devi‐ 1 Setpoint/actual value monitoring in tolerance band BO: r2197.7
ation in tolerance Actual value within tolerance band; dynamic overshoot or
undershoot permitted for t < tmax, tmax can be parame‐
terized. See FP8020 and FP2534
0 Setpoint/actual value monitoring not within tolerance
band
9 Control request 1 The automation system is requested to assume control. BO: r0899.9
"1" is always present 0 Control is only possible at the unit itself
10 n setpoint reached or exceeded 1 n setpoint reached or exceeded BO: r2199.1
0 n setpoint not reached
Note:
The message is parameterized as follows: p50373 (threshold value), p50374 (hysteresis)
See FP8020 and FP2537
11 I or M limit not reached (when 1 I or M limit not reached BO: r1407.7 (in‐
p0922 = 1 or 352) 0 I or M limit reached or exceeded verted)
I or M limit not reached (when 1 I or M limit not reached BO: r0056.13 (in‐
p0922 = 20) 0 I or M limit reached or exceeded verted)
12 Holding brake released 1 Holding brake is released BO: r0899.12
(when p0922 = 1 or 352) 0 Holding brake is closed
Reserved (when p0922 = 20)
13 No motor overtemperature alarm 1 Alarm overtemperature motor not pending BO: r2135.14 (in‐
0 Motor overtemperature alarm pending verted)
14 Motor rotates forward 1 Motor rotates forward (n_act ≥ 0) BO: r2197.3
(n_act ≥ 0) 0 Motor does not rotate forward (n_act < 0)
15 Reserved
(when p0922 = 1 or 352)
CDS display 1 CDS selection bit 0 selected BO: r0836.0
(when p0922 = 20) 0 CDS selection bit 0 not selected

ZSW2 (status word 2)

Table 10-14 Status word 2 (ZSW2)

0 1 = Drive data set selection DDS effective, bit 0 p2081[0] = r0051.0
1 1 = Drive data set selection DDS effective, bit 1 p2081[1] = r0051.1
2 Reserved -
3 Reserved -
4 Reserved -
5 1 = Alarm class bit 0 p2081[5] = r2139.11
7 Reserved -
8 Reserved -
9 Reserved -
10 1 = Enable pulses p2081[10] = r0899.11
11 to 15 Reserved -
ZSW1_BM (status word 1, metal industry)

Table 10-15 Status word 1, metal industry (ZSW1 BM) 1)

0 1 = Ready to switch on p2080[0] = r0899.0
1 1 = Ready p2080[1] = r0899.1
2 1 = Enable operation 1 p2080[2] = r2811.0
3 1 = Fault present p2080[3] = r2139.3
4 0 = Coast to stop active (OFF2) p2080[4] = r0899.4
5 0 = Quick stop active (OFF3) p2080[5] = r0899.5
6 1 = Switching on inhibited active p2080[6] = r0899.6
7 1 = Alarm present p2080[7] = r2139.7
8 1 = Speed setpoint/actual-value deviation in tolerance p2080[8] = r2197.7
9 1 = Control requested 2)
p2080[9] = r0899.9
10 1 = n comparison value reached or exceeded p2080[10] = r2199.1
11 1 = Torque limit not reached p2080[11] = r1407.7
12 1 = Open holding brake p2080[12] = r0899.12
13 to 15 Reserved 3) -
1)
ZSW1 BM is formed via binector-connector converter (BI: p2080[0...15], inversion: p2088[0].0...p2088[0].15).
2)
The drive object is ready for acceptance.
3)

ZSW2_BM (status word 2, metal industry)

Table 10-16 Status word 2, metal industry (ZSW2 BM)

0 to 4 Reserved 1)
-
7 Reserved -
8 Reserved -
9 1 = Speed setpoint limited p2081[9] = r1407.11
10 1 = Upper torque limit reached p2081[10] = r1407.8
11 1 = Lower torque limit reached p2081[11] = r1407.9
12 1 = Encoderless operation because of fault p2081[12] = r1407.13
13 Reserved -
14 Reserved -
15 Controller sign of life toggle bit p2081[15] = r2093.15
1)
NACT_A (speed setpoint A (16-bit))

• Actual speed value with 16-bit resolution.
• The speed actual value is normalized in the same way as the setpoint (see NSET_A).
NACT_B (speed setpoint B (32-bit))

• Actual speed value with 32-bit resolution.
• The speed actual value is normalized in the same way as the setpoint (see NSET_B).
Gn_ZSW (encoder n status word)Gn_XIST1 (encoder n actual position value 1)Gn_XIST2

(encoder n actual position value 2)
This process data belongs to the encoder interface.
E_DIGITALCU_ZSW1
This process data is part of the central process data.
IAIST_GLATT
The absolute current actual value smoothed with p0045 is displayed.

MIST_GLATT
The actual torque value smoothed with p0045 is displayed.
PIST_GLATT
The active power smoothed with p0045 is displayed.
NACT_A_GLATT
The actual speed value smoothed with p0045 is displayed.
MELD_NAMUR
Display of the NAMUR message bit bar.
WARN_CODE
Display of the alarm code (see function diagram [8065]).
FAULT_CODE
Display of the fault code (see function diagram [8060]).
10.3.2.4 Control and status words for encoders
The process data for the encoders is available in various telegrams. For example, telegram 3 is
provided for speed control with 1 position encoder and transmits the process data of encoder 1.
The following process data is available for the encoders:
• Gn_STW encoder n control word (n = 1, 2)
• Gn_ZSW encoder n status word
• Gn_XIST1 encoder n act. pos. value 1
• Gn_XIST2 encoder n act. pos. value 2
Note
Encoder 1: Motor encoder
Encoder 2: Direct measuring system

Example of encoder interface
*B67:
352),%86 *B67:
0DVWHU 6ODYH
*B=6: *B;,67 *B;,67
*B=6: *B;,67
Figure 10-7 Example of encoder interface (encoder-1: Two actual values, encoder -2: One actual
value)
Encoder n control word (Gn_STW, n = 1, 2)

The encoder control word controls the encoder functions.
Table 10-17 Description of the individual signals in Gn_STW
Bit Name Signal status, description

0 Find refer‐ Functions If bit 7 = 0, then find reference mark request applies:
1 ence mark or Bit Meaning
flying meas‐
2 0 Function 1 Reference mark 1
urement
2 Function 3 Reference mark 3
If bit 7 = 1, then find flying measurement request applies:
0 Function 1 Probe 1 rising edge
1 Function 2 Probe 1 falling edge
2 Function 3 Probe 2 rising edge
3 Function 4 Probe 2 falling edge
Note:
• Bit x = 1 Request function
Bit x = 0 Do not request function
• If more than 1 function is activated, then the following applies:
The values for all functions cannot be read until each activated function has
terminated and this has been confirmed in the corresponding status bit
(ZSW.0/.1/.2/.3 "0" signal again).
• Reference mark search
It is possible to search for a reference mark.
• External zero mark
• Flying measuring
Positive and negative edges can be simultaneously selected.


4 Command Bit 6, 5, 4 Meaning
5 000 No function
6 001 Activate selected function
010 Read generated value
011 Cancel function
(x: Function selected using bit 0 to 3)
7 Mode 1 Not permitted
0 Reference mark search (fine resolution via p0418)
8... 12 Reserved -
13 Request cyclic absolute value 1 Request cyclic transfer of the absolute actual position value in Gn_XIST2.
Used for (e.g.):
• Additional measuring system monitoring
• Synchronization during ramp-up
0 No request
14 Parking encoder 1 Request parking encoder (handshake with Gn_ZSW bit 14)
0 No request
15 Acknowledge encoder fault 0/1 Request to reset encoder errors
*QB=6:

(QFRGHUIDXOW

*QB67:
$FNQRZOHGJHHQFRGHU
IDXOW

*QB=6:
(QFRGHUIDXOWDFNQRZ
OHGJHDFWLYH
&OHDUIDXOW
6LJQDOPXVWEHUHVHWE\XVHU
0 No request
Example: Reference mark search

Assumptions for the example:
• Distance-coded reference mark
• Two reference marks (function 1/function 2)
• Position control with encoder 1

0RGH
*B67: 5HIHUHQFHPDUNVHDUFK

5HIHUHQFHPDUN 5HIHUHQFHPDUN
)XQFWLRQ
*B67:
5HIHUHQFHPDUN 5HIHUHQFHPDUN
)XQFWLRQ
*B67:

$FWLYDWHIXQFWLRQ
&RPPDQG
*B67:
$FWLYDWHIXQFWLRQ
5HDG 5HDG
YDOXH YDOXH
*B67:
5HDGYDOXH

)XQFWLRQDFWLYH

)XQFWLRQDFWLYH
*B=6:

)XQFWLRQDFWLYH

)XQFWLRQDFWLYH
*B=6:
9DOXH 9DOXH
DYDLODEOH DYDLODEOH

9DOXHDYDLODEOH
*B=6:
$FWXDOSRVLWLRQYDOXH $FWXDOSRVLWLRQYDOXH
DWUHIHUHQFHPDUN DWUHIHUHQFHPDUN

*[B;,67

5HIHUHQFHPDUN
$FWXDOYDOXHWUDQVIHU

6LJQDOPXVWEHUHVHWE\XVHU
Figure 10-8 Sequence chart for "Reference mark search"
Encoder 2 control word (G2_STW)

• See G1_STW

Encoder n status word (Gn_ZSW, n = 1, 2)

The encoder status word is used to display states, errors and acknowledgements.
See function diagram [4730]
Table 10-18 Description of the individual signals in Gn_ZSW

0 Reference Status: Valid for "Reference mark search" and "Flying measurement"
1 mark search Function 1 - 4 Bit Meaning
active
Note:
• Bit x = 1 function active
Bit x = 0 function inactive
4 Status: Applies to reference mark search
5 Value 1 - 4 Bit Meaning
available
6 4 Value 1 Reference mark 1
7 Probe 1 rising edge
5 Value 2 Reserved
6 Value 3 Reserved
7 Value 4 Reserved
Note:
• Bit x = 1 value available
Bit x = 0 value not available
• Only one single value can be retrieved.
Reason: There is only one common status word Gn_XIST2 to read the values.
8 Reserved 1 Reserved
0 Reserved
9 Reserved 1 Reserved
0 Reserved
10 Reserved -
11 Encoder fault acknowledge ac‐ 1 Encoder fault acknowledge active
tive Note:
See at STW.15 (acknowledge encoder error)
0 No acknowledgement active
12 Reserved -
13 Transmit absolute value cycli‐ 1 Acknowledgement for Gn_STW.13 (request absolute value cyclically)
cally Note:
Cyclic transmission of the absolute value can be interrupted by a function
with higher priority.
• See Gn_XIST2
0 No acknowledgement


14 Parking encoder 1 Parking encoder active (i.e. parking encoder switched off)
0 No active parking encoder
15 Encoder fault 1 Error from encoder or actual-value sensing is active.
Note:
The error code is stored in Gn_XIST2.
0 No error is active.
Encoder 1 actual position value 1 (G1_XIST1)

• Resolution: Encoder lines ∙ 2n
n: Fine resolution, no. of bits for internal multiplication
The fine resolution is specified via p0418.
• Used to transfer the cyclic actual position value to the controller.
• The transferred value is a relative, free-running actual value.
• Any overflows must be evaluated by the master controller.
LQWHUQDOPXOWLSOLFDWLRQ
(QFRGHUSXOVHV )LQHLQIRUPDWLRQ
%LW
SIRU*[B;,67 HQFRGHUWR )DFWRU\VHWWLQJ
Figure 10-9 Subdivision and settings for Gx_XIST1
• Encoder lines of incremental encoder

– For encoders with sin/cos 1Vpp:
Encoder lines = no. of sinusoidal signal periods
• After power-up: Gx_XIST1 = 0
• An overflow in Gx_XIST1 must be viewed by the master controller.
• There is no modulo interpretation of Gx_XIST1 in the drive.

Different values are entered in Gx_XIST2 depending on the function.
• Priorities for Gx_XIST2
The following priorities should be considered for values in Gx_XIST2:

<HV
3DUNLQJHQFRGHU" *[B=6: *[B;,67
1R
<HV *[B;,67
(QFRGHUIDXOW" *[B=6:
)DXOWFRGH
1R
*[B=6:
)LQGUHIHUHQFHPDUN <HV *[B;,67
RU
RUIO\LQJPHDVXUHPHQW UHTXHVWHGYDOXH
RU
VHOHFWHG" S
RU
1R
<HV *[B;,67
&\FOLFDEVROXWHYDOXH DEVROXWHYDOXH
*[B=6:
WUDQVPLWWHG" S
1R
Figure 10-10 Priorities for functions and Gx_XIST2
• Resolution: Encoder pulses ∙ 2n

n: Fine resolution, no. of bits for internal multiplication
LQWHUQDOPXOWLSOLFDWLRQ
(QFRGHUSXOVHV )LQHLQIRUPDWLRQ

IRUUHIHUHQFHPDUNRUIO\LQJPHDVXUHPHQWWKH )DFWRU\VHWWLQJ
IROORZLQJDSSOLHV S
SIRU*B;,67 HQFRGHU S
SIRU*B;,67 HQFRGHU
)RUUHDGDEVROXWHYDOXH (Q'DWHQFRGHU
SIRU*B;,67 HQFRGHU
SIRU*B;,67 HQFRGHU
Figure 10-11 Subdivision and settings for Gx_XIST2
• Encoder lines of incremental encoder

– For encoders with sin/cos 1Vpp:
Encoder lines = no. of sinusoidal signal periods

Error code in Gn_XIST2
Table 10-19 Error code in Gn_XIST2
n_XIST2 Meaning Possible causes / description

1 Encoder fault One or more existing encoder faults.
Detailed information in accordance with drive messages.
2 Zero mark monitoring –
3 Abort parking sensor • Parking drive object already selected.
4 Abort find reference mark • A fault exists (Gn_ZSW.15 = 1)
• Encoder has no zero mark (reference mark)
• Reference mark 2, 3 or 4 is requested
• Switchover to "Flying measurement" during search for reference mark
• Command "Read value x" set during search for reference mark
• Inconsistent position measured value with distance-coded reference marks.
5 Abort retrieve reference • More than four values requested
value • No value requested
• Requested value not available
6 Abort flying measurement • No probe configured p0488, p0489
• Switch over to "reference mark search" during flying measurement
• Command "Read value x" set during flying measurement
7 Abort get measured value • More than one value requested
• No value requested
• Requested value not available
• Parking encoder active
• Parking drive object active
8 Abort absolute value trans‐ • Absolute encoder not available
mission on • Alarm bit absolute value protocol set
3841 Function not supported –
Encoder 2 status word (G2_ZSW)

• See Gn_ZSW

• See Gn_XIST1

• See Gn_XIST2

• 4720 Encoder evaluation - Encoder interface, receive signals, encoders 1 ... 2

• 4730 Encoder evaluation - Encoder interface, send signals, encoders 1 ... 2
• 4735 Encoder evaluation - Reference mark search with external zero mark, encoders 1 ...
2
Adjustable parameter drive, CU_S parameter is marked

• p0418[0...15] Fine resolution Gx_XIST1 (in bits)
• p0419[0...15] Fine resolution absolute value Gx_XIST2 (in bits)
• p0480[0...2] CI: Encoder control word Gn_STW signal source
Display parameters drive
• r0481[0...2] CO: Encoder status word Gn_ZSW
• r0482[0...2] CO: Encoder actual position value Gn_XIST1
• r0483[0...2] CO: Encoder actual position value Gn_XIST2
• r0487[0...2] CO: Diagnostic encoder control word Gn_STW
• r0979[0...30] PROFIdrive encoder format
10.3.2.5 Extended encoder evaluation
The standard parameter r0979[0...30] describes the assignment from the telegram
configuration view.
Index 1 describes the encoder type. Subindex 1 provides further properties of the encoder:
Table 10-20 r0979 subindex 1
Bit Signal Description

0 =0 Rotating encoder
=1 Linear encoder
1 =0 No fine resolution possible
=1 Fine resolution possible
2 =0 64-bit not possible
=1 Reserved
3 - 28 In accordance with the PROFIdrive profile definition
29 =0 Encoder switchable
=1 Encoder not switchable
30 =0 Interface information still to be received
=1 No further interface information will be received
31 =0 Data in the substructure is invalid
=1 Data in the substructure is valid

10.3.2.6 Central control and status words
Description
The central process data exists for different telegrams. For example, telegram 390 is used for
transferring digital inputs and digital outputs.
The following central process data is available:
Receive signals:
• CU_STW1 Control Unit control word
• A_DIGITAL digital outputs
Transmit signals:
• CU_ZSW1 Control Unit status word
• E_DIGITAL digital inputs
• E_DIGITAL_1 digital inputs
CU_STW1 (control word for Control Unit, CU)

Table 10-21 Description of CU_STW1 (control word for Control Unit)
Bit Meaning Remarks Interconnection

parameter
0 Reserved – – –
1 RTC PING – This signal is used to set the UTC time using the PING event. p3104 = r2090.1
2...6 Reserved – – –
7 Acknowledge faults Acknowledge faults p2103[0] =
r2090.7
8...9 Reserved - - -
10 Control transferred 0 The CU has control p3116 = r2090.10
Once the propagated faults have been acknowledged at all
drive objects, the fault is also implicitly acknowledged at
drive object 1 (DO1 ≙ CU).
1 External control has control
The propagated faults must be acknowledged at all drive ob‐
jects and must also be explicitly acknowledged at drive object
1 (DO1 ≙ CU).
11...15 Reserved – -

A_DIGITAL (digital outputs)

This process data can be used to control the Control Unit outputs.
Table 10-22 Description of A_DIGITAL (digital outputs)

0 Digital output 0 (DO 0) p50771[0] = r2091.0
4...15 Reserved -
CU_ZSW1 (status word of the DO1 telegram (telegrams 39x))

Table 10-23 Description of CU_ZSW1 (status word of the CU)

0...2 Reserved -
3 1 = Fault present. The active faults are stored in the fault buffer. p2081[3] = r2139.3
0 = No fault present. There are no faults in the fault buffer.
4...6 Reserved -
7 1 = Alarm present. The active alarms are stored in the alarm buffer. p2081[7] = r2139.7
0 = No alarm present. There are no alarms in the alarm buffer.
8 1 = Synchronize system time. p2081[8] = r0899.8
9 1 = No group alarm present. p2081[9] = r3114.9
10 1 = No group fault present. p2081[10] = r3114.10
11 Reserved, always “1” -
12...15 Reserved -
E_DIGITAL (digital inputs)

Table 10-24 Description of E_DIGITAL (digital inputs)
Bit Meaning Interconnection parameter 1)

0 CUD digital input 4 (DI 4) 2) p2082[0] = r53010.8
1 CUD digital input 5 (DI 5) 2)
p2082[1] = r53010.10
2 CUD digital input 6 (DI 6) 2) p2082[2] = r53010.12
3 CUD digital input 7 (DI 7) 2)
p2082[3] = r53010.14
4...7 Reserved -
8 CUD digital input 0 (DI 0) p2082[8] = r53010.0

Bit Meaning Interconnection parameter 1)

12...15 Reserved -
1)
Default can be freely changed.
2)
Can be set via p50789[0…3] as digital input or digital output.
10.3.2.7 Diagnostics channels for cyclic communication
Alarms and faults can be transferred via two independent diagnostic channels DS0 and DS1. The
information transferred is saved in parameters r0945[8] for faults and in r2122[8] for alarms.
This allows the alarms and faults from a SINAMICS drive to be integrated into the system
diagnostics of a higher-level controller and automatically displayed on an HMI. This function is
certified for PROFINET and PROFIdrive.
The function is activated via the appropriate parameterization in the configuration tool being
used, e.g. using HW Config or TIA Portal. The functionality is then transferred at the next
power up to drive.
The messages of the diagnostic channels depend on the bus system being used for data
transfer.
Table 10-25 Messages in relation to bus system
PROFIdrive error classes SINAMICS messages

Faults Alarms Faults Alarms Fault/alarm
PN GSD Yes Yes No No Is detected and localized
TIA Yes Yes Yes Yes Is detected and localized,
allows problems to be di‐
rectly resolved
• The alarms and faults correspond to the error classes defined in the PROFIdrive profile.
• You can select whether alarms and faults are transferred to a higher-level controller either as
SINAMICS messages or using the error classes of the PROFIdrive profile.
• The alarms and faults can be mapped with standard resources (e.g. GSDML)

• The alarms or faults are logically and locally signaled:

– With alarm or fault number
– With assignment of the drive object, message value and hardware component
assignment
– In a user-friendly way with plain message texts
– Display with user-defined names for drive objects and components
– SINAMICS transfers the messages in the order that they have occurred
– SINAMICS does not record any time stamps
– The time stamps are generated from the higher-level controller when the messages are
received
– To transfer the SINAMICS messages, the extended channel diagnostics is used
• The existing mechanisms of TIA and S7 Classic can be used.
• The messages are compatible with PROFINET controllers.
• Alarms or faults are acknowledged using the already known acknowledgment routes.
• Transfer possible via interface IF1 and/or IF2
Note
Restriction in the case of shared device
If Shared device is activated, only one of the controllers can receive diagnoses.
Transmission in the case of cyclic communication

• For PROFINET, there is a unique assignment of the drive objects to the slots of the cyclic
communication. The diagnostics is issued at the MAP/PAP-submodule.
Transmission in the case of acyclic communication

• There is no slot or subslot configured at which diagnostics can be issued.
• Faults or alarms that occur are routed along the BICO connections to the drive objects.
Display of error classes according to PROFIdrive

• For transfer with PROFINET, the PROFIdrive error class and the extended channel diagnostics.
10.3.3 Parallel operation of communication interfaces
The two cyclic interfaces for the setpoints and actual values differ by the parameter ranges used
(BICO technology, etc.) and the functions that can be used. The interfaces are designated as
cyclic interface 1 (IF1) and cyclic interface 2 (IF2).

Cyclic process data (setpoints / actual values) are processed using interfaces IF1 and IF2. The
following interfaces are used:
• Onboard interfaces of the Control Unit for PROFIBUS DP
• An additional interface (COMM-BOARD) for PROFINET or Ethernet/IP (CBE20 Communication
Board Ethernet) that can be inserted in the Control Unit as an option.
Parameter p8839 is used to set the parallel use of the Control Unit onboard interfaces and
COMM-BOARD in the SINAMICS system. The functionality is assigned to interfaces IF1 and IF2
using indices.
For example, the following applications are possible:
• PROFIBUS DP for control and PROFINET to acquire actual values / measured values of the drive
• PROFIBUS DP for control and PROFINET for engineering only
• Mixed mode with two masters (the first for logic and coordination, and the second for
technology)
• SINAMICS Link via IF1 (CBE20 Communication Board Ethernet); PROFIBUS (only DO drive,
max. 16 PZD) IF2
• Operation of redundant communication interfaces
Assignment of communication interfaces to cyclic interfaces

The two cyclic interfaces for the setpoints and actual values differ by the parameter ranges used
(BICO technology, etc.) and the functions that can be used. The interfaces are designated as
cyclic interface 1 (IF1) and cyclic interface 2 (IF2).
With the factory setting p8839 = 99, the communication interfaces are permanently
assigned one of the cyclic interfaces (IF1, IF2), depending on the communication system,
e.g. PROFIBUS DP, PROFINET.
The assignment to the cyclic interfaces can essentially be freely defined by user
parameterization for the parallel operation of the communication interfaces.
Properties of the cyclic interfaces IF1 and IF2

The following table shows the different features of the two cyclic interfaces:
Table 10-26 Properties of the cyclic interfaces IF1 and IF2
Feature IF1 IF2

Setpoint (BICO signal source) r2050, r2060 r8850, r8860
Actual value (BICO signal sink) p2051, p2061 p8851, p8861
PROFIdrive conformance Yes No
PROFIdrive telegram selection (p0922) Yes No
Isochronous mode possible (p8815[0]) No No
PROFIsafe possible (p8815[1]) No No
Direct data exchange (PROFIBUS only) Yes Yes
List of drive objects (p0978) Yes Yes
Max. PZD (16-bit) setpoint / actual value DC_CTRL 64 / 64 64 / 64

Feature IF1 IF2

Max. PZD (16-bit) setpoint / actual value encoder 4 / 12 4 / 12
Max. PZD (16-bit) setpoint / actual value TM31 5/5 5/5
Max. PZD (16-bit) setpoint / actual value TM15DI_DO 5 / 5 5/5
Max. PZD (16-bit) setpoint / actual value TM150 5/5 5/5
Max. PZD (16-bit) setpoint / actual value CU (device) 20 / 25 20 / 25
Table 10-27 Implicit assignment of hardware to cyclic interfaces for p8839[0] = p8839[1] = 99
Plugged hardware interface IF1 IF2

No option, only use Control Unit onboard interface Control Unit onboard --
(PROFIBUS, PROFINET or USS)
CUD with CBE20 Communication Board Ethernet COMM BOARD Control Unit onboard
PROFIBUS or Control
Unit onboard USS
Parameter p8839[0,1] is used to set the parallel operation of the hardware interfaces and the
assignment to the cyclic interfaces IF1 and IF2 for the Control Unit drive object.
The object sequence for process data exchange via IF2 depends on the object sequence from
IF1; see "List of drive objects" (p0978).
The factory setting of p8839[0.1] = 99 enables the implicit assignment (see previous table).
An alarm is generated in case of invalid or inconsistent parameterization of the assignment.
Parameters for IF2
The following parameters are available in order to optimize the IF2 for a PROFIBUS or
PROFINET interface:
• Receive and send process data:
r8850, p8851, r8853, r8860, p8861, r88631)
• Diagnostic parameters:
r8874, r8875, r88761)
• Binector-connector converters:
p8880, p8881, p8882, p8883, p8884, r88891)
• Connector-binector converters:
r8894, r8895, p8898, p88991)
1)
Significance of 88xx identical to 20xx
Note
Using the HW Config configuration tool, a PROFIBUS/PROFINET device with two interfaces
cannot be shown. In parallel operation, this is the reason that SINAMICS appears twice in the
project or in two projects, although physically it is just one device.

Parameter
p8839 PZD Interface hardware assignment

Description: Assigning the hardware for cyclic communication via PZD interface 1 and interface 2.
Values: 0: Inactive
1: Control Unit onboard
2: COMM BOARD
99: Automatic
For p8839, the following rules apply:

• The setting of p8839 applies for all drive objects of a Control Unit (device parameter).
• For the setting p8839[0] = 99 and p8839[1] = 99 (automatic assignment, factory setting),
the hardware used is automatically assigned to interfaces IF1 and IF2. Both indices must be
selected so that the automatic assignment is activated. If both indices are not selected, then
an alarm is output and the setting p8839[x] = 99 is treated just like 'inactive'.
• An alarm is issued if the same hardware (Control Unit onboard or COMM-BOARD) is selected
in p8839[0] and p8839[1]. Then the setting of p8839[0] is valid, and the setting of p8839[1]
is treated as 'inactive'.
• If p8839[x] is set to 2, and the COMM-BOARD is missing/defective, then the corresponding
interface is not automatically supplied from the Control Unit onboard interface. Message
A08550 is output instead.
• p0922 IF1 PROFIdrive PZD telegram selection

• p0978[0...24] List of drive objects
• p8815[0...1] IF1/IF2 PZD functionality selection
• p8839[0...1] PZD Interface hardware assignment
10.3.4 Acyclic communication
10.3.4.1 General information about acyclic communication

With acyclic communication, as opposed to cyclic communication, data transfer takes place only
when an explicit request is made (e.g. in order to read and write parameters).
The "Read data record" and "Write data record" services are available for acyclic
communication.

The following options are available for reading and writing parameters:
• S7 protocol
This protocol uses the STARTER commissioning tool, for example, in online mode via
PROFIBUS.
• PROFIdrive parameter channel with the following data sets:
– PROFIBUS: Data block 47 (0x002F)
The DPV1 services are available for master class 1 and class 2.
– PROFINET: Data block 47 and 0xB02F al global access, data set 0xB02E as local access
Note
Please refer to the following documentation for a detailed description of acyclic communication:
Reference: PROFIdrive Profile V4.2, October 2015, Order No: 3.172
Note
Addressing
• PROFIBUS DP:
The addressing is carried out via the logical address or the diagnostics address.
• PROFINET IO:
The addressing is only undertaken using a diagnostics address which is assigned to a module
as of slot 1. Parameters cannot be accessed via slot 0.
&RQWUROOHU $F\FOLFFRPPXQLFDWLRQ 'HYLFH

6XSHUYLVRU
3DUDPHWHU
UHTXHVW ZLWKG :ULWH
DWD SD UHT
UDPHWH
UUHT XH VW 3DUDPHWHUUHTXHVW
V
:ULWHUH
GDWD
ZLWKRXW
5HDGU
ZLWKRX HT
WGDWD
3DUDPHWHU
SURFHVVLQJ
V
5HDGUH WD
GD
ZLWKRXW
5HDGU
ZLWKRX HT
WGDWD
V 3DUDPHWHUUHVSRQVH
5HDGUH UHVSRQVH
3DUDPHWHU S D UD PHWHU
WD
UHVSRQVH ZLWKGD
Figure 10-12 Reading and writing data

Properties of the parameter channel

• One 16-bit address exists for each parameter number and subindex.
• Concurrent access by several PROFIBUS masters (master class 2) or PROFINET IO supervisor
(e.g. commissioning tool).
• Transfer of different parameters in one access (multiple parameter request).
• Transfer of complete arrays or part of an array possible.
• Only one parameter request is processed at a time (no pipelining).
• A parameter request/response must fit into a data set (max. 240 bytes).
• The request or the response header is user data.
10.3.4.2 Structure of requests and responses
Structure of parameter request and parameter response
Table 10-28 Parameter request
Parameter request Offset

Values for Request header Request reference Request ID 0
write access Drive object No. Number of parameters 2
only
1st parameter address Attribute Number of elements 4
Parameter number 6
Subindex 8
...
nth parameter address Attribute Number of elements
Parameter number
Subindex
1st parameter value(s) Format Number of values
Values
...
...
nth parameter value(s) Format Number of values
Values
...

Table 10-29 Parameter response
Parameter response Offset

Values for read Response header Request reference mirrored Response ID 0
access only Axis mirrored Number of parameters 2
Error values for 1st parameter value(s) Format Number of values 4
negative re‐
sponse only Values or error values 6
...
...
nth parameter value(s) Format Number of values
Values or error values
...
Description of fields in DPV1 parameter request and response
Table 10-30 Fields
Field Data type Values Remark

Request reference Unsigned8 01 hex ... FF hex
Unique identification of the request/response pair for the master. The master changes the
request reference with each new request. The device mirrors the request reference in its re‐
sponse.
Request ID Unsigned8 01 hex Read request
02 hex Write request
Specifies the type of request.
In the case of a write request, the changes are made in a volatile memory (RAM). A save
operation is needed in order to transfer the modified data to the non-volatile memory (p0971,
p0977).
Response ID Unsigned8 01 hex Read request (+)
02 hex Write request (+)
81 hex Read request (-)
82 hex Write request (-)
Mirrors the request identifier and specifies whether request execution was positive or negative.
Negative means:
Cannot execute part or all of request.
The error values are transferred instead of the values for each subresponse.
Drive object Unsigned8 00 hex ... FF hex Number
number Specification of the drive object number for a drive unit with more than one drive object.
Different drive objects with separate parameter number ranges can be accessed over the same
DPV1 connection.
Number of parameters Unsigned8 01 hex ... 27 hex No. 1 ... 39
Limited by DPV1 telegram length
Defines the number of adjoining areas for the parameter address and/or parameter value for
multi-parameter requests.
The number of parameters = 1 for single requests.

Field Data type Values Remark

Attribute Unsigned8 10 hex Value
20 hex Description
30 hex Text (not implemented)
Type of parameter element accessed.
Number of elements Unsigned8 00 hex Special function
01 hex ... 75 hex No. 1 ... 117
Number of array elements accessed.
Parameter number Unsigned16 0001 hex ... FFFF hex No. 1 ... 65535
Addresses the parameter to be accessed.
Subindex Unsigned16 0000 hex ... FFFF hex No. 0 ... 65535
Addresses the first array element of the parameter to be accessed.
Format Unsigned8 02 hex Data type integer8
03 hex Data type integer16
04 hex Data type integer32
05 hex Data type unsigned8
08 hex Data type floating point
other values See PROFIdrive profile V3.1
40 hex Zero (without values as a positive
subresponse to a write request)
41 hex Byte
42 hex Word
43 hex Double word
44 hex Error
The format and number specify the adjoining space containing values in the telegram.
For write access, it is preferable to specify data types according to the PROFIdrive profile. Bytes,
words and double words are also possible as a substitute.
Number of values Unsigned8 00 hex ... EA hex No. 0 ... 234
Specifies the number of subsequent values.
Error values Unsigned16 0000 hex ... 00FF hex Significance of the error values
→ refer to the following table "Error
values in the DPV1 parameter respon‐
ses"
The error values in the event of a negative response.
If the values make up an odd number of bytes, a zero byte is attached. This ensures the integrity
of the word structure of the telegram.
Values Unsigned16 0000 hex ... 00FF hex
The values of the parameter for read or write access.
If the values make up an odd number of bytes, a zero byte is attached. This ensures the integrity
of the word structure of the telegram.

Error values in DPV1 parameter responses
Table 10-31 Error values in DPV1 parameter responses
Error Meaning Remark Addition‐

value al info
00 hex Illegal parameter number. Access to a parameter that does not exist. –
01 hex Parameter value cannot be changed. Modification access to a parameter value that cannot be Subindex
changed.
02 hex Lower or upper value limit exceeded. Modification access with value outside value limits. Subindex
03 hex Invalid subindex. Access to a subindex that does not exist. Subindex
04 hex No array. Access with subindex to non-indexed parameter. –
05 hex Wrong data type. Modification access with a value that does not match the data –
type of the parameter.
06 hex Setting not allowed (only reset). Modification access with a value not equal to 0 in a case where Subindex
this is not allowed.
07 hex Description element cannot be Modification access to a description element that cannot be Subindex
changed. changed.
09 hex No description data available. Access to a description that does not exist (the parameter value –
exists).
10 hex Read request is not executed. The read request is refused because know-how protection is
active.
0B hex No operating priority. Modification access with no operating priority. –
0F hex No text array exists. Access to a text array that does not exist (the parameter value –
exists).
11 hex Request cannot be executed due to op‐ Access is temporarily not possible for unspecified reasons. –
erating status.
14 hex Illegal value. Modification access with a value that is within the limits but is Subindex
illegal for other permanent reasons (parameter with defined
individual values).
15 hex Response too long. The length of the present response exceeds the maximum –
transfer length.
16 hex Illegal parameter address. Illegal or unsupported value for attribute, number of ele‐ –
ments, parameter number, subindex or a combination of
these.
17 hex Illegal format. Write request: Illegal or unsupported parameter data format. –
18 hex Number of values inconsistent. Write request: A mismatch exists between the number of val‐ –
ues in the parameter data and the number of elements in the
parameter address.
19 hex Drive object does not exist. You have tried to access a drive object that does not exist. –
20 hex Parameter text cannot be changed. – –
21 hex Service is not supported. Illegal or unknown request ID –
65 hex Parameter presently deactivated. You have tried to access a parameter that, although available, –
does not currently perform a function (e.g. n control set and
access to a V/f control parameter).
6B hex Write access for the enabled controller. Write access is realized while the device is in the "Controller –
enable" state.
Pay attention to the parameter attribute "changeable" in the
SINAMICS DCM List Manual (C1, C2, U, T).


value al info
6C hex Parameter %s [%s]: Unknown unit. – –
6D hex Parameter %s [%s]: Write access only in – –
the commissioning state, encoder
(p0010 = 4).
6E hex Parameter %s [%s]: Write access only in – –
the commissioning state, motor
(p0010 = 3).
6F hex Parameter %s [%s]: Write access only in – –
the commissioning state, power unit
(p0010 = 2).
70 hex Parameter %s [%s]: Write access only in – –
the quick commissioning mode
(p0010 = 1).
the ready mode (p0010 = 0).
the commissioning state, parameter
reset (p0010 = 30).
the commissioning state, Safety
(p0010 = 95).
the commissioning state, tech. appli‐
cation/units (p0010 = 5).
the commissioning state (p0010 not
equal to 0).
the commissioning state, download
(p0010 = 29).
77 hex Parameter %s [%s] must not be written – –
during download.
the commissioning state, drive config‐
uration (device: p0009 = 3).
the commissioning state, define drive
type (device: p0009 = 2).
7A hex Parameter %s [%s]: Write access only in – –
the commissioning state, data record
base configuration (de‐
vice: p0009 = 4).
7B hex Parameter %s [%s]: Write access only in – –
the commissioning state, device con‐
figuration (device: p0009 = 1).
7C hex Parameter %s [%s]: Write access only in – –
the commissioning state, device
download (device: p0009 = 29).


value al info
7D hex Parameter %s [%s]: Write access only in – –
the commissioning state, device pa‐
rameter reset (device: p0009 = 30).
7E hex Parameter %s [%s]: Write access only in – –
the commissioning state, device ready
(device: p0009 = 0).
7F hex Parameter %s [%s]: Write access only in – –
the commissioning state, device (de‐
vice: p0009 not equal to 0).
81 hex Parameter %s [%s] must not be written – –
during download.
82 hex Transfer of master control is blocked by – –
BI: p0806.
83 hex Parameter %s [%s]: Requested BICO in‐ The BICO output does not supply a float value. However, the –
terconnection not possible. BICO input requires a float value.
84 hex Parameter %s [%s]: Parameter change – –
inhibited (refer to p0300, p0400,
p0922)
85 hex Parameter %s [%s]: Access method not – –
defined.
87 hex Write request is not executed. The write request is rejected because know-how protection is –
active.
C8 hex Below currently valid limit. Modification request for a value that, although within "abso‐ –
lute" limits, is below the currently valid lower limit.
C9 hex Above currently valid limit. Modification request for a value that, although within "abso‐ –
lute" limits, is below the currently valid lower limit (e.g. gov‐
erned by the current converter rating).
CC hex Write access not permitted. Write access is not permitted because an access code is not –
available.

10.3.4.3 Determining the drive object numbers

Further information about the drive system (e.g. drive object numbers) can be determined as
follows using parameters p0101, r0102, and p0107/r0107:
1. The value of parameter r0102 ("Number of drive objects") for drive object/axis 1 is read via a
read request.
Drive object 1 is the Control Unit (CU) which is a minimum requirement for each drive system.
2. Depending on the result of the initial read request, further read requests for drive object 1 are
used to read the indices for parameter p0101 ("Drive object numbers"), as specified by
parameter r0102.
Example:
If the number of drive objects is "5", the values of indices 0 to 4 of parameter p0101 are read.
Of course, the relevant indexes can also be read at once.
Note
The first two points provide you with the following information:
• The number of drive objects that exist in the drive system
• The numbers of the existing drive objects
3. Following this, parameter r0107/p0107 ("Drive object type") is read for each drive object
(indicated by the drive object number).
Depending on the drive object, parameter 107 can be either an adjustable parameter or a
display parameter.
The value in parameter r0107/p0107 indicates the drive object type. The coding for the drive
object type is specified in the parameter list.
4. As of here, the list of parameters applies to the particular drive object.
10.3.4.4 Example 1: Read parameter
Requirements
• The PROFIdrive controller has been commissioned and is fully operational.
• PROFIdrive communication between the controller and the device is operational.
• The controller can read and write data sets in conformance with PROFIdrive DPV1.
Task description
After at least one fault occurs (ZSW1.3 = "1") at drive object 2, the active fault codes must be read
from the fault buffer r0945[0] ... r0945[7].
The request is to be handled using a request and response data block.

Basic procedure
1. Create a request to read the parameters.
2. Invoke the request.
3. Evaluate the response.
Create the request

Request header Request reference = 25 hex Request ID = 01 hex 0+1
Drive object No. = 02 hex Number of parameters = 01 hex 2+3
Parameter address Attribute = 10 hex Number of elements = 08 hex 4+5
Parameter no. = 945 dec 6
Subindex = 0 dec 8
Information about the parameter request:

• Request reference:
The value is selected at random from the valid value range. The request reference establishes
the relationship between request and response.
• Request ID:
01 hex → This identifier is required for a read request.
• Drive object No.:
02 hex → Drive 2, fault buffer with drive- and device-specific faults
• Number of parameters:
01 hex → One parameter is read.
• Attribute:
10 hex → The parameter values are read.
• Number of elements:
08 hex → The actual fault incident with eight faults is to be read.
• Parameter number:
945 dec → p0945 (fault code) is read.
• Subindex:
0 dec → Reading starts at index 0.
Initiate parameter request

If ZSW1.3 = "1" → Initiate parameter request.

Evaluate parameter response

Response header Request reference mirrored = Response ID = 01 hex 0+1
25 hex
Drive object No. mirrored = Number of parameters = 01 hex 2+3
02 hex
Parameter value Format = 06 hex Number of values = 08 hex 4+5
1st value = 1355 dec 6
2nd value = 0 dec 8
... ...
8th value = 0 dec 20
Information about the parameter response:

• Request reference mirrored:
This response belongs to the request with request reference 25.
• Response ID:
01 hex → Read request positive, values stored as of 1st value.
• Drive object No. mirrored, number of parameters:
The values correspond to the values from the request.
• Format:
06 hex → Parameter values are in the unsigned16 format.
• Number of values:
08 hex → Eight parameter values are available.
• 1st value ... 8th value
A fault is only entered in value 1 of the fault buffer for drive 2.
10.3.4.5 Example 2: Writing to parameters (multi-parameter request)
Requirements
• The PROFIdrive controller has been commissioned and is fully operational.
• PROFIdrive communication between the controller and the device is operational.
• The controller can read and write data sets in conformance with PROFIdrive DPV1.
Task description
Jog 1 and 2 are to be set up via the input terminals of the CUD. A parameter request is to be used
to write the corresponding parameters as follows:
• BI: p1055 = r53010.0 Jog bit 0

• BI: p1056 = r53010.6 Jog bit 1
• p50436[0] = 5% Jog 1 speed setpoint
• p50436[1] = 10 % Jog 2 speed setpoint

The request is to be handled using a request and response data block.
9
S>&@
; ',
U %,212)) 2))
; S>&@
',
U %,(QDEOHRSHUDWLRQLQKLELWRSHUDWLRQ
Figure 10-13 Task description for multi-parameter request (example)
To establish BICO interconnections, target parameters (p0840, p0852) are given a reference
to the source parameters (r53010.0, r53010.6):
Source parameter number Drive object number Index number Parameter value (DINT) for BICO
interconnection
r53010 2 (in the example, DC_CTRL) 0 CF12 0800 hex
r53010 2 (in the example, DC_CTRL) 6 CF12 0806 hex
DINT
Bits 31 ... 16 Bits 15 ... 10 Bits 9 ... 0
A drive object can be interconnected with itself using drive object No. 63. More detailed
information is provided in the following Chapter: "BICO technology: Interconnecting signals
(Page 335)".
Basic procedure
1. Create a request to write the parameters.
2. Invoke the request.
3. Evaluate the response.
1. Creating a request
Table 10-32 Parameter request

Request header Request reference = 40 hex Request ID = 02 hex 0+1
Drive object No. = 02 hex Number of parameters = 04 hex 2+3
1st parameter ad‐ Attribute = 10 hex Number of elements = 01 hex 4+5
dress Parameter no. = 1055 dec 6
Subindex = 0 dec 8
2nd parameter ad‐ Attribute = 10 hex Number of elements = 01 hex 10 + 11
Subindex = 0 dec 14
3rd parameter ad‐ Attribute = 10 hex Number of elements = 01 hex 16 + 17
Subindex = 0 dec 20


4th parameter ad‐ Attribute = 10 hex Number of elements = 01 hex 22 + 23
dress Parameter number = 50436 dec 24
Subindex = 1 dec 26
1st parameter val‐ Format = 07 hex Number of values = 01 hex 28 + 29
ue(s) Value = CF12 hex 30
Value = 0800 hex 32
2nd parameter val‐ Format = 07 hex Number of values = 01 hex 34 + 35
ue(s) Value = CF12 hex 36
Value = 0806 hex 38
3rd parameter val‐ Format = 08 hex Number of values = 01 hex 40 + 41
ue(s) Value = 40A0 hex 42
Value = 0000 hex 44
4th parameter val‐ Format = 08 hex Number of values = 01 hex 46 + 47
ue(s) Value = 4120 hex 48
Value = 0000 hex 50
Information about the parameter request:

• Request reference:
The value is selected at random from the valid value range. The request reference establishes
the relationship between request and response.
• Request ID:
02 hex → This identifier is required for a write request.
• Drive object No.:
02 hex → The parameters are written to drive 2.
• Number of parameters
04 hex → The multi-parameter request comprises four individual parameter requests.
1st parameter address ... 4. Parameter address

• Attribute:
10 hex → The parameter values are to be written.
• Number of elements
01 hex → One array element is written.
• Parameter number
Specifies the number of the parameter to be written (p1055, p1056, p50436).
• Subindex:
0 dec → ID of the first array element.

1st parameter value ... 4th parameter value

• Format:
07 hex → Data type, unsigned32
08 hex → Data type, floating point
• Number of values:
01 hex → A value is written to each parameter in the specified format.
• Value:
BICO input parameter: Enter signal source
Adjustable parameter: Enter value
2. Initiating the parameter request
3. Evaluating the parameter response

Response header Request reference mirrored = 40 hex Response ID = 02 hex 0
Drive object No. mirrored = 02 hex Number of parameters = 04 hex 2
Information about the parameter response

• Request reference mirrored:
This response belongs to the request with request reference 40.
• Response ID:
02 hex → Write request positive
• Drive object No. mirrored:
02 hex → The value matches the value from the request.
• Number of parameters:
04 hex → The value matches the value from the request.

10.4 Communication via PROFIBUS DP
10.4.1 PROFIBUS connection
WARNING
Electric shock during connection while voltage is present
• Only connect the PROFIBUS cable to connector X126 when the device is in a no-voltage
condition.
Position of PROFIBUS connection and diagnostics LEDs

The PROFIBUS connection and diagnostics LEDs are located on the Control Unit (CUD).
The PROFIBUS connection is via a 9-pin Sub-D socket X126. The connections are electrically
isolated.
See also Figure 6-31 Terminal/connector arrangement on the "Control Unit (CUD)" (Page 129)
and Chapter “Description of the LEDs on the CUD (Page 609)”.
Table 10-33 PROFIBUS connector assignment

X126
1 - Not assigned
1 2 - Not assigned
3 RxD/TxD-P RS485 receive/transmit data P (B)
4 CNTR-P Control signal (TTL)
5 DGND PROFIBUS data ground
9 6 VP Positive supply voltage (5 V +/-10%)
7 - Not assigned
8 RxD/TxD-N RS485 receive/transmit data N (A)
9 - Not assigned
Bus connector
The cables must be connected using PROFIBUS bus connectors as these contain the necessary
bus terminating resistors.
Suitable PROFIBUS bus connector: Article No. 6GK1500-0FC10

Figure 10-14 PROFIBUS bus connector
Bus terminating resistor

The bus terminating resistor must be switched on or off depending on its position in the bus,
otherwise the data will not be transmitted properly.
Principle: The terminating resistors must only be switched on at both ends of the bus line;
the resistors must be switched off at all other connectors.
The cable shield must be connected at both ends and over a large surface area.
)LUVWEXVSDUWLFLSDQW ODVWEXVSDUWLFLSDQW
RQ RQ RQ
RII RII RII
%XVWHUPLQDWLRQ %XVWHUPLQDWLRQ
IURPWKHSUHYLRXV WRWKHQH[W
EXVSDUWLFLSDQW EXVSDUWLFLSDQW
Figure 10-15 Position of the bus terminating resistors
10.4.2 General information about PROFIBUS
10.4.2.1 General information about PROFIBUS for SINAMICS
PROFIBUS is an open international fieldbus standard for a wide range of production and process
automation applications.
The following standards ensure open, multi-vendor systems:
• International standard EN 50170
• International standard IEC 61158

PROFIBUS is optimized for high-speed, time-critical data communication at field level.
Note
PROFIBUS for drive technology is standardized and described in the following document:
PROFIdrive Profile Drive Technology
http://www.profibus.com
NOTICE
Destruction of the CAN bus nodes
No CAN cables must be connected to interface X126. If CAN cables are connected, the CUD and
other CAN bus nodes may be destroyed.
Master and device

• Master and device properties
Properties Master Device

As bus node Active Passive
Send messages Permitted without external re‐ Only possible on request by
quest master
Receive messages Possible without any restrictions Only receive and acknowledge
permitted
• Master
Masters are categorized into the following classes:
– Master class 1 (DPMC1):
Central automation stations that exchange data with the devices in cyclic and acyclic
mode. Communication between the masters is also possible.
Examples: SIMATIC S7, SIMOTION
– Master class 2 (DPMC2):
Devices for configuration, commissioning, operator control and monitoring during bus
operation. Devices that only exchange data with the devices in acyclic mode.
Examples: Programming devices, human machine interfaces
• Devices
With respect to PROFIBUS, the SINAMICS drive unit is a device.
Bus access method

PROFIBUS uses the token passing method, i.e. the active stations (masters) are arranged in a
logical ring in which the authorization to send is received within a defined time frame.
Within this time frame, the master with authorization to send can communicate with other
masters or handle communication with the assigned devices in a master/device procedure.

PROFIBUS telegram for cyclic data transmission and acyclic services

Each drive unit that supports cyclic process data exchange uses a telegram to send and receive
all the process data. A separate telegram is sent in order to perform all the acyclic services (read/
write parameters) under a single PROFIBUS address. The acyclic data is transferred with a lower
priority after cyclic data transmission.
The overall length of the telegram increases with the number of drive objects that are
involved in exchanging process data.
Sequence of drive objects in the telegram

On the drive side, the sequence of drive objects in the telegram is displayed via a list in
p0978[0...24] where it can also be changed.
You can use the STARTER commissioning tool to display the sequence of drive objects for
a commissioned drive system in online mode in the project navigator under "Drive unit" >
"Communication" > "Telegram configuration".
When you create the configuration on the controller side (e.g. HW Config), the process-data-
capable drive objects for the application are added to the telegram in this sequence.
The following drive objects can exchange process data:
• Terminal Module 15 (TM15)
• DC drive control (DC_CTRL)
Note
The sequence of drive objects in HW Config must be the same as that in the drive (p0978).
The structure of the telegram depends on the drive objects taken into account during
configuration. Configurations are permitted that do not take into account all of the drive
objects that are present in the drive system.
Example:
The following configurations, for example, are possible:
• Configuration with CU_DC, DC_CTRL
• Configuration with DC_CTRL, TM31, TM31
• etc.

10.4.2.2 Example of a telegram structure for cyclic data acquisition
Task
The drive system comprises the following drive objects:
SINAMICS DCM with the objects
• CU_DC
• DC_CTRL
Configuration settings (e.g. HW Config for SIMATIC S7)

The components are mapped to objects for configuration.
Due to the telegram structure shown, the objects in the "DP slave properties" overview must
be configured as follows:
• CU_DC Standard telegram 390

• DC_CTRL Standard telegram 352
DP slave properties – overview - Drive-ES / STARTER
Figure 10-16 Slave properties - overview
When you click "Details", the properties of the configured telegram structure are displayed
(e.g. I/O addresses, axis separator).
DP slave properties – details

Figure 10-17 Slave properties - details
The axis separator separates the objects in the telegram as follows:
• Slot 4 and 5: Object 2 → DC_CTRL

• Slot 7 and 8: Object 1 → CU_DC
10.4.3 Commissioning PROFIBUS
10.4.3.1 Setting the PROFIBUS interface
Interfaces and diagnostic LED

See Chapter "PROFIBUS connection (Page 427)".
Note
A teleservice adapter can be connected to the PROFIBUS interface (X126) for remote diagnostics
purposes.
Setting the PROFIBUS address

The PROFIBUS address is set at parameter p0918.

The factory setting is

• For the left CUD: 126
• For the right CUD: 125
Each PROFIBUS address in a PROFIBUS line can only be assigned once. When several Control
Units are connected to a PROFIBUS line, you set the addresses differently than the factory
setting.
The PROFIBUS address can be changed
• Using the BOP20 (only possible on the left CUD)
• Using the AOP30 (if available)
• Using STARTER
You must switch to DO 1 (CU) to change the bus address using the BOP. Access level
p0003 = 3 is required to change p0918.
When using the STARTER commissioning tool, make sure that the bus address p0918 in the
offline project matches the online value. If this is not the case, the value is overwritten at the
next upload or download.
The PROFIBUS address must be saved in a non-volatile way using the "Copy RAM to ROM"
function.
The change made to the bus address takes effect after POWER ON.
10.4.3.2 PROFIBUS interface during operation
Generic station description file

A generic station description file clearly and completely defines the properties of a PROFIBUS
device.

The GSD files can be found:

• On the Internet. For the link, see "Preface (Page 3)"
• On the memory card in the directory \\SIEMENS\SINAMICS\DATA\CFG\.
– Universal module
– Axis separator
– Standard telegram1, PZD-2/2
– SIEMENS telegram 220, PZD-10/10
– Free telegram, PZD-4/4
– Device-to-device, PZD-1
The GSD file also includes standard telegrams, free telegrams and device-to-device telegrams
for configuring direct data exchange. With the aid of these telegram parts and an axis
separator, a telegram for the drive unit must be composed for each drive object.
Processing a GSD file in HW Config is included in the SIMATIC documentation. Suppliers of
PROFIBUS components can provide their own bus configuration tool. The description of the
respective bus configuration tool is described in the relevant documentation.
Note for commissioning for VIK-NAMUR

To be able to operate a SINAMICS drive as a VIK-NAMUR drive, standard telegram 20 must be set
and the VIK-NAMUR identification number activated via p2042 =1.
Device identification
Identification for individual devices facilitates diagnostics and provides an overview of the nodes
on the PROFIBUS.
The information for each device is stored in the following CU-specific parameter:
r0964[0...6] device identification

Bus terminating resistor and shielding

Reliable data transmission via PROFIBUS depends, amongst other things, on the setting of the
bus terminating resistors and the shielding of the PROFIBUS cables.
• Bus terminating resistor
The bus terminating resistors in the PROFIBUS plugs must be set as follows:
– First and last nodes in the line: Switch on terminating resistor
– Other nodes in the line: Switch off terminating resistor
• Shielding of the PROFIBUS cables
The cable shield must be connected in the plug through a large surface area at both ends. See
also Chapter "PROFIBUS connection (Page 427)".
10.4.3.3 Commissioning PROFIBUS
Preconditions and assumptions for commissioning

PROFIBUS device
• The PROFIBUS address to be set for the application is known.
• The telegram type for each drive object is known by the application.
PROFIBUS master
• The communication properties of the SINAMICS DCM device must be available in the master
(GSD file or Drive ES device OM).
Commissioning steps (example with SIMATIC S7)

1. Set the PROFIBUS address on the device.
2. Set the telegram type on the device.
3. Perform the following in the HW Config:
– Connect the drive unit to PROFIBUS and assign the address.
– Set the telegram type.
The same telegram type as on the device should be set for every drive object exchanging
process data via PROFIBUS.
The master can send more process data than the device uses. A telegram with a larger PZD
number than is assigned for the drive object STARTER can be configured on the master.
The PZDs not supplied by the drive object are filled with zeros.
The setting "without PZD" can be defined on a node or object (e.g. infeed controlled via
terminals).
4. Assign the I/O addresses according to the user program.
10.4.3.4 Diagnostics options
The standard device diagnostics can be read online in the HW Config.

10.4.3.5 SIMATIC HMI addressing
You can use a SIMATIC HMI as a PROFIBUS master (master class 2) to access SINAMICS directly.
With respect to SIMATIC HMI, SINAMICS behaves like a SIMATIC S7. For accessing drive
parameters, the following simple rule applies:
• Parameter number = data block number
• Parameter sub-index = bit 0 ... 9 of data block offset
• Drive object number = bit 10 ... 15 of data block offset
Pro Tool and WinCC flexible

The SIMATIC HMI can be configured flexibly with "Pro Tool" or "WinCC flexible".
The following specific settings for drives must be observed when configuration is carried out
with Pro Tool or WinCC flexible.
Controllers: Protocol always "SIMATIC S7 - 300/400"
Table 10-34 Additional parameters
Field Value
Network parameter profile DP
Network parameter baud rate Any
Communication partner address PROFIBUS address of the drive unit
Communication partner don’t care, 0
slot/rack
Table 10-35 Variables: "General" tab
Field Value
Name Any
Control system Any
Type Depending on the addressed parameter value, e.g.:
INT: for integer 16
DINT: for integer 32
WORD: for unsigned 16
REAL: for float
Area DB
DB Parameter number
(data block number) 1 ... 65535
DBB, DBW, DBD Drive object No. and sub-index
(data block offset) bit 15 ... 10: Drive object No. 0 ... 63
bit 9 ... 0: Sub-index 0 ... 1023
or expressed differently
DBW = 1024 * drive object No. + sub-index
Length Not activated
Acquisition cycle Any

Field Value
Number of elements 1
Decimal places Any
Note
• You can operate a SIMATIC HMI together with a drive unit independently of an existing
controller.
A basic "point-to-point" connection can only be established between two nodes (devices).
• The "variable" HMI functions can be used for drive units. Other functions cannot be used (e.g.
"messages" or "recipes").
• Individual parameter values can be accessed. Entire arrays, descriptions, or texts cannot be
accessed.

10.4.3.6 Monitoring telegram failure
When monitoring telegram failure, SINAMICS differentiates between two cases:

• Telegram failure with a bus fault
After a telegram failure, and the additional monitoring time has elapsed (p2047), bit r2043.0
is set to "1" and alarm A01920 is output. Binector output r2043.0 can be used for a quick stop,
for example.
Once the delay time p2044 has elapsed, fault F01910 is output. Fault F01910 triggers fault
response OFF3 (quick stop) on the DO DC_CTRL. If no OFF response is to be triggered, the
fault response can be reparameterized accordingly.
Fault F01910 can be acknowledged immediately. The drive can then be operated even
without PROFIdrive.
'XULQJEXVIDXOW
S
U
&\FOLFWHOHJUDPV
IURPWKHPDVWHU 7 $
S
W
6 4 7
)
5 4
Figure 10-18 Monitoring of telegram failure with a bus fault
• Telegram failure with a CPU stop

After telegram failure, bit r2043.0 is set to "1". Binector output r2043.0 can be used for a
quick stop, for example.
Once the delay time p2044 has elapsed, fault F01910 is output. Fault F01910 triggers fault
response OFF3 (quick stop) on the DO DC_CTRL. If no OFF response is to be triggered, the
fault response can be reparameterized accordingly.
Fault F01910 can be acknowledged immediately. The drive can then be operated even
without PROFIdrive.
'XULQJ&38VWRS
U
&\FOLFWHOHJUDPV
IURPWKHPDVWHU
S
W
6 4 7
)
5 4
Figure 10-19 Monitoring telegram failure for a CPU stop
Example: Quick stop at telegram failure
Settings:
• CU p2047 = 20 ms
• DC_CTRL p2044 = 0 s

Sequence:
1. Following a telegram failure, and once the additional monitoring time (p2047) has elapsed,
binector output r2043.0 of drive object CU switches to "1".
Alarm A01920 and fault F01910 are output at the same time for the DC_CTRL drive objects.
2. When F01910 is output, an OFF3 is triggered for the drive.
Note
The additional monitoring time p2047 is only useful for cyclic communication.
10.4.4 Direct data exchange
For PROFIBUS DP, the master interrogates all of the devices one after the other in a DP cycle. In
this case, the master transfers its output data (setpoints) to the particular device and receives as
response the input data (actual values). Fast, distributed data transfer between drives (devices)
is possible using the "direct data exchange" function without direct involvement from the
master.
The following terms are used for the function described in this chapter:
• Direct data communication
• Data Exchange Broadcast (DXB.req)
• Direct data exchange (is used in the following)
j
jGXG
OUUGzpth{pjGz^P wnVwj o~Gj
wGG kGlzGi

wG
vGXPG pGGXPG
y
k k k
zpuhtpjz zpuhtpjz zpuhtpjz
w z z
s
XPGmGGGGGjGXG
Figure 10-20 Direct data exchange with the publisher-subscriber model

Publisher
With the "direct data exchange" function, at least one device must act as the publisher.
The publisher is addressed by the master when the output data is transferred with a modified
layer 2 function code (DXB.req). The publisher then sends its input data for the master with a
broadcast telegram to all bus nodes.
Subscriber
The subscribers evaluate the broadcast telegrams, sent from the publishers, and use the data
which has been received as setpoints. These setpoints of the publisher are used, in addition to
the setpoints received from the master, corresponding to the configured telegram structure
(p0922).
Links and taps

The links configured in the subscriber (connections to publisher) contain the following
information:
• From which publisher is the input data received?
• What is the content of the input data?
• Where are the additional setpoints received?
Several taps are possible within a link. Several input data or input data areas, which are not
associated with one another, can be used as setpoint via a tap.
Links are possible on the drive unit itself. This internal link corresponds, as far as the timing is
concerned, to a link via PROFIBUS.
Requirements
The following requirements should be observed for the "direct data exchange" function:
• STARTER as of Version 4.2
• Configuration:
– Drive ES Basic, Drive ES SIMATIC or Drive ES PCS7 as of Version 5.3 SP3
– Alternatively using a GSD file
• Firmware as of Version 1.2
• The maximum number of process data per drive can be identified from the value in r2050 –
minus the resources that have already been used
• A maximum of 16 links to publishers

Applications
For example, the following applications can be implemented using the "direct data exchange"
function:
• Axis couplings
• Specifying binector connections from another device
10.4.4.1 Setpoint assignment in the subscriber
Information about setpoints

• Number of setpoint
When bus communication is being established, the master signals the device the number of
setpoints (process data) to be transferred using the configuring telegram (ChkCfg).
• Contents of the setpoints
The structure and contents of the data are determined using the local process data
configuration for the "SINAMICS device".
• Operation as "standard" device
The drive unit (device) only receives its setpoints as output data from the master.
• Operation as subscriber
When a device is operated as a subscriber, some of the setpoints are defined by one or more
publishers rather than by the master.
The device is informed of the assignment via the parameterization and configuration
telegram when bus communication is being established.
10.4.4.2 Activating/parameterizing direct data exchange
The "direct data exchange" function must be activated in the publishers as well as in the
subscribers, whereby only the subscriber is to be configured. The publisher is automatically
activated during bus startup.
Activation in the publisher

The master is informed abut which devices are to be addressed as publishers with a modified
layer 2 function code (DXB req) via the configuration of the subscriber links.
The publisher then sends its input data not only to the master but also as a broadcast
telegram to all bus nodes.
These settings are made automatically using the bus configuration tool (e.g. HW Config).
Activation in the subscriber

The device, which is to be used as subscriber, requires a filter table. The device must know which
setpoints are received from the master and which are received from a publisher.
The filter table is created automatically via the bus configuration tool (e.g. HW Config).

The following diagram shows the information contained in the filter table.
Parameterizing telegram (SetPrm)

The filter table is transferred, as a dedicated block from the master to the device with the
parameterizing telegram when a bus communication is established.
%ORFNKHDGHU %ORFN/HQ ದ
&RPPDQG [(
6ORW [
6SHFLILHU [
)LOWHUWDEOH 9HUVLRQLGHQWLILHU [(
KHDGHU
1XPEHURIOLQNV ದ
2IIVHW/LQN

2IIVHW/LQNQ
/LQN 3XEOLVKHU'3DGGUHVV
3XEOLVKHULQSXWOHQJWK
7DS 2IIVHWLQWKHSXEOLVKHUGDWD
7DUJHWRIIVHWLQWKHVXEVFULEHU
/HQJWKRIWKHWDSSLQJ
7DS
/LQN 3XEOLVKHU'3DGGUHVV

6SHFLILHGLQE\WHV
&DOFXODWHGDVRIYHUVLRQLGHQWLILHU
Figure 10-21 Filter block in the parameterizing telegram (SetPrm)
Configuration telegram (ChkCfg)

Using the configuration telegram, a device knows how many setpoints are to be received from
the master and how many actual values are to be sent to the master.
For direct data exchange, a special space ID is required for each tap. The PROFIBUS
configuration tool (e.g. HW Config) generates this ID. The ID is then transferred with the
ChkCfg into the drive devices that operate as subscribers.
10.4.4.3 Commissioning of the PROFIBUS direct data exchange

The commissioning of direct data exchange between two SINAMICS drives using the additional
Drive ES Basic package is described below.

Settings in HW Config
The project below is used to describe the settings in HW Config.
Figure 10-22 Example project of a PROFIBUS network in HW Config

Procedure
1. Select a device (e.g. SINAMICS DCM) and use its properties to configure the telegram for the
connected drive object.
2. In the "Configuration" tab of the drive unit, select e.g. the standard telegram 1 for the
associated drive in the telegram selection.
Figure 10-23 Telegram selection for drive object

3. Then go to the detail view.

Slots 4/5 contain the actual value / setpoint for the drive object.
Slots 7/8 are the telegram portions for the actual value / setpoint of the CU.
Figure 10-24 Detail view of slave configuration

4. The "Insert slot" button can be used to create a new setpoint slot for the SINAMICS DCM drive
object.
Figure 10-25 Insert new slot
5. Assign the setpoint slot the type "direct data exchange".

6. Select the publisher DP address in the "PROFIBUS address" column.
All PROFIBUS DP slaves from which actual value data can be requested are listed here. It also
provides the possibility of sharing data via direct data exchange within the same drive group.

7. The "I/O address" column displays the start address for each DO.
Select the start address of the DO data to be read. This is 200 in the example.
If the complete data of the publisher is not read, set this via the "Length" column. You may
also offset the start address for the request so that data can be read out in the middle of the
DO telegram.
Figure 10-26 Configuring the direct data exchange nodes

8. The "Direct data exchange - Overview" tab shows you the configured direct data exchange
relationships which correspond to the current status of the configuration in HW Config.
Figure 10-27 Direct data exchange - overview
9. When the direct data exchange link has been created, the standard telegram for the drive
object is replaced with the "User-defined" telegram in the configuration overview.
Figure 10-28 Telegram assignment for direct data exchange

10.The details after the creation of the direct data exchange link for the drive object of the
SINAMICS DCM are as follows:
Figure 10-29 Details after the creation of the direct data exchange link
11.You must adjust the standard telegrams accordingly for every DO (drive object) of the
selected CU that shall actively participate in direct data exchange.

Commissioning in STARTER
Direct data exchange is configured in HWConfig and is simply an extension of an existing
telegram. Telegrams can be extended in STARTER (e.g. p0922 = 999).
Figure 10-30 Configuring the direct data exchange links in STARTER
In order to terminate the configuration of direct data exchange for the DOs, the telegram
data of the DOs in STARTER must be matched to those in the HW Config and must be
extended. The configuration is made centrally via the configuration of the respective CU.

Procedure
1. In the overview for the PROFIBUS telegram, you can access the telegram components of the
drive objects, here DC_CTRL. Select the telegram type "Free telegram configuration" for the
configuration.
2. Enter the telegram lengths for the input data and output data according to the settings in HW
Config. For direct data exchange links, the input data consists of the telegram component of
the master and the direct data exchange data.
3. Then set the telegram component in the telegram selection to the standard telegram for
drive objects (in the example: Standard telegram 1), which results in a split display of the
telegram types (standard telegram + telegram extension). The telegram extension
represents the telegram portion of direct data exchange.
Figure 10-31 Display of the telegram extension
By selecting the item "Communication → PROFIBUS" for the drive object "DC_CTRL" in the
project navigator, you obtain the structure of the PROFIBUS telegram in the receive and send
directions.
The telegram extension from PZD3 onwards is the component for direct data exchange.

Figure 10-32 Configuring the PROFIBUS direct data exchange in STARTER
To connect the drive objects to the process data which is received via direct data exchange,
you also need to connect the appropriate connectors to the corresponding signal sinks. A list
for the connector shows all signals that are available for interconnection.

Figure 10-33 Linking the PZDs for direct data exchange with external signals
10.4.4.4 GSD in operation
Generic station description file

In special generic station description files (GSD), the properties of a PROFIBUS device are
uniquely and fully described to use PROFIBUS direct data exchange for SINAMICS.

The GSD files can be found:

• On the Internet. For the link, see “Preface (Page 3)”
• On the memory card in the directory \\SIEMENS\SINAMICS\DATA\CFG\
– Universal module
– Axis separator
The SINAMICS S DXB GSD file contains among other things standard telegrams, free
telegrams and device-to-device telegrams for configuring direct data exchange. The user
must take these telegram parts and an axis separator after each drive object to compose a
telegram for the drive unit.
Processing a GSD file in HW Config is includen in the SIMATIC documentation. Suppliers of
PROFIBUS components can provide their own bus configuration tool. The description of the
respective bus configuration tool is described in the relevant documentation.
Device identification
Identification for individual devices facilitates diagnostics and provides an overview of the nodes
on the PROFIBUS.
The information for each device is stored in the Control Unit parameter r0964[0...6] device
identification.
10.4.4.5 Diagnostics of the PROFIBUS direct data exchange in STARTER
Since the PROFIBUS direct data exchange is implemented on the basis of a broadcast telegram,
only the subscriber can detect connection or data faults, e.g. via the publisher data length (see
"Configuration telegram").
The publisher can only detect and report an interruption of the cyclic connection to the
DP master (A01920, F01910). The broadcast telegram to the subscriber will not provide

any feedback. A fault of a subscriber must be fed back via direct data exchange. In case
of a "master drive" 1:n, however, the limited quantity framework (see "Links and requests")
should be observed. It is not possible to have n subscribers report their status via direct data
exchange directly to the "master drive" (publisher)!
Diagnostics can be performed using the diagnostic parameters r2075 (Receive PROFIBUS
diagnostics telegram offset PZD) and r2076 (Send PROFIBUS diagnostics telegram offset
PZD). The parameter r2074 (PROFIBUS diagnostics, receive bus address PZD) displays the DP
address of the setpoint source of the respective PZD.
r2074 and r2075 enable the source of a direct data exchange relationship to be verified in
the subscriber.
Note
The subscribers do not monitor the existence of an isochronous publisher sign of life.
Faults and alarms with PROFIBUS direct data exchange

Alarm A01945 signals that the connection to at least one publisher of the drive device is missing
or has failed. Any interruption to the publisher is also reported by fault F01946 at the affected
drive object. A failure of the publisher only impacts the respective drive objects.
More detailed information on the messages can be found in the SINAMICS DCM List Manual.
10.4.5 Messages via diagnostics channels
Messages can be displayed not only via the well-known commissioning tools (STARTER, SCOUT).
After the activation of a diagnostic function, the messages are also transferred to the higher-
level controller via the standardized diagnostic channels. The messages are evaluated there or
forwarded for convenient display at the various user interfaces (SIMATIC HMI, TIA Portal, etc.).
The messages are shown on the respective user interfaces similarly as in STARTER.
In this way, problems or faults can be located immediately regardless of the tool currently
being used, and then corrected immediately. No further tools must therefore be called for
the correction.

Activating the diagnostics function

The diagnostics function is activated or deactivated via the parameterization of the relevant
configuration tool (HW Config, TIA Portal, etc.).
Figure 10-34 Activation of PROFIBUS
The following parameter assignments are possible:
Setting Code for parameter assignment

Inactive 0
PROFIdrive error classes 1
When establishing the communication between SINAMICS and a master/controller, the

activated diagnostics mode of this master/controller is first transferred to the drive. With
activated diagnostics, SINAMICS first transfers all pending messages to the master/controller.
Messages
The following PROFIBUS error texts can be displayed:
Line faulted
A line supply fault has occurred (phase failure, voltage level, etc.). Check the line supply and
fuses. Check the supply voltage. Check the wiring.
Power electronics faulted

An impermissible operating state of the power electronics was detected (overcurrent,

overtemperature, etc.). Check compliance with the permissible load cycles. Check the
ambient temperatures (fan).
Overtemp. electronic component
The temperature in the component has exceeded the highest permissible limit. Check the
ambient temperature / control cabinet ventilation.
Ground fault / inter-phase short-circuit detected
A ground fault / inter-phase short-circuit was detected in the power cables or in the motor
windings. Check the power cables (connection). Check the motor.
Motor overload
The motor was operated outside the permissible limits (temperature, current, torque…).
Check the load cycles and set limits. Check the ambient temperature / motor cooling.
Communication to the controller faulted
The communication to the higher-level controller (internal coupling, PROFIBUS, PROFINET,
etc.) is faulted or interrupted. Check the state of the higher-level controller. Check the
communication connection/wiring. Check the bus configuration/cycles.
Actual position/speed value error
An illegal signal state was detected while evaluating the encoder signals (track signals, zero
marks, absolute values, etc.). Check the encoder / state of the encoder signals. Observe the
maximum permissible frequencies.
Internal communication faulted
The internal communication between the SINAMICS components is faulted or interrupted.
Check the DRIVE-CLiQ wiring. Ensure an EMC-compliant installation. Observe the maximum
permissible quantity structures / cycles.
External signal state error
A measured value / signal state read-in via the input area (digital/analog/temperature) has
assumed an impermissible value/state. Identify and check the relevant signal. Check the set
thresholds.
Application / function faulted
The application / technological function has exceeded a (set) limit (position, velocity, torque,
etc.). Identify and check the relevant limit. Check the setpoint specification of the higher-level
controller.
Error in the parameterization / commissioning
An error was identified in the parameterization or in a commissioning procedure, or the
parameterization does not match the actual device configuration. Determine the exact cause
of the error with the commissioning tool, adapt the parameterization or device configuration.

10.5 Communication via PROFINET IO
10.5.1 Activating online mode: STARTER via PROFINET IO
Description
The following options are available for online operation via PROFINET IO:
• Online operation via IP
Requirements
• STARTER with Version ≥ 4.1.5 (SINAMICS DCM is supported starting only from STARTER
Version 4.1.5)
• CBE20
STARTER via PROFINET IO (example)
352),1(7
LQWHUIDFH
&8'
67$57(5 3*3&
(WKHUQHW 352),1(7 'HYLFH
DGDSWHU
,3
Figure 10-35 STARTER via PROFINET (example)
Procedure for activating online mode with PROFINET

1. Assign the PG/PC a fixed, free IP address. In our example, we have selected 169.254.11.1. Set
the subnet mask to 255.255.0.0.
2. Make the settings in STARTER
3. Select online operation in STARTER.
Setting the IP address in Microsoft Windows 7
Note
The following procedure is based on the Microsoft Windows 7 operating system. Under other
operating systems (such as Microsoft Windows XP), operation may differ slightly.

1. In the PG/PC call the control panel using the "Start > Control Panel" menu item.
2. In the control panel of your PG/PC, under "Network and Internet", select the "Network and
Sharing Center" function.
3. For your network card that is displayed, click the connection link.
4. Click in the status dialog of the connection on "Properties" and acknowledge the subsequent
confirmation prompt with "Yes".
5. In the properties dialog of the connection, select the "Internet protocol 4 (TCP/IPv4)" element
and then click "Properties".
6. In the properties dialog, activate the "Use the following IP address" option.
7. Set the IP address of the PG/PC access interface to the Control Unit to 169.254.11.1 and the
subnet mask to 255.255.0.0.
Figure 10-36 Example: IPv4 address of the PG/PC
8. Click "OK" and close the Microsoft Windows-specific window of the network connections.

Setting the interface in STARTER

In STARTER, you set communication via PROFINET as follows:
1. Call the menu "Tools > Set PG/PC interface ...".
2. Select the "Access point of the application", and therefore the interface parameter
assignment (in the example we use the access point "S7ONLINE (STEP 7)" and the interface
parameterization "TCP/IP(Auto)->Belkin F5D 5055").
Figure 10-37 Setting the PG/PC interface
If the desired interface does not yet exist in the selection list, you can create it.

3. Click the "Select" button.
Figure 10-38 Installing the interface
4. In the selection list on the left-hand side, select the module that you want to use as the
interface.
5. Click the "Install" button.
The selected module is then listed in the "Installed" list.
6. Click the "Close" button.

You can then check the IP address of the integrated Ethernet interface as follows:
1. Select the drive unit and call the shortcut menu "Target device > Online access ...".
2. Click the "Module addresses" tab.
The IP address that you set must be located under "Connect to target station".
Figure 10-39 Setting online access
Assigning the IP address and name for the PROFINET interface of the drive unit
With STARTER, you can assign an IP address and a name to the PROFINET interface (e.g. CBE20)
of the drive unit. The following steps are required:
1. Connect the programming device via a Crosslink-Ethernet cable with the CBE20, inserted in
the CUD.
2. Switch on the Control Unit.
3. Open STARTER.

4. Call the menu "Project > Accessible nodes" or click the "Accessible nodes" icon.
– The search is performed for available nodes connected to PROFINET.
– The Control Unit is identified and displayed under "Accessible nodes" as the bus node with
the IP address 0.0.0.0, without any type information.
Figure 10-40 Bus nodes found
5. Right-click the bus node entry to open the shortcut menu "Edit Ethernet node ...".
– In the selection window that opens "Edit Ethernet node" you will also see the MAC address.
6. Under "Set IP configuration", enter the IP address that you selected (e.g. 169.254.11.33) and
the subnet mask (e.g. 255.255.0.0).
7. Click the "Set IP configuration" button.
– The data transfer is confirmed.
8. Click the "Update" button.
– The bus node is identified as a drive unit.
– The address and the type are specified.
In the "Edit Ethernet node" selection window you can also assign a device name to the drive
unit that has been detected.
9. In the "Device name" field, enter the name that you have selected.
Note
ST (Structured Text) conventions must be satisfied for the name assignment of IO devices in
PROFINET (SINAMICS components). The names must be unique within PROFINET. Rules for
assigning names:
• Other than "-" and ".", no special characters (such as accented characters, spaces,
brackets) are permitted in the name of an IO device.
• The device name must not begin or end with the "-" character.
• The device name must not begin with a number.
• Maximum total length of 240 characters (lowercase characters, numbers, hyphen, or
period)
• A name component within the device name, e.g. a string between two periods, must not
exceed 63 characters.
• The device name must not take the form n.n.n.n (n = 0...999).
• The device name must not begin with the character sequence "port-xyz" or "port-xyz-
abcde" (a, b, c, d, e, x, y, z = 0...9).
In the "Device name" field, enter the name that you have selected.

10.Click the "Assign name" button.

– The data transfer is confirmed.
11.Click the "Update" button.
– The bus node is detected as drive unit and is consecutively numbered.
– The address, device name and the type are specified.
12.Close the "Edit Ethernet node" window.
13.Activate the option button in front of the detected drive unit and click the "Accept" button.
The SINAMICS drive with CBE20 is transferred as a drive object into the project tree. You can
now continue to configure the drive object.
14.Click the "Connect to target system" button and then call the menu "Target system > Load >
To target device", to load the project to the Control Unit memory card.
The IP address and device name are stored non-volatile on the memory card of the Control
Unit.
10.5.2 General information about PROFINET IO
General information
PROFINET IO is an open Industrial Ethernet standard for a wide range of production and process
automation applications. PROFINET IO is based on Industrial Ethernet and observes TCP/IP and
IT standards.
Deterministic signal processing in real time is important in industrial networks. PROFINET IO
satisfies these requirements.
International standard IEC 61158 ensures open, multi-vendor systems.
PROFINET IO is optimized for high-speed, time-critical data communication at field level.
PROFINET IO
Within the context of Totally Integrated Automation (TIA), PROFINET IO is the systematic
development of the following systems:
• PROFIBUS DP, the established fieldbus
• Industrial Ethernet, the communications bus for the cell level.
Experience gained from both systems was integrated into PROFINET IO. An Ethernet-based
automation standard defined by PROFIBUS International (PROFIBUS user organization),
PROFINET IO is a manufacturer-independent communication and engineering model.
PROFINET IO defines every aspect of the data exchange between IO controllers (devices with
what is known as "controller functionality" and the IO devices (those with what is known as
"device functionality") as well as carrying out parameterization and diagnostics. A PROFINET
IO system is configured in virtually the same way as a PROFIBUS system.

A PROFINET IO system is assembled from the following devices:

• An IO controller controls automation tasks.
• An IO device is controlled and monitored by an IO controller. An IO device consists of several
modules and submodules.
• An IO supervisor is an engineering tool, typically based on a PC, with which the individual IO
devices (drive units) are parameterized and diagnosed.
IO devices: Drive units with PROFINET interface

• SINAMICS DCM with inserted CBE20
Cyclic communication using PROFINET IO with IRT or using RT is possible on all drive units
equipped with a PROFINET interface. This means that error-free communication using other
standard protocols is guaranteed within the same network.
Note
PROFINET for drive technology is standardized and described in the following document:
• PROFIBUS profile PROFIdrive – Profile Drive Technology
Version V4.1, May 2006
http://www.profibus.com, Order Number 3.172, spec. Chapter 6
• IEC 61800-7
Note
For a CUD with inserted CBE20, the cyclic PZD channel is deactivated for PROFIBUS DP. By setting
parameter p8839 = 1, the PZD channel can be reactivated, see Chapter “Parallel operation of
communication interfaces (Page 410)”.
10.5.2.1 Real-time (RT) and isochronous real-time (IRT) communication
Real-time communication
When communication takes place via TCP/IP, the resultant transmission times may be too long
and non-deterministic to meet production automation requirements. When communicating
time-critical IO user data, PROFINET IO therefore uses its own real-time channel, rather than
TCP/IP.
Real time means that a system processes external events over a defined period.
Determinism
Determinism means that a system will react in a predictable ("deterministic") manner.
With PROFINET IO with IRT, it is possible to precisely determine (predict) transmission times.

PROFINET IO with RT (Real Time)

Real-time data is treated with a higher priority than TCP(UDP)/IP data. Transmission of time-
critical data takes place at guaranteed time intervals. RT communication is the basis for data
exchange with PROFINET IO.
PROFINET IO with IRT (Isochronous Real Time)

Isochronous real time: Real time property of PROFINET IO where IRT telegrams are transmitted
deterministically via planned communication paths in a defined sequence to achieve the best
possible synchronism and performance between the IO controller and IO device (drive unit). IRT
is also known as time-scheduled communication whereby knowledge about the network
structure (topology) is utilized. IRT requires special network components that support planned
data transfer.
Minimum cycle times of 500 μs and a jitter accuracy of less than 1 μs can be achieved with
this transmission method.
(JPVF\FOH
5HVHUYHGDUHD 0LQLPXPZLGWK
&\FOLF SODQQHG 6SRQWDQHRXVFRPPXQLFDWLRQ

FRPPXQLFDWLRQ
0RQLWRUHGOLPLW 0RQLWRUHGOLPLW
Figure 10-41 Bandwidth distribution/reservation, PROFINET IO
10.5.2.2 Addresses
MAC address
Every Ethernet and PROFINET interface is assigned a worldwide unique device identifier in the
factory. This 6-byte long device identifier is the MAC address. The MAC address is divided up as
follows:
• Three bytes for the manufacturer's ID
• Three bytes for the device identifier (consecutive number)
The MAC address is on a label (CBE20), e.g. 08-00-06-6B-80-C0
IP address
The TCP/IP protocol is a prerequisite for establishing a connection and parameterization. To allow
a PROFINET device to be addressed as a node on Industrial Ethernet, this device requires a unique
IP address in the network. The IP address is made up of 4 decimal numbers with a range of values
from 0 through 255. The decimal numbers are separated by a decimal point. The IP address
comprises:
• The address of the node (also called host or network node)
• The address of the (sub) network

IP address assignment
The IP addresses of IO devices can be assigned by the IO controller and always have the same
subnet screen as the IO controller. In this case, the IP address is not stored permanently. The IP
address entry is lost after POWER ON/OFF. The IP address can be assigned retentively via the
STARTER function "Accessible nodes".
This function can also be performed with HW Config of STEP 7. The function is called "Edit
Ethernet node" here.
Note
If the network is part of an existing Ethernet company network, obtain the information (IP
address) from your network administrator.
Device name (NameOfStation)

When it is shipped, an IO device does not have a device name. An IO device can only be addressed
by an IO controller, for example, for the transfer of project engineering data (including the IP
address) during startup or for user data exchange in cyclic operation, after it has been assigned
a device name with the IO supervisor.
Note
The device name must be stored retentively either with STARTER or with HW Config of STEP 7.
Note
You can enter the address data for the ports of the optional CBE20 module in STARTER in the
expert list using parameters p8940, p8941, p8942 and p8943.
Replacing the Control Unit (CUD) (IO device)

If the IP address and device name are stored in non-volatile memory, this data is also forwarded
with the memory card of the Control Unit.
If a complete Control Unit needs to be replaced due to a device or module defect, the new
Control Unit automatically parameterizes and configures using the data on the memory card.
Following this, cyclic exchange of user data is restarted. The memory card allows module
exchange without an IO supervisor when a fault occurs in a PROFINET device.

10.5.2.3 Data transfer
Properties
The PROFINET interface on a drive unit supports the simultaneous operation of:
• IRT – isochronous real-time Ethernet
• RT – real-time Ethernet
• Standard Ethernet services (TCP/IP, LLDP, UDP and DCP)
PROFIdrive telegram for cyclic data transmission, acyclic services

Telegrams to send and receive process data are available for each drive object of a drive unit with
cyclic process data exchange.
In addition to cyclic data transfer, acyclic services can also be used for parameterizing and
configuring the drive unit. These acyclic services can be utilized by the IO supervisor or IO
controller.
Sequence of drive objects in the telegram

On the drive side, the sequence of drive objects in the telegram is displayed via a list in
p0978[0...24] where it can also be changed.
You can use the STARTER commissioning tool to display the sequence of drive objects for
a commissioned drive system in online mode in the project navigator under "Drive unit" >
"Communication" > "Telegram configuration".
When you create the configuration on the controller side (e.g. HW Config), the process-data-
capable drive objects for the application are added to the telegram in this sequence.
The following drive objects can exchange process data:
• DC drive control (DC_CTRL)
Note
The sequence of drive objects in HW Config must be the same as that in the drive (p0978).
The structure of the telegram depends on the drive objects taken into account during
configuration. Configurations are permitted that do not take into account all of the drive
objects that are present in the drive system.
Example:

The following configurations, for example, are possible:

• Configuration with CU_DC, DC_CTRL
• Configuration with DC_CTRL, TM31, TM31
• etc.
10.5.2.4 Communication channels for PROFINET
Control Unit with CBE20 Communication Board Ethernet

A Communication Board can be optionally inserted in the Control Unit CUD:
• The CBE20 Communication Board is a PROFINET switch with four PROFINET ports.
Overview of important parameters

(see the SINAMICS DCM List Manual)
• p8829 CBE20 remote controller number

• p8940[0...239] CBE20 name of station
• p8941[0...3] CBE20 IP address of station
• p8942[0...3] CBE20 default gateway of station
• p8943[0...3] CBE20 subnet mask of station
• p8944 CBE20 DHCP mode
• p8945 CBE20 interface configuration
• r8950[0...239] CBE20 name of active station
• r8951[0...3] CBE20 IP address of active station
• r8952[0...3] CBE20 default gateway of active station
• r8953[0...3] CBE20 subnet mask of active station
• r8954 CBE20 DHCP mode active
• r8955[0...5] CBE20 MAC address of station
• r8959 CBE20 DAP ID

10.5.3 Drive control with PROFINET
PROFINET interfaces
The CBE20 Communication Board Ethernet can be inserted in the option slot of a CUD. The
Communication Board Ethernet CBE20 is a PROFINET switch with 4 ports.
Note
Ring topology
When connecting the ports, it must be ensured that for standard applications a ring topology is
not created. Additional information on ring topologies can be found in Chapter “Media
redundancy (Page 472)”.
References
• The integration of a SINAMICS Control Unit in a PROFINET IO system is described in detail in
System Manual "SIMOTION SCOUT Communication” "Communication with SIMOTION
(https://support.industry.siemens.com/cs/de/en/view/109749943)".
• For an example of how to link a Control Unit to a SIMATIC S7 via PROFINET IO, please refer to
the FAQ "PROFINET IO communication between an S7-CPU and SINAMICS S120" on the
Internet.
• For a description of the CBE20 Communication Board Ethernet and how you can use this in
the drive, see Chapter "Additional system components (Page 169)".
Telegrams
PROFIdrive telegrams are available for implementing cyclic communication via PROFINET IO (see
Chapter "Communication according to PROFIdrive", cyclic communication).
DCP flashing
This function checks the correct assignment to a module and its interfaces.
1. In HW Config or the STEP 7 Manager, select the menu item "Target system" > Ethernet > Edit
Ethernet node".
The "Edit Ethernet Node" dialog box opens.
2. Click the "Browse" button.
The "Browse Network" dialog box opens and displays the connected nodes.
3. Select the CUD with inserted CBE20 as node.
The "DCP flashing" function is then activated via the "Flash" button.
The "DCP flashing" function is activated on the RDY LED (READY LED 2 Hz, green/orange or
red/orange) on the CUD.
The LED will continue to flash as long as the dialog is open. When the dialog is closed, the
LED will go out automatically. The function is available as of STEP 7 V5.3 SP1 via Ethernet.

STEP 7 routing with CBE20 Communication Board Ethernet

The CBE20 does not support STEP 7 routing between PROFIBUS and PROFINET IO.
Connecting the PC to the STARTER commissioning tool

You can go online with STARTER in a number of ways, which are illustrated below:
7RSRORJ\
,2VXSHUYLVRUYLD352),1(7
,2VXSHUYLVRU 'HYLFH &RQWUROOHU

HJ3& HJ&8' HJ6&38
(7 &%( 3% 3% 31
7RSRORJ\
,2VXSHUYLVRURQ352),%86RIFRQWUROOHU
,2VXSHUYLVRU 'HYLFH &RQWUROOHU

HJ3& HJ&8' HJ6&38
3% &%( 3% 3% 31
7RSRORJ\
,2VXSHUYLVRURQ352),%86RIGHYLFH
,2VXSHUYLVRU 'HYLFH
HJ3& HJ&8'
3% &%( 3%
Figure 10-42 Connecting the IO supervisor
Note
SINAMICS does not support routing from PROFIBUS to PROFINET and vice versa.
Note
If a CBE20 Communication Board Ethernet fails (e.g. due to a power failure), then
communication with the subsequent nodes is interrupted at this point.

10.5.3.1 Media redundancy
To increase the availability of PROFINET, you can create a ring topology for redundancy purposes.
If the ring is interrupted at one point, the data paths between the devices are automatically
reconfigured. Following reconfiguration, the devices can once again be accessed in the resulting
new topology.
To create a ring topology with media redundancy, route the two ends of a line-type PROFINET
topology to a switch which serves as redundancy manager (e.g. a suitable SCALANCE
switch). Closing the linear bus topology is realized using two ports (ring ports) of the
SCALANCE redundancy manager, which monitors the data telegrams in the PROFINET ring.
All other connected PROFINET nodes are redundancy clients.
The Media Redundancy Protocol (MRP) is the standard procedure for media redundancy.
Using this procedure, a maximum of 50 devices can participate in each ring. In the case of an
interrupted cable, data transfer is only briefly interrupted as the system switches over to the
redundant data path.
If a short-term interruption is not permitted, data transfer must be set to IRT High
Performance. The uninterruptible MRRT is automatically set.
From a CBE20, only the first two ports are capable of establishing a ring topology.
Note
In order to use the ring topology, the GSDML file version V2.3 must be installed.
This file can be found, for example, on the memory card as
"\SIEMENS\SINAMICS\DATA\CFG\PNGSD.ZIP".
Configuring media redundancy

The ring topology is configured by appropriately configuring the participating devices
individually in STEP 7.
10.5.4 RT classes for PROFINET IO
PROFINET IO is a scalable realtime communication system based on Ethernet technology. The

scalable approach is expressed with three realtime classes.
RT
RT communication is based on standard Ethernet. The data is transferred via prioritized
Ethernet telegrams. Because standard Ethernet does not support any synchronization
mechanisms, isochronous operation is not possible with PROFINET IO with RT!
The real update cycle in which cyclic data is exchanged depends on the bus load, the devices
used and the quantity framework of the I/O data. The update cycle is a multiple of the send
cycle.

IRT
Two options are available with this RT class:
• IRT "high flexibility"
• IRT "high performance"
SINAMICS DCM only supports option IRT "high-performance".
Software preconditions for configuring IRT:
• STEP 7 5.4 SP4 (HW Config)
Note
For further information about configuring the PROFINET interface for the I/O controller and I/O
device, please refer to the following document: SIMOTION SCOUT Communication System
Manual.
IRT "high flexibility"

The telegrams are sent cyclically in a deterministic cycle (Isochronous Real Time). The telegrams
are exchanged in a bandwidth reserved by the hardware. One IRT time interval and one standard
Ethernet time interval are created for each cycle.
Note
SINAMICS DCM does not support IRT "high flexibility".
IRT "high performance"

In addition to the bandwidth reservation, the telegram traffic can be further optimized by
configuring the topology. This enhances the performance during data exchange and the
deterministic behavior. The IRT time interval can thus be further optimized or minimized with
respect to IRT "high flexibility".
In addition to the isochronous data transfer provided by IRT, even the application itself
(position control cycle, IPO cycle) can be isochronous in the devices. This is an essential
requirement for closed-loop axis control and synchronization via the bus. Isochronous data
transfer with cycle times well below one millisecond and with a deviation in the cycle start
(jitter) of less than a microsecond provide sufficient performance reserves for demanding
motion control applications.
The RT classes IRT "high flexibility" and IRT "high performance" can be selected as options in
the synchronization settings configuration area of HW Config. In the description below, both
these classes are simply referred to as "IRT".
In contrast to standard Ethernet and PROFINET IO with RT, the telegrams for PROFINET IO
with IRT are transferred according to a schedule.

Modules
The following SINAMICS modules support the IRT "high performance":
• S120 CU320 together with the CBE20
• S120 CU320-2 DP together with the CBE20
• S120 CU320-2 PN
• S120 CU310 PN
• S120 CU310-2 PN
• S110 CU305 PN
• CUD in conjunction with CBE20
Note
SINAMICS DCM does not support isochronous operation.
Also for cyclic communication via PROFINET IRT the drive closed-loop control is independent of
the PROFINET clock cycle.
Comparison between RT and IRT
Table 10-36 Comparison between RT and IRT
RT class RT IRT "high flexibility" IRT "high performance"

Transmission mode Switching based on the MAC Switching using the MAC ad‐ Path-based switching accord‐
address; prioritization of the dress; ing to a topology-based plan;
RT telegrams possible using bandwidth reservation by re‐ no transmission of TCP/IP
Ethernet-Prio (VLAN tag) serving an IRT "high flexibili‐ frames and IRT "high flexibili‐
ty" interval in which only IRT ty" frames in the IRT "high per‐
"high flexibility" frames are formance" interval.
transferred but, for example,
no TCP/IP frames.
Isochronous application in the No No Yes
IO controller
Determinism Variance of the transmission Guaranteed transmission of Exactly planned transfer;
duration by started TCP/IP the IRT "high flexibility" tele‐ times for transmission and re‐
telegrams grams in the current cycle by ceiving are guaranteed for
the reserved bandwidth. any topologies.
Reload the network configura‐ Not relevant Only when the size of the IRT Always when the topology or
tion after a change "high flexibility" interval the communications relation‐
needs to be modified (reser‐ ships change.
vation of position is possible).
Maximum switching depth 10 at 1 ms 61 64
(number of switches in one
line)
For possible send cycles, see subitem "Send cycles and update cycles for RT classes" in table "Adjustable send cycles and update
cycles"

Set the RT class

The RT class is set by means of the IO controller interface properties. If RT class IRT "high
performance" is set, it is not possible to operate any IRT "high flexibility" devices on the IO
controller and vice versa. IO devices with RT can always be operated, regardless of the IRT class
setting.
You can set the RT class in the HW Config for the associated PROFINET device.
1. In HW Config, double-click item PROFINET interface in the module.
The "Properties" dialog box opens.
2. Select the RT class under RT class on the "Synchronization" tab.
3. Once you have selected "IRT", you can also choose between option "high flexibility" and "high
performance".
Note
It is not permissible that the "high flexibility" option is selected for SINAMICS DCM, otherwise
an error message is output.
4. Confirm with "OK".
Synchronization domain
The sum of all devices to be synchronized form a synchronization domain. The whole domain
must be set to a single, specific RT class (real-time class) for synchronization. Different
synchronization domains can communicate with one another via RT.
For IRT, all IO devices and IO controllers must be synchronized with a common
synchronization master.
RT allows an IO controller to communicate with a drive unit outside a synchronization
domain or "through" another synchronization domain.
From version of 5.4 SP1, STEP 7 supports several synchronization domains in an Ethernet
subnet.
Example:
• Synchronization domain IRT: SIMOTION2 with SINAMICS
• SINAMICS, which is assigned to the IO system of SIMOTION1, is arranged in the topology in
such a way that its RT communication must be established through the IRT synchronization
domain.
6\QF'RPDLQ 6\QF'RPDLQ
,57 ,57
6,1$0,&6 6,1$0,&6 6,1$0,&6
6,027,21
6,027,21
&RPPXQLFDWLRQRXWVLGHV\QFKURQL]DWLRQGRPDLQV
Figure 10-43 RT communication across the limits of synchronization domains

Update cycles and send cycles for RT classes
Definition of the update time / send cycle

If we take a single IO device in the PROFINET IO system as an example, this device has been
supplied with new data (outputs) by the IO controller and has transferred new data (inputs)
to the IO controller within the update time. The send cycle is the shortest possible update
cycle.
All cyclic data is transferred within the send cycle. The actual send cycle that can be set
depends on various factors:
• Bus load
• Type of devices used
• Computing capacity available in the IO controller
• Supported send clocks in the participating PROFINET devices of a synchronization domain. A
typical send cycle is, e.g. 1 ms.
The table below specifies the reduction ratios which can be set between the send cycle and
the update times for IRT "high performance", IRT "high flexibility", and RT.
Table 10-37 Settable send cycles and update cycles
Send cycle Reduction ratio between update and send cycles

RT IRT "high performance"
IRT "high flexibility" 4)
Range 250, 500, 1000 µs 1, 2, 4, 8, 16, 32, 64, 128, 256, 512 1, 2, 4, 8, 162)
"even"1) 2000 µs 1, 2, 4, 8, 16, 32, 64, 128, 256 1, 2, 4, 8, 162)
4000 µs 1, 2, 4, 8, 16, 32, 64, 128 1, 2, 4, 8, 162)
Range 375, 625, 750, 875, 1125, Not supported 5)
1
"odd" 3) 1250 µs ... 3875 µs
(increment 125 µs)
Explanations for the previous table:

1)
It is only possible to set send cycles from the "even" range when IO devices with RT class "RT" are assigned to a synchronization
domain. Likewise, only the reduction ratios from the "even" range can be set for a send cycle setting from the "even" range.
2)
It is generally only possible to set a reduction ratio of 1:1 between the update time and send cycle for IO devices (ET200S
IM151-3 PN HS, SINAMICS S) which are operated in isochronous mode. In this case, the update time mode must always be
set to "fixed factor" (under "I/O device" properties, "IO cycle" tab, "Mode" drop-down menu). This means that STEP 7 will not
automatically adjust the update cycle and thus the update cycle will always correspond to the send cycle.
3)
The send cycles from the "uneven" range can be set only if a synchronization domain does not include any IO devices with RT
class "RT". Likewise, only the reduction ratios from the "uneven" range can be set for a send cycle setting from the "uneven"
range.
4)
Isochronous operation is not compatible with IRT "high flexibility".
5)
Uneven send cycles can be used only if the IO systems assigned to the synchronization domain do not include any RT or IRT
"high flexibility" devices.
Furthermore, the send cycles which can actually be set are determined by the intersection of
the send cycles supported by all the devices in the synchronization domain.

The reduction ratio between the update cycle of an IO device and the send cycle is set in the
"Properties" of the PROFINET interface for the relevant device.
Note
There is no intersection between the send cycles for the "even" and "odd" ranges!
Send cycles for SINAMICS drive units

A SINAMICS drive unit with PROFINET interface which supports IRT permits send cycle
settings of between 0.25 ms and 4.0 ms in a 250 µs time frame.
Topology rules
Topology rules for RT

• A topology can be, but need not be configured for RT. If a topology has been configured, the
devices must be wired in accordance with the topology.
• Otherwise, the wiring between devices is entirely optional.
Topology rules for IRT

• Mixed operation is not supported by STEP 7 V5.4 SP4, i.e. IRT "high performance" cannot be
combined with IRT "high flexibility" in the same synchronization domain.
• A synchronization domain with IRT "high performance" can contain a maximum of one IRT
"high performance" island. "Island" means that the devices must be interconnected to match
the configured topology. A synchronization master must be positioned in the relevant island.
• IRT "high flexibility" is subject to the same topology rules as IRT "high performance", the only
exception being that a topology does not need to be configured. However, if a topology has
been configured, the devices must be wired to match the topology.
Device selection in HW Config
Hardware catalog:
The drive unit from the appropriate device family entry in the hardware catalog must be
configured.
10.5.5 PROFINET GSDML
As with PROFIBUS, when DriveES is present, the device can be inserted using a DriveES/STARTER
interface or using a GSDML file.
The GSDML file is available as a zip archive on the memory card with the current firmware:
\\Siemens\SINAMICS\DATA\CFG\PNGSD.zip
See Chapter “Ordering information for options and accessories (Page 32)” for ordering data of
the memory card.

Alternatively, the GSDML file can be requested from the Customer Support.
Table 10-38 Submodules depending on the particular drive object
Module Subslot 1 Subslot 2 Subslot 3 Subslot 4 Max. num‐

MAP PROFIsafe PZD telegram PZD extension ber of PZD
DC_CTRL MAP - Telegrams: 1...352 PZD-2/2, -2/4, -2/6 64/64
free PZD-16/16, 32/32
TM31, MAP Reserved Telegrams: no Reserved 5/5
TM15DI_DO free PZD-4/4
TM150 MAP Reserved Telegrams: no Reserved 7/7
free PZD-4/4
Control Unit MAP Reserved Telegrams: 390 Reserved 20/25
free PZD-4/4
TM15/TM17 Not supported.
The telegrams in subslots 2, 3 and 4 can be freely configured, i.e. they can also remain empty.
10.5.6 Communication with CBE20
The CBE20 is a Communication Board that can be flexibly used and which can be operated with
different communication profiles. Only one firmware of a communication profile can be loaded
at any one time. The available firmware files are saved with the communication profiles in UFW
files.
The required file is selected using parameter p8835. A POWER ON must be carried out after
selecting the desired UFW file. During the subsequent system boot, the corresponding UFW
file is loaded. The new selection then becomes active.
Table 10-39 UFW files and selection in the pointer file
UFW file and folder on the memory card Functionality (p8835) Pointer file content
/SIEMENS/SINAMICS/CODE/CB/CBE20_1.UFW PROFINET device 1
/SIEMENS/SINAMICS/CODE/CB/CBE20_3.UFW SINAMICS Link 3
/SIEMENS/SINAMICS/CODE/CB/CBE20_4.UFW EtherNet/IP 4
/SIEMENS/SINAMICS/CODE/CB/CBE20_5.UFW Modbus TCP 5
/OEM/SINAMICS/CODE/CB/CBE20.UFW Customized 99
Note
All communication profiles are saved on the memory card. Some communication profiles (UFW
files) can also be saved to the flash memory in the device itself. In this case, the memory card
does not have to be inserted.
p8835=1 (PROFINET): The memory card does not have to be inserted.
p8835 = 3 (SINAMICS Link): The memory card must remain inserted.
p8835 = 4 (EtherNet/IP): The memory card does not have to be inserted.
p8835 = 5 (Modbus TCP): Memory card must remain inserted.

Identification of the firmware version

Using parameter r8858, the loaded firmware version of the PROFINET interface can be
identified uniquely.
• p8835 CBE20 firmware selection

• r8858[0...39] COMM BOARD read diagnostics channel
• r8859[0...7] COMM BOARD identification data
10.5.7 Messages via diagnostics channels
Messages can be displayed not only via the well-known commissioning tools (STARTER, SCOUT).
After the activation of a diagnostic function, the messages are also transferred to the higher-
level controller via the standardized diagnostic channels. The messages are evaluated there or
forwarded for convenient display at the various user interfaces (SIMATIC HMI, TIA Portal, etc.).
The messages are shown on the respective user interfaces similarly as in STARTER.
In this way, problems or faults can be located immediately regardless of the tool currently
being used, and then corrected immediately. No further tools must therefore be called for
the correction.

Activating the diagnostics function

The diagnostics function is activated or deactivated via the parameterization of the relevant
configuration tool (HW Config, TIA Portal, etc.).
Figure 10-44 Activation of PROFINET
The following parameter assignments are possible:
Setting Code for parameter assignment

Inactive 0
PROFIdrive error classes 1
When establishing the communication between SINAMICS and a master/controller, the

activated diagnostics mode of this master/controller is first transferred to the drive. With
activated diagnostics, SINAMICS first transfers all pending messages to the master/controller.
Messages
The following PROFIdrive error texts are displayed during forwarding via the PROFINET
diagnostics channel:
Hardware fault/software error

A hardware or software malfunction was detected. Carry out a POWER ON for the relevant
component. If it occurs again, contact the hotline.

Line fault
A line supply fault has occurred (phase failure, voltage level, etc.). Check the line supply and
fuses. Check the supply voltage. Check the wiring.
Supply voltage fault

An electronics supply voltage fault (48 V, 24 V, 5 V…) was detected. Check the wiring. Check
the voltage level.
Power electronics faulted

An impermissible operating state of the power electronics was detected (overcurrent,
overtemperature, etc.). Check compliance with the permissible load cycles. Check the
ambient temperatures (fan).
Electronic component overtemperature

The temperature in the component has exceeded the highest permissible limit. Check the
ambient temperature / control cabinet ventilation.
Ground fault / inter-phase short-circuit detected

A ground fault / inter-phase short-circuit was detected in the power cables or in the motor
windings. Check the power cables (connection). Check the motor.
Motor overload
The motor was operated outside the permissible limits (temperature, current, torque, ...).
Check the load cycles and set limits. Check the ambient temperature / motor cooling.
Communication error to the higher-level controller

The communication to the higher-level controller (internal coupling, PROFIBUS, PROFINET,
etc.) is faulted or interrupted. Check the state of the higher-level controller. Check the
communication connection/wiring. Check the bus configuration/cycles.
Actual position value / actual speed value incorrect or not available

An illegal signal state was detected while evaluating the encoder signals (track signals, zero
marks, absolute values, etc.). Check the encoder / state of the encoder signals. Observe the
maximum permissible frequencies.
Internal (DRIVE-CLiQ) communication error

The internal communication between the SINAMICS components is faulted or interrupted.
Check the DRIVE-CLiQ wiring. Ensure an EMC-compliant installation. Observe the maximum
permissible quantity structures / cycles.
External measured value / signal state outside the permissible range

A measured value / signal state read-in via the input area (digital/analog/temperature) has
assumed an impermissible value/state. Identify and check the relevant signal. Check the set
thresholds.
Application / technology function faulted

The application / technological function has exceeded a (set) limit (position, velocity, torque,
etc.). Identify and check the relevant limit. Check the setpoint specification of the higher-level
controller.

Error in the parameterizing/configuring/commissioning sequence

An error was identified in the parameterization or in a commissioning procedure, or the
parameterization does not match the actual device configuration. Determine the exact cause
of the error with the commissioning tool, adapt the parameterization or device configuration.
General drive fault

Group fault, determine the exact cause of the fault with the commissioning tool.
Auxiliary unit faulted

The monitoring of an auxiliary unit (incoming transformer, cooling unit, etc.) has detected an
illegal state. Determine the exact cause of the error and check the relevant device.
10.5.8 Support of I&M data sets 1...4
Identification & Maintenance (I&M)

I&M data sets contain information for a standardized and simplified identification and
maintenance of PROFIBUS/PROFINET devices. I&M data sets 1...4 contain plant-specific
information, such as the installation location and date. PROFINET supports I&M data sets 0...4.
I&M data sets 1...3 can be set with the SIMATIC Manager (STEP 7) and also with HW Config
(STEP 7).
I&M parameters
Table 10-40 Parameter designation, assignment and meaning
I&M parameter Format Size/ Initialization SINAMICS pa‐ Meaning

designation octets rameters
I&M 0: IM_SUPPOR‐ ‑ ‑ ‑ r8820[62,63] The parameter indicates which I&M data sets
TED are supported.
The value 0x1E indicates that I&M data sets
1...4 are available.
I&M 1: TAG_FUNC‐ Visible 32 Space 0x20… p8806[0...31] Text that identifies the function or task of the
TION string 0x20 device.
I&M 1: TAG_LOCA‐ Visible 22 Space 0x20… p8806[32...53] Text that identifies the device location.
TION string 0x20

I&M parameter Format Size/ Initialization SINAMICS pa‐ Meaning

designation octets rameters
I&M 2: INSTALLA‐ Visible 16 Space 0x20… p8807[0...15] Text with the date of the installation or the in‐
TION_DATE string 0x7E itial commissioning of the device. The follow‐
ing date formats are supported:
• YYYY-MM-DD
• YYYY-MM-DD hh:mm
– YYYY: Year
– MM: Month 01...12
– DD: Day 01...31
– hh: Hours 00...23
– mm: Minutes 00...59
The separators between the individual specifi‐
cations, i.e. hyphen '-', blank ' ' and colon ':',
must be entered.
I&M 3: DESCRIPTOR Visible 54 Space 0x20… p8808[0...53] Text with any comments or notes.
string 0x20
I&M 4: SIGNATURE Octet 54 Space 0x00… r8809[0...53] The parameter is automatically populated by
string 0x00 the system, in which case it contains a func‐
tional check signature for the change tracking
with Safety Integrated. The check signature
has the following format:
• The first four octets (0...3) contain the con‐
tent of parameter r9781 index 0: "SI
change monitoring checksum (Control
Unit)".
• The second four octets (4...7) contain the
content of parameter r9782 index 0: "SI
change monitoring time stamp (Control
Unit)".
• The remainder (octets 8...53) contains ze‐
roes.
The I&M data sets 1...3 are stored permanently in the parameters p8806...p8808. Essential
properties of these 3 parameters:
• They can be displayed in the STARTER expert list.
• The SINAMICS "Reset parameter" (p0976 = 1, p0970 = 1) function does not have any effect
on the content of parameters.
• I&M data sets are not changed when the alternative parameter sets are stored or loaded. The
transfer of parameter sets between a memory card and non-volatile device memory does not
have any effect on the I&M data sets.
• p8806[0...53] Identification and Maintenance 1


10.6 Communication via SINAMICS Link

• r8809[0...53] Identification and Maintenance 4
10.6.1 Basic principles of SINAMICS Link

A drive unit (with a node number) most frequently comprises a Control Unit with a number of
connected drive objects (DOs). SINAMICS Link allows data to be directly exchanged between up
to 64 CU320-2 PN or CU320-2 DP Control Units or CUD. All of the participating Control Units must
be equipped with a CBE20 in order that SINAMICS Link functions. Possible applications are, for
example:
• Torque distribution for n drives
• Setpoint cascading for n drives
• Load distribution of drives coupled through a material web
• Master/device function for infeed units
• Couplings between SINAMICS DCM and SINAMICS S120
Requirements
The following preconditions must be fulfilled to operate SINAMICS Link:
• One CBE20 must be inserted for each drive object.
• The following applies for the CUD:
- an Advanced CUD must be inserted.
- the memory card (the device firmware) must be inserted.
Note
Handling the memory card
Information on how to correctly handle the memory card is provided in Chapter "Memory card
functions (Page 329)".
It is especially important to note that it is not permissible to insert the card when the device is
operational.

Send and receive data

The SINAMICS Link telegram contains 32 indices (0...31) for the process data (PZD1...32). Each
PZD is precisely 1 word long (= 16 bits). Indices that are not required are automatically filled with
zeros. There is always a fixed assignment between the index and PZD: The index i corresponds
to PZD i+1.
Index 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15
PZD 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16
SINAMICS Link telegram content, Part 1
Index 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31
PZD 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32
SINAMICS Link telegram content, Part 2

Each transfer cycle, every SINAMICS Link node can send 1 telegram with 32 PZD. Each node
receives all of the telegrams that are sent. For each transfer cycle clock, a node can select
and process up to 32 PZD from all telegrams that have been received. Single words and
double words can be sent and received. You must write double words in two consecutive
PZDs.
Limitations:
• In a telegram, a PZD may only be sent and received once. If a PZD occurs more than once in
a telegram, then Alarm A50002 or A50003 is output.
• It is not possible to read in your own send data. An appropriate alarm is initiated. The
following alarms are possible:
– A50006: It is parameterized that own data sent can be received. This is not permitted.
– A50007: The send telegram word is larger than possible in the project.
– A50008: The receive telegram word is larger than possible in the project.
• The maximum number of PZDs that can be received and sent also depends on the drive
object. The number of PZDs that can be evaluated corresponds to communication according
to PROFIdrive; however, for SINAMICS Link, it is limited to a maximum of 32 PZDs.
• If, as a result of a project download, parameters of the CBE20 are change, then alarm A08531
is output. In this case, a POWER ON is required to activate the values.
Transmission time
A transmission time of up to 1.5 ms is possible when using SINAMICS Link.

Bus cycle and number of nodes

A maximum of 64 participants can communicate with one another via SINAMICS Link. To do so,
set the maximum number of nodes with p8811 (project selection):
Number of participants / Number of PZD Bus cycle (ms)

project no.
64 16 1 or 2
16 16 0.5
12 24 0.5
8 32 0.5
In the non-synchronized mode, the bus cycle of the SINAMICS Link can be set with p8812[1]
to 1000 µs or 2000 µs.
After changing parameter p8811, p8812, p8835 or p8836, carry out a POWER ON to transfer
the settings.
10.6.2 Topology
Only a line topology with the following structure is permitted for SINAMICS Link. You must
manually set the parameters in the expert lists of the Control Units and drive objects. To do this,
use the STARTER commissioning tool.
352),%86352),1(7
6,1$0,&6 6,1$0,&6 6,1$0,&6 6,1$0,&6

&%( &%( &%( &%(
S S S S
3 3 3 3 3 3 3 3
3 3 3 3 3 3 3 3
6,1$0,&6/LQN
Figure 10-45 Maximum topology

Features
• The CBE20 can be assigned to IF1 or IF2 when SINAMICS Link is used.
You must also make the following parameter settings in order to assign, e.g. IF1 to SINAMICS
Link:
– For IF1: p8839[0] = 2 (COMM BOARD)
– For IF2: p8839[1] = 1 (Control Unit onboard)
The data in the additional description are applicable for the case (IF1 ≙ SINAMICS Link).
• The number of the respective node must be entered manually in parameter p8836. Each
node must be assigned a different number. Enter the numbers in ascending order starting
with 1.
• If p8836 is set to 0, the nodes and the complete following line is shut down for SINAMICS Link.
• Gaps in the numbering are not permitted, as then SINAMICS Link would not function.
• The node with the number 1 is automatically the sync master of the communication link.
• The ports of the CBE20 must be interconnected strictly in accordance with the previous
diagram. You must always connect port 2 (P2) of node n with port 1 (P1) of node n + 1.
• In the "SINAMICS Link" mode, ports 3 and 4 of the CBE20 can only be used to connect to the
STARTER commissioning tool or Startdrive.
Corresponding parameters for IF1 or IF2

Use different parameters for configuring, depending on which interface SINAMICS Link is
assigned:
Table 10-41 Corresponding parameters
Parameter IF1 IF2

Setting of the processing mode for PROFIdrive STW1.10 "Control by PLC". p2037 p8837
Connector output to interconnect the PZD (setpoints) received from the r2050 r8850
fieldbus controller in the word format.
Selects the PZD (actual values) to be sent to the fieldbus controller in the p2051 p8851
word format.
Displays the PZD (actual values) sent to the fieldbus controller in the word r2053 r8853
format.
Connector output to interconnect the PZD (setpoints) received from the r2060 r8860
fieldbus controller in the double word format.
Selects the PZD (actual values) to be sent to the fieldbus controller in the p2061 p8861
double word format.
Displays the PZD (actual values) sent to the fieldbus controller in the double r2063 r8863
word format.

10.6.3 Configuring and commissioning
Note
When using SINAMICS Link, the memory card must remain inserted in the CUD.
p8835 cannot be set to 3 if it is not inserted.
Commissioning
When commissioning, proceed as follows:
1. Set the Control Unit parameter p0009 = 1 (device configuration).
2. Set the Control Unit parameter p8835 = 3 (SINAMICS Link).
3. Using p8839, define which interface should be used (for example for IF1: p8839[0] = 2).
4. If SINAMICS Link is assigned to IF1, set parameter p2037 of the drive objects to 2 (do not
freeze setpoints).
If SINAMICS Link was assigned IF2, then p8837 must be used for the setting.
5. Assign the nodes in parameter p8836 to the SINAMICS Link node number.
The first Control Unit is always assigned the number 1. Node number 0 means that for this
Control Unit SINAMICS Link has been shut down. Observe the specifications under
"Topology".
6. Check and/or correct the following parameters:
– p8811 must be identical for all nodes
– p8812[1] must be identical for all nodes
– p8812[0] may be different for local nodes
7. Set the Control Unit parameter p0009 = 0 (ready).
8. Execute a "Copy RAM to ROM".
9. Carry out a POWER ON (switch off the Control Unit and switch on again).
Sending data
Note
The parameters listed in the following description refer to the assignment of SINAMICS Link to
IF1. If you assigned SINAMICS Link to IF2, then you find the corresponding parameters in the
"Table 10-41 Corresponding parameters (Page 487)".

In this example, the first "Control Unit 1" node has two drive objects: "Drive 1" and "Drive 2".
Proceed as follows to send data:
1. If SINAMICS Link is assigned to IF1, then for each drive object, in its associated parameter
p2051[0...31], you define which data (PZDs) should be sent.
If SINAMICS Link was assigned IF2, then p8851 must be used for the setting. The data is
simultaneously reserved in the send slot of the p8871[0...31].
2. Enter the double words in p2061[x].
Double word data is simultaneously written to p8861[0...31].
3. For each drive object, allocate the send parameters in p8871[0...31] to a send slot of its own
node.
Table 10-42 Compile send data of drive 1 (DO2)
p2051[x] p2061[x] Content From param‐ Telegram

index index eter word p8871
0 - ZSW1 r0899 1
- 1 Actual speed value part 1 r0061[0] 2
- Actual speed value part 2 3
- 3 Actual torque value part 1 r0080 4
- Actual torque value part 2 5
5 - Actual fault code r2131 6
6 - 0 0 0
... - ... - ...
15 - 0 0 0
... - ... - ...
31 - 0 0 0
Table 10-43 Compile send data of drive 2 (DO3)
p2051[x] p2061[x] Content From pa‐ Slots in the send buffer

index index rameter p8871[x]
x Telegram
word
- - - - 0...51) 0
0 - ZSW1 r0899 6 7
- 1 Actual speed value part 1 r0061[0] 7 8
- Actual speed value part 2 8 9
- 3 Actual torque value part 1 r0080 9 10
- Actual torque value part 2 10 11
5 - Actual fault code r2131 11 12
6 - 0 0 12 0
... ... ... ...
15 - 0 0 15 0


x Telegram
word
... - ... - ... ...
31 - 0 0 31 0
1)
0...5 here remain free, as they are already assigned by DO2.
Table 10-44 Compile send data of Control Unit 1 (DO1)

x Telegram
word
- - - - 0...112) 0
0 - Control word, faults/alarms r2138 12 13
- 1 Missing enables part 1 r0046 13 14
- Missing enables part 2 14 15
15 - 0 0 15 0
... - ... - ... ...
31 - 0 0 31 0
2)
0...11 here remain free, as they are already assigned by DO2 and DO3.
Send slots PZD 16 to 31 are not required for this telegram and are therefore filled with a zero.
1. For double words (e.g. 1 + 2), assign two consecutive send slots, e.g.
p2061[1] => p8871[1] = PZD 2 and p8871[2] = PZD 3.
2. Enter the following PZD into the next parameter slots of p2051[x] or p2061[2x].
3. You must fill the unused slots of p8871[0...31] with zeros.
4. The sequence of the PZDs in the send telegram of this node are defined in parameter
p8871[0...31] by the entries in the required slots.
Receiving data
The sent telegrams of all nodes are simultaneously available at the SINAMICS Link. Each
telegram has a length of 32 PZD. Each telegram has a marker of the sender. You select those PZD
that you want to receive for the relevant node from all telegrams. You can process a maximum
of 32 PZD.
Note
If you have not deactivated the evaluation of bit 10 with p2037 = 2, the first word of the receive
data (PZD 1) must be a control word, where bit 10 = 1 is set.

In this example, Control Unit 2 receives selected data from the telegram of Control Unit 1.
Proceed as follows to receive data:
1. In parameter p8872[0…31] enter the address of the node for which you want to read one or
more PZDs (e.g. p8872[3] = 1 → from node 1, read in PZD 4, p8872[15] = 0 → do not read
in PZD 16).
2. After setting the parameters, using parameter r2050[0…31] or r2060[0…31] you can read
out the values.
Table 10-45 Receive data for Control Unit 2
From the sender Receiver

Transfer Tel. word 1)
Address Receive buffer Data transferred in
from p8871[x] p8872[x] p8870[x] r2050[x] r2060[x] Parameter Content
p2051[0] 0 1 PZD 1 0 - r0899 ZSW1
p2061[1] 1 1 PZD 2 - 1 r0061[0] Actual speed value part 1
2 1 PZD 3 - r0061[0] Actual speed value part 2
p2061[3] 3 1 PZD 4 - 3 r0080 Actual torque value part 1
4 1 PZD 5 - Actual torque value part 2
p2051[5] 5 1 PZD 6 5 - r2131 Actual fault code
p2051[4] 6 1 PZD 7 6 - r0899 ZSW1
p2061[5] 7 1 PZD 8 - 7 r0061[0] Actual speed value part 1
8 1 PZD 9 - Actual speed value part 2
p2061[6] 9 1 PZD 10 - 9 r0080 Actual torque value part 1
10 1 PZD 11 - Actual torque value part 2
p2051[7] 11 1 PZD 12 11 - r2131 Actual fault code
p2051[8] 12 1 PZD 13 12 - r2138 Control word, faults/alarms
p2061[9] 13 1 PZD 14 - 13 r0046 Missing enables part 1
14 1 PZD 15 - Missing enables part 2
- 15 0 PZD 16 15 - 0 Empty
... ... ... ... ... ... ... ...
- 31 0 PZD 32 31 0 0 -
1)
Tel.word = telegram word
Note
For double words, two PZD must be read in succession. To do this, read in a 32 bit setpoint, which
is on PZD 2 + PZD 3 of the telegram of node 2. Map this setpoint to PZD 2 + PZD 3 of participant 1:
p8872[1] = 2, p8870[1] = 2, p8872[2] = 2, p8870[2] = 3
Activating SINAMICS Link

To activate SINAMICS Link connections, perform a POWER ON for all nodes.

Without POWER ON, the following can be changed:

• The assignments of p2051[x]/2061[2x] and the links of the read parameters r2050[x]/
2060[2x]
• Parameters p8870, p8871, and p8872 In this case, the SINAMICS Link connections can also
be connected via p8842 = 1.
10.6.4 Example
Task
Configure SINAMICS Link for two nodes and transfer the following values:
• Send data from node 1 to node 2
– r0898 CO/BO: Control word, sequence control, drive 1 (1 PZD), in the example PZD 1
– r0079 CO: Total torque setpoint (2 PZD), in the example PZD 2
– r0021 CO: Smoothed actual speed (2 PZD), in the example PZD 3
• Send data from node 2 to node 1
– r0899 CO/BO: Status word, sequence control, drive 2 (1 PZD), in the example PZD 1
• IF1 is used for SINAMICS Link.
Procedure
1. For all nodes, set p0009 = 1 to change the device configuration.
2. For all CBE20 nodes, set the "SINAMICS Link" mode using p8835 = 3.
3. Limit the maximum number of nodes for all nodes with p8811 = 8. By setting p8811,
parameter p8812[1] is preassigned, and parameter p8836, if necessary, is corrected.
4. Assign the node numbers for the devices involved:
– Node 1 (≙ device 1): p8836 = 1
– Node 2 (≙ device 2): p8836 = 2
5. Make the following interface setting for all nodes:
– For IF1: p8839[0] = 2 (COMM BOARD)
– For IF2: p8839[1] = 1 (Control Unit onboard)
6. For both nodes p0009 = 0, carry out a "Copy RAM to ROM" followed by a POWER ON in order
to activate the modified firmware versions and the new settings in the CBE20.

7. Define the send data for node 1:

– Define the PZD that node 1 should send:
p2051[0] = drive1:r0898 (PZD 1)
p2061[1] = drive1:r0079 (PZD 2 + PZD 3)
p2061[3] = drive1:r0021 (PZD 4 + PZD 5)
– Place these PZD in the send buffer (p8871) of node 1:
p8871[0] = 1 (r0898)
p8871[1] = 2 (r0079 1st part)
p8871[2] = 3 (r0079 2nd part)
p8871[3] = 4 (r0021 1st part)
p8871[4] = 5 (r0021 2nd part)
8. Define the receive data for node 2:
– Specify that the data placed in the receive buffer p8872 of node 2 in locations 0 to 4 will
be received by node 1:
p8872[0] = 1
p8872[1] = 1
p8872[2] = 1
p8872[3] = 1
p8872[4] = 1
– Specify that PZD1, PZD2, and PZD3 of node 1 will be placed in the receive buffer p8870
of node 2 in locations 0 to 4:
p8870[0] = 1 (PZD1)
p8870[1] = 2 (PZD2 1st part)
p8870[2] = 3 (PZD2 2nd part)
p8870[3] = 4 (PZD3 1st part)
p8870[4] = 5 (PZD3 2nd part)
– r2050[0], r2060[1] and r2060[3] subsequently contain (after step 13) the values of
PZD 1, PZD 2 and PZD 3 of node 1.
9. Define the send data for node 2:
– Specify the PZD that node 2 should send:
p2051[0] = drive1:r0899 (PZD length is 1 word)
– Place this PZD in the send buffer (p8871) of node 2:
p8871[0] = 1
10.Define the receive data for node 1:
– Specify the data that should be placed in the receive buffer p8872 of node 1 in location
0, received from node 2:
p8872[0] = 2
– Define that PZD1 of node 2 is saved in the receive buffer p8870 of node 1 in location 0:
p8870 [ 0] = 1
– r2050[0] subsequently contains (after step 13) the value of PZD 1 of node 2.
11.At the two nodes carry-out a "Copy RAM to ROM" to backup the parameterization and the
data.
12.Set p8842 =1 to activate parameters p8870, p8871 and p8872.

6,1$0,&6/LQN 6,1$0,&6/LQN
3DUWLFLSDQW 3DUWLFLSDQW
&8 &8
3='
S S
S 3=' S
S 3=' S
S>@ S>@
3='
'ULYHREMHFW 'ULYHREMHFW
1DPH GULYH 1DPH GULYH
6HQGEXIIHU 5HFHLYHEXIIHU 6HQGEXIIHU 5HFHLYHEXIIHU
S>@ GULYHU 3=' U>@ 3='SDUWLF U>@GULYHU 3=' U>@ 3='SDUWLF

S>@ GULYHU 3=' S>@ S>@ U>@ 3='SDUWLF
S>@ GULYHU 3=' S>@ U>@ 3='SDUWLF
S>@ S>@
S>@ S>@
S>@ S>@
S>@ S>@
S>@ S>@
S>@
S>@
S>@
S>@
S>@
U6SHHGDFWXDOYDOXHVPRRWKHG
U7RWDOWRUTXHVHWSRLQW
U&RQWUROZRUGVHTXHQFHFRQWUROGULYH
U6WDWXVZRUGVHTXHQFHFRQWUROGULYH
Figure 10-46 SINAMICS Link: Configuration example
10.6.5 Communication failure when booting or in cyclic operation

If at least one sender does not correctly boot after commissioning or fails in cyclic operation,
then alarm A50005 is output to the other nodes: “Sender was not found on SINAMICS Link”.
The message contains the number of the faulted node. After you have resolved the fault at the
node involved and the system has identified the node, the system automatically withdraws the
alarm.
If several nodes are involved, the message occurs a multiple number of times consecutively
with different node numbers. After you have resolved all of the faults, the system
automatically withdraws the alarm.
When a node fails in cyclic operation, in addition to alarm A50005, fault F08501 is output:
"COMM BOARD: Monitoring time, process data expired"
At node 1, fault F08501 is not triggered. This node should be used for specifying setpoint
values to other nodes.

10.6.6 Examples: Transmission times for SINAMICS Link

Example 1: Transmission times at a communication cycle of 1 ms
p2048 or p8848 = 1 ms
Bus cycle Transmission time [ms]

[ms] Sync both Sync send Sync receive Async both
0.5 *) 1.0 1.5 1.3 1.6
1.0 1.5 2.1 2.1 2.2
2.0 3.0 3.6 3.1 2.8
Example 2: Transmission times at a communication cycle of 4 ms

p2048 or p8848 = 4 ms
Bus cycle Transmission time [ms]

[ms] Sync both Sync send Sync receive Async both
0.5 *) 1.0 3.0 2.8 4.6
1.0 1.5 3.6 3.6 5.2
2.0 3.0 5.1 4.6 5.8
*)
Only possible for SINAMICS S120/S150.
10.6.7 Function diagrams and parameters
Function diagrams (see SINAMICS DCM List Manual)
• 2197 Control Unit communication - SINAMICS Link overview

(r0108.31 = 1, p8835 = 3)
• 2198 Control Unit communication - SINAMICS Link configuration
(r0108.31 = 1, p8835 = 3)
• 2199 Control Unit communication - SINAMICS Link receive data
(r0108.31 = 1, p8835 = 3)
• 2200 Control Unit communication - SINAMICS Link send data
(r0108.31 = 1, p8835 = 3)
• p0115[0] Sampling time for additional functions

• p2037 IF1 PROFIdrive STW1.10 = 0 mode
• r2050[0...31] CO: IF1 PROFIdrive PZD receive word
• p2051[0...31] CI: IF1 PROFIdrive PZD send word
• r2060[0...30] CO: IF1 PROFIdrive PZD receive double word
• p2061[0...30] CI: IF1 PROFIdrive PZD send double word

10.7 Communication via EtherNet/IP (EIP)
• p8811 SINAMICS Link project selection

• p8812[0...1] SINAMICS Link cycle settings
• p8836 SINAMICS Link node address
• p8839[0...1] PZD interface hardware assignment
• p8870[0...31] SINAMICS Link PZD receive word
• p8871[0...31] SINAMICS Link PZD send word
• p8872[0...31] SINAMICS Link PZD receive address

EtherNet/IP (EIP) is a realtime Ethernet, and is mainly used in automation technology.
The EtherNet Industrial Protocol (EtherNet/IP) is an open standard for industrial networks. It
is used to transmit cyclic I/O data and acyclic parameter data. EtherNet/IP was developed by
Rockwell Automation and the Open Device-Net Vendor Association (ODVA), and standardized
in the series of international IEC 61158 standards. EtherNet/IP uses the basis technology
of Ethernet TCP/IP, which has been well proven in practice. Ethernet twisted-pair cables or
fiber-optic cables are used as data transmission medium.
For communication with EtherNet/IP, an Ethernet CBE20 Communication Board is required.
By setting p8835 = 4, you can choose the communication profile EtherNet/IP. After POWER
ON, the profile becomes active.
10.7.1 Components to connect SINAMICS DCM to EtherNet/IP

To connect the DC drive (left-hand CUD) to EtherNet/IP, SINAMICS DCM must be ordered with the
following options:
• G00: (Advanced CUD in the left-hand slot)
• G20: (CBE20 PROFINET, left possible with option G00)
The following options are required to connect an additional CUD (right-hand CUD) to
EtherNet/IP:
• G11 (Advanced CUD in right-hand slot, possible with option G00)
• G21 (CBE20 PROFINET right-hand, possible with G11)
See Chapter “Ordering information for options and accessories (Page 32)” for ordering data.
For additional information on the CBE20 Communication Board Ethernet, see Chapter
"Additional system components (Page 169)".

&%(
$GYDQFHG&8'
Picture left: Communication Board Ethernet CBE20 inserted in the option module slot ① of an
Advanced CUD
Picture right: Maximum configuration with two CBE20. 4 Ethernet cables ② for each CBE20.
Figure 10-47 CBE20
10.7.2 Configuration of SINAMICS DCM for EtherNet/IP

Requirements
• Advanced CUD
• CBE20
SINAMICS DCM for EtherNet/IP is configured via STARTER or by directly entering parameters at
the BOP.
Carry out the following steps to communicate with a higher-level control system via
EtherNet/IP:
1. Switch on the line supply and the 24 V supply of the SINAMICS DCM, and wait until run-up
has been completed.
2. Using STARTER or the BOP, switch to drive object CU_DC.
3. Activate the device configuration by setting p0009 = 1.
4. With p8835 = 4, set the firmware version "EtherNet/IP".
5. Set the IP address for the CBE20 using p8941. You can find the currently valid address in
r8951.
6. Set the subnet mask using p8943. You can find the currently valid subnet mask in r8953.
7. Set the standard gateway using p8942. You can find the currently valid standard gateway in
r8952.

8. Set the station name using p8940. You can find the currently valid station name in r8950.
This setting is not absolutely necessary for operation with EtherNet/IP; however, it can be
necessary in conjunction with DHCP.
9. Accept and activate the settings by setting p8945 = 2.
10.Complete the device configuration with p0009 = 0.
11.Save the data using command "Copy RAM to ROM".
12.Switch off the line supply and the 24 V supply of the SINAMICS DCM. Wait until all LEDs on the
SINAMICS DCM are dark before switching on.
13.Switch on the line supply and the 24 V supply of the SINAMICS DCM again. There settings are
active once running-up has been completed.
In addition to directly entering the IP address, it is also possible to retrieve this via DHCP.
1. Set the required DHCP mode using p8944 (CBE2x DHCP mode):
Parameterization Meaning
p8944 = 2 The DHCP server assigns the IP address based on the MAC address
p8944 = 3 The DHCP server assigns the IP address based on the station name
2. Save the settings with p8945 = 2.

The next time the drive runs up, it retrieves the IP address from the DHCP server. After the
drive has run-up, you can address the drive as Ethernet participant.
Note
Immediate switchover without restart
The switchover to DHCP is performed immediately and without a restart if the change is
carried out with the EtherNet/IP command "Set Attribute Single" (TCP/IP Interface Object /
Class code F5 hex, attribute 3), e.g. using an EtherNet/IP control or a commissioning tool.
Note
When DHCP (p8944 ≠ 0) is activated, PROFINET communication via CBE20 is not possible. As a
consequence, DHCP must be deactivated before switching over the interface to PROFINET.
10.7.3 EtherNet/IP communication with the SINAMICS DCM
The EtherNet/IP communication with SINAMICS DCM is possible using the following connection
types:
• Implicit (I/O) messaging
for cyclic I/O or process data (setpoints, actual values, control and status words)
• Explicit messaging
for acyclic message requirements

For communication via EtherNet/IP, SINAMICS DCM supports the following CIP objects:
Class code (hex) Class code Object name

001 hex 1 Identity object
004 hex 4 Assembly object
006 hex 6 Connection Manager object
0F5 hex 245 TCP/IP Interface Object 1)
0F6 hex 246 Link Object 1)
32C hex 812 Siemens Drive Object
(reading and writing certain device parameters)
401 hex ... 43E hex 1025 ... 1086 Parameter object
(General reading and writing of device parameters)
1)
These objects are part of the EtherNet/IP system management
The communication types and objects that are supported are described in more detail in the
following.
10.7.3.1 “Implicit messaging” – cyclic communication as I/O slave
Assembly object (Class Code 4 hex) is used for cyclic communication.

As standard, the SINAMICS DCM as I/O device exchanges cyclic process data (PZDs) with a PLC
or another control system.
Cyclic information, such as control words, status words, actual values and setpoints, are
called process data.
The following I/O assembly settings must be made (from the PLC perspective):
Assembly Content Description

101 Receive data Total length of the receive data in bytes (= 2x num‐
ber of receive PZD)
102 Send data Total length of the send data in bytes (= 2x number
of send PZD)
103 Configuration data Length 0 bytes
In addition, the cycle time of the data transfer - the RPI (Requested Packet Interval) - must be
additionally defined in the PLC. 4 ms is supported as the minimum value.
PZD are transferred as words (16 bit integer).

The data length for the assemblies of the receive and send data correspond to the total
number of PZD for all drive objects:
• Example 1:
Drive object (DO) Number of PZD in the send di‐ Number of PZD in the receive
rection direction
DC_CTRL (drive) 10 10
CU_DC 2 2
Total data length 12 words = 24 bytes 12 words = 24 bytes
• Example 2:
Drive object (DO) Number of PZD in the send di‐ Number of PZD in the receive
rection direction
DC_CTRL (drive) 10 5
CU_DC 0 0
TM31 1 1
Total data length 11 words = 22 bytes 6 words = 12 bytes
The highest PZD of a drive object, whose data is sent or received in an assembly, must be
connected with the data source or data sink via BiCO technology.
In example 1, PZD 10 of drive object DC_CTRL and PZD 2 of the drive object CU_DC must have
an active BiCO interconnection in the receive and send directions.
The highest interconnected PZD is displayed separately in r2067 (IF1) or r8867 (IF2) of a
drive object for the receive direction (index 0) and send direction (index 1).
In example 1, the total length of the send data can be calculated based on this parameter:
• DO DC_CTRL: r2067[1] = 10
• DO CU_DC: r2067[1] = 2
In total, 12 PZD or 24 bytes are obtained in the send direction.
Note
For a firmware release < 1.5, the assembly must be manually created by setting p8842 = 1 on the
CU_DC.
If the change is to be permanent, copy RAM to ROM.

The sequence in which the drive object data is arranged, depends on the communication
settings of the SINAMICS DCM.
The position of the data in the assembly can be set in the STARTER window "Telegram
configuration":

Figure 10-48 Changing the sequence of the drive objects
The sequence can only be changed offline, using the right arrow (①).
For the change to take effect, it must be subsequently downloaded from the PG/PC to the
SINAMICS DCM.
Note
If the constraints described for the communication are not complied with, then alarm A50011
"EtherNetIP/COMM BOARD; configuration error" is output.
Description of the Assembly Object
Table 10-46 Assembly Object – supported services
Environment Service
Class Get Attribute single
Instance Get Attribute single
Set Attribute single

Table 10-47 Assembly Object – Class Attributes
Attribute ID Service Type Name

1 get UINT16 Revision
2 get UINT16 Max Instance
3 get UINT16 Num of Instances
Table 10-48 Assembly Object – Instance Attributes
Attribute ID Service Type Name Value Description

3 get UINT8[] Assembly ... 1 byte array
10.7.3.2 “Explicit messaging” – acyclic or event-driven communication
Using this communication type, when requested by the SINAMICS DCM, data can be read or
transferred there.
Identity Object, Class code 1 hex

The Identity Object allows basic information to be queried about the device, for example, the
serial number and the product name.
Table 10-49 Identity Object – supported services
Environment Service
Class Get Attribute all
Get Attribute single
Instance Get Attribute all
Reset
Table 10-50 Identity Object – Class Attributes

Table 10-51 Identity Object – Instance Attributes

1 get UINT16 Vendor ID 1251 Siemens
2 get UINT16 Device Type 0x0C Siemens Drive
3 get UINT16 Product Code 5480 CU_DCP r0964[1]


4 get Struct of Revision - -
5 get WORD Status ... See the following table
6 get UINT32 Serial number ... Bit 0 ... 19: Consecutive number
Bits 20 ...23: Production day
Bits 24 ... 27: Month of manufacture (0 = Jan, B = Dec)
Bits 28 … 31: Year of manufacture (0 = 2002)
7 get SHORT_STRI Product Name SINAMICS Max. length 32 bytes
NG DCM
Table 10-52 Identity Object – explanation of Instance Attribute ID 5 of the previous table
Byte Bit Name Description

1 0 Owned 0: Converter is not assigned to a controller
1: Converter is assigned to a controller
1 ‑ Reserved
2 Configured 0: Ethernet/IP basic settings
1: modified Ethernet/IP settings
3 ‑ Reserved
4…7 Extended Device Sta‐ 0: Self-test or status not known
tus 1: Firmware update active
2: At least one I/O connection with error
3: No I/O connections
4: Incorrect configuration in the ROM
5: Fatal fault
6: At least one I/O connection is active
7: All I/O connections in the quiescent state
8 … 15: Reserved
2 8 … 11 ‑ not used
12 … 15 ‑ Reserved
Siemens Drive Object, Class code 32C hex

Using the Siemens Drive Object, a defined subset of the parameters of all drive objects (DO) of
the SINAMICS DCM can be read out (get) and changed (set).
Drive objects of the SINAMICS DCM are accessed via the instance ID and the position of the drive
object in the sequence of the telegram configuration, i.e. instance ID corresponds to the entry
under "Object" of the drive object in the STARTER window "Telegram configuration".
Parameter Object (Class codes 401 hex … 43E hex) should always be used for reading and
writing drive objects; in contrast to the Siemens Drive Object, it allows all parameters of the
drive object to be accessed.
Table 10-53 Siemens Drive Object - supported services
Environment Service

Table 10-54 Siemens Drive Object – Class Attributes

The following table describes the available attributes and/or the parameters of the drive
objects. It should be noted that some attributes are not supported by all drive devices.
Table 10-55 Siemens Drive Object – Instance Attributes
Attribute ID Service Name Description Comment

2 get, set Commissioning p0010 Only for drive objects
state Commissioning parameter filter DC_CTRL, TM15 DI/DO, TM31, TM150
3 … 18 get STW1 r2090[0] (r2050[0] bit-by-bit)
STW1 bit-by-bit access
Attribute ID 3 = STW1.0
...
Attribute ID 18 = STW1.15
20 … 35 get ZSW1 r2089[0]
ZSW1 bit-by-bit access
Attribute ID 20 = ZSW1.0
Attribute ID 35 = ZSW1.15
36 get, set Actual frequency r0063 Only for drive object
Main actual value (actual frequency) DC_CTRL
43 get, set PID Enable p2200[0] Only for drive object
Technology controller enable DC_CTRL
44 get, set PID Filter Time Con‐ p2265 Only for drive object
stant Technology controller actual value fil‐ DC_CTRL
ter time constant
45 get, set PID D Gain p2274 Only for drive object
Technology controller differentiation DC_CTRL
time constant
46 get, set PID P Gain p2280 Only for drive object
Technology controller proportional DC_CTRL
gain
47 get, set PID I Gain p2285 Only for drive object
Technology controller integral time DC_CTRL
48 get, set PID Up Limit p2291 Only for drive object
Technology controller maximum lim‐ DC_CTRL
iting
49 get, set PID Down Limit p2292 Only for drive object
Technology controller minimum lim‐ DC_CTRL
iting
50 get, set Speed setpoint r0020 Only for drive object
Speed setpoint smoothed DC_CTRL
54 get Actual Current r0027 Only for drive object
Reactor absolute actual current DC_CTRL
smoothed
60 get CDS Eff (Local r0050 Only for drive object
Mode) Command data set CDS effective DC_CTRL

Attribute ID Service Name Description Comment

61 get Status Word 2 r2089[1] binector-connector con‐
verter
Send status word, status word 2
62 get Control Word 1 r0898 Only for drive object
Control word sequence control DC_CTRL
63 get Motor speed (en‐ r0061[0] Only for drive object
coder) Speed actual value unsmoothed DC_CTRL
70 get Fault Code 1 r0947[0]
Fault number 1
Fault number 2
Fault number 3
Fault number 4
Fault number 5
Fault number 6
Fault number 7
Fault number 8
79 get Alarm Code 1 r2110[0]
Alarm number 1
Alarm number 2
Alarm number 3
Alarm number 4
Parameter Object, Class codes 401 hex … 43E hex

Using Parameter Object, it is possible to write to any parameter of the addressed drive object
(get) or to read any parameter of the addressed drive object (set).
Table 10-56 Parameter Object – supported services
Environment Service

Table 10-57 Parameter Object – Class Attributes

Parameters of the drive objects are accessed via Class code, Instance ID and Instance
Attribute:
Class code: The Class code corresponds to 400 hex + <Drive object No.>
The drive object No. can be taken from column "(Drive object) No." in
the STARTER "Telegram configuration" window.
For example,
Class code 401 hex: Drive object 1
Class code 402 hex: Drive object 2
... ...
Class code 43E hex: Drive object 62
Instance ID: The parameter No. is transferred in the Instance ID.
For example, access to r50001 ⇒ Instance ID = 50001
(Instance) attribute: Parameter indices are transferred as Instance Attributes.
For example, access to r52051[2] ⇒ Instance Attribute = 2
Generally, the following applies:
• Drive object No. 1 = CU_DC ⇒ Class code 401 hex
• Drive object No. 2 = DC_CTRL ⇒ Class code 402 hex
Example:Read parameter r50013[4] (temperature control module CUD) from DO 2 (in

this case, DC_CTRL)
Service "Get Attribute single" with the following values:
EtherNet/IP task Value Comment

Class code 402 hex Drive object 2 (default: DC_CTRL)
Instance ID 50013 Parameter r50013:
Temperature sensor/module
Instance Attribute 4 Index 4: Temperature, Control module CUD
Example:Write to p0009 (device commissioning parameter filter) in DO 1 (in this case,

CU_DC)
Service "Set Attribute single" with the following values:
EtherNet/IP task Value Comment

Class code 401 hex Drive object 1 (default: CU_DC)
Instance ID 9 Parameter p0009:
device commissioning parameter filter
Instance Attribute 0 No index
Data 1 Parameter value: [1] device configuration

The data type of the parameter, and therefore the representation in the user data of the
parameter object, is specified by the drive and can be found in the SINAMICS DCM List
Manual (Chapter "List of parameters").
Note
For write access, the number of user data bytes must correspond to the parameter data width.
Otherwise, the write request is rejected.
Examples:
• Precisely 2 bytes must be transferred for a parameter, data type Integer16 (e.g. P0010).
• Precisely 4 bytes must be transferred for a parameter, data type FloatingPoint32.
Other supported objects
Connection Management Object, Class code 6 hex
Table 10-58 Connection Management Object – supported services
Environment Service
Instance Forward open
Forward close
Get Attribute all
Table 10-59 Connection Management Object – Class Attributes

Table 10-60 Connection Management Object – Instance Attributes

1 get UINT16 Open Requests ... Counters
2 get UINT16 Open Format Re‐ ... Counters
jects
3 get UINT16 Open Resource ... Counters
Rejects
4 get UINT16 Open Other Re‐ ... Counters
jects
5 get UINT16 Close Requests ... Counters


6 get UINT16 Close Format Re‐ ... Counters
quests
7 get UINT16 Close Other Re‐ ... Counters
quests
8 get UINT16 Connection ... Counters
Timeouts Number of bus errors
TCP/IP Interface Object, Class code F5 hex
Table 10-61 TCP/IP Interface Object – supported services
Environment Service
Reset
Table 10-62 TCP/IP Interface Object – Class Attributes

Table 10-63 TCP/IP Interface Object – Instance Attributes
Attribute ID Service Type Name Value/explanation

1 get UNIT32 Status Fixed value: 1 hex
1: Configuration acknowledged, by DHCP or
saved values
2 get UNIT32 Configuration Fixed value: 94 hex
Capability 4 hex: DHCP supported,
10 hex: Configuration can be adjusted,
80 hex: ACD-capable
3 get, set UNIT32 Configuration 1 hex: Saved values
Control 3 hex: DHCP
4 get UNIT16 Physical Link Path size (in WORDs)
Fixed value: 2 hex
UNIT8 Path
20 hex,
F6hex,
24hex,
5 hex, whereby 5 hex is the number of instances
of F6 hex (for physical ports plus one internal
port).


5 get, set STRING Interface Config‐ r61000 Name of Station
UNIT32 uration r61001 IP address
6 get, set UNIT16 Host Name Host Name Length
STRING -
10 get, set UNIT8 Select ACD local OM flash:
0: Disabled,
1: Enabled
11 get, set UNIT8 Last Conflict De‐ local OM flash ACD Activity
UNIT8 tected local OM flash Remote MAC
UNIT8 local OM flash ARP PDU
Link Object, Class code F6 hex
Table 10-64 Link Object – supported services
Environment Service
Reset
Table 10-65 Link Object – Class Attributes

Table 10-66 Link Object – Instance Attributes

1 get UINT32 Interface Speed 0: link down,
10: 10 Mbps,
100: 100 Mbps
2 get - Interface Flags Bit 1: Link-Status
Bit 2: Duplex Mode (0: half duplex, 1 duplex)
bit 3 … 5: Automatic state identification
Bit 6: Reset required
Bit 7: Local hardware fault (0 = ok)
3 get ARRAY Physical Address r8935 Ethernet MAC address


4 get, Struct of Interface Counters Optional, required if the "Media Counters Attribute"
get_and_cle is implemented.
ar UINT32 In Octets Received octets
UINT32 In Ucast Packets Received Unicast packets
UINT32 In NUcast Packets Received non-Unicast packets
UINT32 In Discards Incoming packets, not processed
UINT32 In Errors Incoming packets with errors
UINT32 In Unknown Protos Incoming packets with unknown protocol
UINT32 Out Octets Sent octets
UINT32 Out Ucast Packets Sent Unicast packets
UINT32 Out NUcast packets Sent non-Unicast packets
UINT32 Out Discards Outgoing packets, not processed
UINT32 Out Errors Outgoing packets, with errors
5 get, Struct of Media Counters Media-specific counters
get_and_cle UINT32 Alignment Errors Structure received, which does not match the num‐
ar ber of octets
UINT32 FCS Errors Structure received, which does not pass the FCS
check
UINT32 Single Collisions Structure successfully transmitted, precisely one
collision
UINT32 Multiple Collisions Structure successfully transmitted, several colli‐
sions
UINT32 SQE Test Errors Number of SQE errors
UINT32 Deferred Transmissions First transmission attempt delayed
UINT32 Late Collisions Number of collisions that occurred delayed by 512
bit timers to the request
UINT32 Excessive Collisions Transmission unsuccessful as a result of intensive
collisions
UINT32 MAC Transmit Errors Transmission unsuccessful as a result of an internal
MAC sublayer transmission error.
UINT32 Carrier Sense Errors Number of errors when attempting to send a re‐
quest frame, where the transmission condition was
lost or was not assigned
UINT32 Frame Too Long Structure too large
UINT32 MAC Receive Errors Transmission unsuccessful as a result of an internal
MAC sublayer receive error.
6 get, set Struct of Interface Control ‑
UINT16 Control Bits ‑
UINT16 Forced Interface Speed ‑
10 get String Interface_Label Interface-Label
11 get ‑ Interface Capability Bit 0: Manual setting
Bit 1: Auto negotiate
Bit 2: Auto MDIX
Bit 3: Manual speed/duplex
Bits 4 – 31: reserved
Rest: Speed/Duplex options

10.7.4 Examples when using a Rockwell PLC
10.7.4.1 Configuration of a Rockwell PLC for the communication with SINAMICS DCM
Note
The user must have basic knowledge of Allen-Bradley / Rockwell PLCs.
The associated Allen-Bradley / Rockwell documentation should be used for detailed information
about communication with EtherNet/IP and general programming of Rockwell PLCs.
A "Generic EtherNet/IP" module must be created in order to communicate with a SINAMICS

DCM.

The following configurations must be made for the basic communication:

• Selection of the module, figures "Selection of the module (1), (2) and (3)"
The dialog box for the selection of the module for the appropriate EtherNet interface is
selected in the I/O configuration through > right-click > New Module.
Figure 10-49 Selection of the module (1)
The "Generic EtherNet Module" is selected at Communication:

• After the module has been inserted by clicking OK, a new EtherNet/IP appears in the
structure tree.
A window is opened as follows by double-clicking with the left-hand mouse key or > right-
hand mouse key > Properties.
Figure 10-52 Properties
Make the following settings:

• Select a name to identify the drive
• Enter the IP address of the drive
• Set the "Connection Parameters" as described in Chapter "“Implicit messaging” – cyclic
communication as I/O slave (Page 499)".

After the configuration has been activated, the drive data can be accessed via the input and
output data fields (see following diagram).
For a better program documentation, it is recommended that aliases be defined for each
input and output signal.
Figure 10-53 Input data and output data
Now configure the drive in order to use EtherNet/IP.
10.7.4.2 Reading and writing parameters using the Parameter Object (Class code 4xx hex)
As described in Chapter ““Explicit messaging” – acyclic or event-driven communication

(Page 502)”, individual drive parameters can be read and written.
In order to use this function, a "MSG" message block must be inserted in the program (figure
below). A control tag of the "MESSAG" type must be declared and assigned to the message
block for saving the configuration and status information.
The class information is assigned to the block in the next step. The configuration dialog must
be opened by clicking (1).
Figure 10-54 Inserting MSG

The configuration dialog shown in the following figure opens:
Figure 10-55 Configuration dialog
Configuration:
• Set "Message Type" to "CIP Generic"
• Set "Service Type" to
– "Get Attribute Single" for reading
– "Set Attribute Single" for writing
• Class: 4xx–xx represents the drive object number (default 02 hex for drive ⇒ 402)
• Instance: Parameter number
• Attribute: Index number
• Destination: Sufficiently large variable to store the queried value
• "Source Element" and "Source Length" must be defined for writing with service type "Set
Attribute Single". The number of bytes must match the data type of the parameter to be
written.
If the above settings have been activated, the source or destination EtherNet/IP device to
which the message is to be sent must be specified.
This is done on the "Communication" tab:

Figure 10-56 Communication
"Path": Defines the EtherNet/IP module, in this example "dcmlinks".

The previous example reads the active error number from parameter r0947 index 0 on drive
object No. 2 (drive).
10.7.5 Messages and parameters
Faults and alarms (see SINAMICS DCM List Manual)
• F08501 (N,A) PN/COMM BOARD: Setpoint timeout

• F01910 (N,A) Fieldbus: Setpoint timeout
• A08526 (F) PN/COMM BOARD: No cyclic connection
• A01980 (F) PN: Cyclic connection interrupted
• A50011 (F) EtherNetIP/COMM BOARD: Configuration error
• p0922 IF1 PROFIdrive PZD telegram selection

• p0978[0...n] List of drive objects
• p0999[0...99] List of modified parameters 10
• p2030 Fieldbus interface protocol selection
• p8940[0...239] CBE2x Name of Station

10.8 Communication via MODBUS TCP
• p8941[0...3] CBE2x IP address

• p8942[0...3] CBE2x Default Gateway
• p8943[0...3] CBE2x Subnet Mask
• p8944 CBE2x DHCP mode
• p8945 CBE2x interfaces configuration
• r8950[0...239] CBE2x Name of Station actual
• r8951[0...3] CBE2x IP address actual
• r8952[0...3] CBE2x Default Gateway actual
• r8953[0...3] CBE2x Subnet Mask actual
• r8954 CBE2x DHCP Mode actual
• r8955[0...5] CBE2x MAC address
• r8956[0...1] CBE2x cyclic connection state
• r8957[0...5] CBE2x cyclic connection diagnostics
10.8.1 Overview
The Modbus protocol is a communication protocol based on a controller/device architecture.

Modbus offers three transmission modes:
• Modbus ASCII - via a serial interface
data in the ASCII code. The data throughput is lower compared to RTU.
• Modbus RTU - via a serial interface
data in the binary format. The data throughput is greater than in ASCII code.
• Modbus TCP - via Ethernet
data as TCP/IP packages. TCP port 502 is reserved for Modbus TCP.
Only transfer type "Modbus TCP" is available for SINAMICS DCM.
Modbus functionality
Process data and parameters are accessed via the Modbus tab.
• Process data: 40100 - 40119
A maximum of 10 process data (PZD) can be exchanged.
• Drive data: 40300 - 40522
• All parameters via DS47: 40601 - 40722

Modbus TCP always provides a basic Ethernet functionality, which corresponds to the
functionality of Ethernet interface X127:
• Commissioning access for STARTER/Startdrive with S7 protocol
• DCP (Discovery and Configuration Protocol) to set the IP address etc.
• SNMP for identification
General information about communication

Communication with Modbus TCP is established via the Ethernet/PROFINET interface on the
CBE20 module.
To do this, an Advanced CUD is required.
Further, the memory card (with the device firmware) must remain permanently inserted.
For further details on the CBE20 module, see Chapter "Option Board: CBE20 Communication
Board Ethernet (Page 170)".
Note
Information on how to correctly handle the memory card is provided in Chapter "Memory card
functions (Page 329)".
It is especially important to note that it is not permissible to insert the card when the device is
operational.
Drive object that can be addressed via Modbus

With Modbus TCP, you always address the first drive object from the list of drive objects
(p0978[0]). A DC_CTRL drive object must be in this parameter.
• However, Modbus TCP is only activated if, under p0978[0], there is a drive object that is
supported by Modbus TCP.
• If p0978[0] does not contain a valid drive object, then establishing communication is
acknowledged with alarm A08555(2).
Diagnostics LEDs in Modbus TCP

For Modbus TCP, diagnostic states are shown using the following LEDs:
X1400 (CBE20): "OPT" LED
The following states can be displayed using these LEDs:
Color Status Meaning

Green Continuous Connections and setpoints are OK.
light
Green Flashing light Connection is OK, but no setpoints (dependent on timeout).
Red Flashing light No connection or setpoint timeout.
2 Hz

10.8.2 Configuring Modbus TCP via interface X1400
Activating Modbus TCP via X1400 (CBE20)

1. Switch off the power supply voltage of the SINAMICS DCM.
Wait until all LEDs on the SINAMICS DCM are dark.
2. Insert the memory card with firmware version 1.5 or higher into the appropriate slot of the
CUD.
Note that the device configuration can be overwritten if the memory card already has a
parameterization file.
Note
Information on how to correctly handle the memory card is provided in Chapter "Memory
card functions (Page 329)".
It is especially important to note that it is not permissible to insert the card when the device
is operational.
3. Switch on the SINAMICS DCM and wait for it to run up.

4. Using STARTER or the BOP, switch to drive object CU_DC.
5. Activate the device configuration by setting p0009 = 1.
6. For drive object CU_DC, using p8835 = 5, set the firmware version "Modbus TCP".
7. Set the IP address for the CBE20 using p8941.
The currently valid address is in r8951.
8. Set the subnet mask for the CBE20 using p8943.
The currently valid subnet mask is in r8953.
9. Set the default gateway for the CBE20 using p8942.
You can find the currently valid default gateway in r8952.
10.Set the DHCP mode for the CBE20 using p8944.
11.Select the setting "Activate and save configuration" as interface configuration using
p8945 = 2.
12.In the STARTER commissioning tool, check the list of drive object p0978.
If required, change the sequence of the drive objects using the telegram configuration ("Drive
device" > "Communication" > "Telegram configuration").
13.Complete the device configuration with p0009 = 0.
14.Save the data using command "Copy RAM to ROM".
15.Switch off the supply voltage for the SINAMICS DCM.
Before you switch on again, wait until all LEDs on the SINAMICS DCM are dark.
16.Switch on the supply voltage for the SINAMICS DCM.
Your settings become active after the system has run up.

Modbus settings with interface X1400

Using the following parameters, set the communication for Modbus TCP with a X1400 interface:
Parameter Explanation
r2050[0...19] Connector output to interconnect the PZD received from the fieldbus controller via IF1.
p2051[0...24] Selects the PZD (actual values) to be sent to the fieldbus controller in the word format
via IF1.
r2053[0...24] Displays the PZD (actual values) sent to the fieldbus controller in the word format via
IF1.
p8840 Setting the monitoring time to monitor the received process data via the COMM
BOARD.
If, within this time, the Control Unit does not receive any process data from the COMM
BOARD, then the drive shuts down with fault F08501.
p8839[0...1] Assigning the CBE20 Communication Board Ethernet (X1400) for cyclic communica‐
tion via PZD interface 1 (IF1) and interface 2 (IF2).
r8850[0...19] Connector output to interconnect the PZD (setpoints) received in the word format via
IF2.
p8851[0...24] Selects the PZD (actual values) to be sent in the word format via IF2.
r8853[0...24] Displays the PZD (actual values) sent in the word format via IF2.
10.8.3 Mapping tables
Modbus register and Control Unit parameters

The Modbus protocol contains register or bit numbers for addressing memory. You must assign
the appropriate control words, status words, and parameters to these registers in the device.
The valid holding register address range extends from 40001 up to 40722. When trying to
access other holding registers, the "Exception code" error is output
The process data are transferred into the register range from 40100 up to 40119.
Note
"R"; "W"; "R/W" in the “Access" column stands for read (with FC03); write (with FC06); read/write.
Table 10-67 Assigning the Modbus register to the parameters - process data
Register Description Access Unit Scaling ON/OFF text Data / parameter

or Value range
Control data
40100 Control word (see SINAMICS DCM List R/W - 1 - Process data 1
Manual, function block diagram 2442) (r2050[0])
40101 Main setpoint R/W - 1 - Process data 2
(r2050[1])


or Value range
40102 STW 3 R/W - 1 - Process data 3
(r2050[2])
40103 STW 4 R/W - 1 - Process data 4
(r2050[3])
40104 PZD 5 R/W - 1 - Process data 5
(r2050[4])
(r2050[5])
(r2050[6])
(r2050[7])
(r2050[8])
(r2050[9])
Status data
40110 Control word (see SINAMICS DCM List R - 1 - Process data 1
Manual, function block diagram 2452) (p2051[0])
40111 Main actual value R - 1 - Process data 2
(p2051[1])
40112 ZSW 3 R - 1 - Process data 3
(p2051[2])
40113 ZSW 4 R - 1 - Process data 4
(p2051[3])
40114 PZD 5 R - 1 - Process data 5
(p2051[4])
(p2051[5])
(p2051[6])
(p2051[7])
(p2051[8])
(p2051[9])
Table 10-68 Assigning the Modbus register to the parameters - parameter data

or Value range
Drive identification
40300 Actual power unit code number R - 1 0 … 65535 r0200
40301 Control Unit firmware R - 1 0 … 65535 r50060
Drive data


or Value range
40322 Ramp-up time R/W s 100 10.00 … 655.35 p50303
40323 Ramp-down time R/W s 100 10.00 … 655.35 p50304
40324 Reference speed R/W RPM 1 6 … 65535 p2000
Drive diagnostics
40340 Speed setpoint R RPM 1 -32768 … 32767 r0020
40341 Actual speed value R RPM 1 -32768 … 32767 r0021
40345 Actual current value R A 100 0 … 655.35 r0027
40347 Actual active power R kW 100 0 … 655.35 r0032
40349 Control priority R - 1 HAND AUTO r0807
Fault diagnostics
40400 Failure number, index 0 R - 1 0 … 65535 r0947 [0]
40403 Fault number, index 3 R - 1 0 … 65535 r0947 [3]
40408 Alarm number R - 1 0 … 65535 r2110 [0]
40409 Actual alarm code R - 1 0 … 65535 r2132
40499 PRM ERROR code R - 1 0 … 255 -
Technology controller1)
40500 Technology controller enable R/W - 1 0…1 p2200, r2349.0
Adapt technology controller 1)
40510 Time constant for actual-value filters R/W - 100 0.00 … 60.0 p2265
of the technology controller
40511 Scaling factor for actual value of the R/W % 100 0.00 … 500.00 p2269
technology controller
40512 Proportional amplification of the tech‐ R/W - 1000 0.000 … 65.535 p2280
nology controller
40513 Integral time of the technology con‐ R/W s 1 0 … 60 p2285
troller
40514 Time constant D-component of the R/W - 1 0 … 60 p2274
technology controller
40515 Max. limit of technology controller R/W % 100 -200.0 … 200.0 p2291
40516 Min. limit technology controller R/W % 100 -200.0 … 200.0 p2292
PID diagnostics
40521 Actual value of technology controller R % 100 -100.0 … 100.0 r2266
after filter
40522 Output signal technology controller R % 100 -100.0 … 100.0 r2294
1)
The technology controller parameters can only be accessed if, in the STARTER project, also the "Technology controller"
function module is activated.

Table 10-69 Assignment of the Modbus register for general parameter access using DS47

or Value range
40601 DS47 Control R/W - - - -
40602 DS47 header R/W - - - -
40603 DS47 data 1 R/W - - - -
… …
40722 DS47 data 120 R/W - - - -
Note
Limited value range
Modbus TCP registers have a maximum 16 bit width. The values of display parameters (r
parameters) cannot always be represented with 16 bits. In these particular cases, the maximum
value that can be represented is displayed.
• Unsigned: 65535
• Signed min: -32768
• Signed max: 32767
10.8.4 Read and write access using function codes
Function codes used

For data exchange between the controller and device, predefined function codes are used for
communication via Modbus.
The Control Unit uses the following Modbus function codes:
• FC 03: Holding register to read data from the converter
• FC 06: Write single register to write to individual register
• FC 16: Write to multiple registers to write to several registers
Structure of a Modbus TCP message
Application Data Unit (ADU)

Modbus Application Header Protocol Data Unit (PDU)
Transaction ID Protocol ID Length Unit ID FCode Data
2 Bytes 2 Bytes 2 Bytes 1 Byte 1 Byte 0 ... 252 Bytes
Figure 10-57 Individual components, including the Modbus Application Header (MBAP) and function
code

Structure of a read request via Modbus function code 03 (FC 03)

Any valid register address is permitted as the start address.
Via FC 03, the control can address more than one register with one request. The number of
addressed registers is contained in bytes 10 and 11 of the read request.
Table 10-70 Structure of a read request for device number 17, example
Value Byte Description

MBAP header
03 h 7
00 h 8 Register start address "High" (register 40110)
6D h 9 Register start address "Low"
00 h 10 Number of registers "High" (2 registers: 40110; 40111)
02 h 11 number of registers "Low"
The response returns the corresponding data set:
Table 10-71 Device response to the read request, example

MBAP header
03 h 7 Function code
04 h 8 Number of bytes (4 bytes are returned)
11 h 9 Data, first tab "High"
22 h 10 Data, first tab "Low"
33 h 11 Data, second tab "High"
44 h 12 Data, second tab "Low"
Table 10-72 Invalid read request
Read request Converter response

Invalid register address Exception code 02 (invalid data address)
Read a write-only register Telegram in which all values are set to 0.
Read a reserved register
Controller addresses more than 125 registers Exception code 03 (invalid data value)
The start address and the number of registers of an Exception code 02 (invalid data address)
address are located outside of a defined register block
Structure of a write request via Modbus function code 06 (FC 06)

Start address is the holding register address.

Via FC 06, with one request, only precisely one register can be addressed. The value, which is
written to the addressed register, is contained in bytes 10 and 11 of the write request.
Table 10-73 Structure of a write request for device number 17, example

MBAP header
00 h 8 Register start address "High" (write register 40100)
63 h 9 Register start address "Low"
55 h 10 Register data "High"
66 h 11 Register data "Low"
The response returns register address (bytes 8 and 9) and the value (bytes 10 and 11), which
the higher-level control had written to the register.
Table 10-74 Device response to the write request, example

MBAP header
00 h 8 Register start address "High"
63 h 9 Register start address "Low"
55 h 10 Register data "High"
66 h 11 Register data "Low"
Table 10-75 Invalid write request
Write request Converter response

Incorrect address (a holding register address does not exist) Exception Code 02 - invalid data ad‐
dress
Write to a "read-only" register Exception Code 04 - device failure
Write to a reserved register
For Exception Code 4, via the holding register 40499, you can read out the internal drive
error code, which has occurred for the last parameter access via the holding register.
10.8.5 Communication via data set 47
Via FC 16, with one request, up to 122 registers can be written to directly one after the other,
while for Write Single Register (FC 06) you must individually write the header data for each
register.
Header
In addition to the transfer type, the start address and the number of the following registers in
the header.

User data
You control the access in the user data via register 40601.
In register 40602, you define the access as well as the length of the request data.
Register 40603 contains the request reference - it is defined by the user - and the access type
- reading or writing.
From register 40603 and higher, the request aligns communication via data set 47 according
to PROFIdrive.
Register 40604 contains the number of the drive object and the number of parameters that
are read out or written to.
Register 40605 contains the attribute that you use to control whether you read out the
parameter value or the parameter attribute. In the number of elements you specify how
many indices are read.
10.8.5.1 Communication details
General parameter access is realized using the Modbus register 40601 … 40722.
Communication via DS47 is controlled using 40601. 40602 contains the function code
(always = 47 = 2F hex) and the number of the following user data. User data are contained in
registers 40603 … 40722.
Communication overview
Value in the register Explanation

40601 40602 40603 … 40722
0 47 … … Write values for acyclic access
1 47 Request Request data Activate acyclic access
length
[bytes]
2 47 Response Response data Response for a successful request
length
[bytes]
2 47 0 Fault code Response for an erronous request
Error codes
1 hex: Invalid Length (invalid length)
2 hex: Invalid State (in the actual converter state, this action is not permitted)
3 hex: Invalid function code (FC ≠ 2F hex)
4 hex: Response not ready (the response has still not been issued)
5 hex: Internal Error (general system error)
Incorrect access operations to parameters via data set 47 are logged in registers
40603 … 40722. The error codes are described in the PROFIdrive profile.

10.8.5.2 Examples: Read parameter
Table 10-76 Write parameter request: Reading parameter value of r0002 from device number 17

MBAP header
10 h 7 Function code (write multiple)
0258 h 8,9 Register start address
0007 h 10,11 Number of registers to be read (40601 … 40607)
0E h 12 Number of data bytes (7 registers, each 2 bytes = 14 bytes)
0001 h 13,14 40601: DS47 Control = 1 (activate request)
2F0A h 15,16 40602: Function 2F h (47), request length 10 bytes (0A h)
8001 h 17,18 40603: Request reference = 80 h, request identifier = 1 h
0101 h 19,20 40604: DO Id = 1, number of parameters = 1
1001 h 21,22 40605: Attribute, number of elements = 1
0002 h 23,24 40606: Parameter number = 2
0000 h 25,26 40607: Subindex = 0
Table 10-77 Start parameter request: Reading parameter value of r0002 from device number 17

MBAP header
03 h 7 Function code (read)
0007 h 10,11 Number of registers to be read (40601 … 40607)
0010 h 12,13 Number of registers
Table 10-78 Response for successful read operation

MBAP header
20 h 8 Number of following data bytes (20 h: 32 bytes ≙ 16 registers)
0002 h 9,10 40601: DS47 Control = 2 (the request was executed)
2F08 h 11,12 40602: Function code 2F h (47), response lengths 8 bytes
8001 h 13,14 40603: Request reference mirrored = 80 h,
response identifier = 1 (request parameter)
0101 h 15,16 40604: DO-ID = 1, number of parameters = 1
0301 h 17,18 40605: Format, number of elements = 1
001F h 19,20 40606: Parameter value = 1F h (31)

Table 10-79 Response for unsuccessful read operation - read request still not completed

MBAP header
0001 h 9,10 40601: Check value 1 = request is processed
2F00 h 11,12 40602: Function code 2F h (47), response length 0 (error)
0004 h 13,14 40603: Error code: 0004 Response Not Ready (response has still not been
issued)
10.8.5.3 Examples: Write parameter
Table 10-80 Write parameter request: Writing the parameter value of p1121 from device number 17

MBAP header
10 h 7 Function code (write multiple)
000A h 10,11 Number of registers to be written to (40601 … 40610)
14 h 12 Number of data bytes (10 registers, each 2 bytes = 20 bytes)
0001 h 13,14 40601: C1 (activate request)
2F10 h 15,16 40602: Function 2F h (47), request length 16 bytes (10 h)
8002 h 17,18 40603: Request reference = 80 h, request identifier = 2 h (write)
0101 h 19,20 40604: DO Id = 1, number of parameters = 1
1001 h 21,22 40605: Attribute, number of elements = 1
0461 h 23,24 40606: Parameter number = 1121
0000 h 25,26 40607: Subindex = 0
0801 h 27,28 40608: Format + number of values
4142 h 29,30 40609: Parameter value 12,15
6666 h 31,32 40610: Parameter value
Table 10-81 Start parameter request: Writing the parameter value of p1121 from device number 17

MBAP header
0007 h 10,11 Number of registers to be written to (40601 … 40610)
0010 h 12,13 Number of registers

Table 10-82 Response for successful write operation

MBAP header
0002 h 9,10 40601: DS47 Control = 2 (request was executed)
2F04 h 11,12 40602: Function code 2F h (47), response length 4 bytes
8002 h 13,14 40603: Request reference mirrored = 80 h,
response identifier = 2 (change parameter)
0101 h 15,16 40604: DO-ID = 1, number of parameters = 1
Table 10-83 Response for unsuccessful write operation - write request still not completed

MBAP header
0001 h 9,10 40601: DS47 Control = 1 (request is processed)
2F00 h 11,12 40602: Function code 2F h (47), response length 0 (error)
0004 h 13,14 40603: Error code: 0004 Response Not Ready (response has still not been
issued)
10.8.6 Communication sequence
Logical error
If the device detects a logical error within a request, it responds to the controller with an
"exception response". In the response, the device sets the highest bit in the function code to 1.
If the device receives, for example, an unsupported function code from the controller, the device
responds with an "exception response" with code 01 (illegal function code).
Table 10-84 Overview of exception codes
Exception Modbus name Note

code
01 Illegal function code An unknown (unsupported) function code was sent to the
device.
02 Illegal Data Address An invalid address was requested.
03 Illegal data value An invalid data value was detected.
04 Server failure The device has terminated during processing.
Process data monitoring time (setpoint timeout)

The "Setpoint timeout" only applies for access to process data (40100 ... 40109, 40110 ...
40119). The "Setpoint timeout" is not generated for parameter data (40300 … 40522).

Fieldbus interface:
In parameter p2040 you define the time for cyclic data exchange for process data.
Setting range 0 - 2000 s.
The time depends on the amount of data to be transferred and the control.
"Setpoint timeout" (F01910) is issued by the Modbus if p2040 is set to a value > 0 ms and no
process data is requested within this time period.
COMM BOARD:
In parameter p8840 you define the time for cyclic process data exchange.
Setting range 0 - 2000 s.
The time depends on the amount of data to be transferred and the control.
"Setpoint timeout" (F08501) is issued by the Modbus if p8840 is set to a value > 0 ms and no
process data is requested within this time period.
10.8.7 Messages and parameters
Faults and alarms (see DCM List Manual)
• F01910 Fieldbus: Setpoint timeout

• A01925 Modbus TCP connection interrupted
• F08501 PN/COMM BOARD: Setpoint timeout
• A08526 PN/COMM BOARD: No cyclic connection
• A08555 Modbus TCP commissioning fault
• p0978[0...n] List of drive objects

• p2030 Fieldbus interface protocol selection
• p2040 Fieldbus interface monitoring time:
• r2050[0...19] CO: IF1 PROFIdrive PZD receive word
• p2051[0...24] CI: IF1 PROFIdrive PZD send word
• r2053[0...24] IF1 PROFIdrive diagnostics PZD send word
• r2054 PROFIBUS status
• p8839[0...1] PZD interface hardware assignment
• p8840 COMM BOARD monitoring time
• r8850[0...19] CO: IF2 PZD receive word
• p8851[0...24] CI: IF2 PZD send word
• r8853[0...24] IF2 diagnostics PZD send
• r8854 COMM BOARD state

10.9 Serial interface with USS protocol
• p8920[0...239] PN Name of Station

• p8921[0...3] PN IP address
• p8922[0...3] PN default gateway
• p8923[0...3] PN Subnet Mask
• p8924 PN DHCP mode
• p8925 PN interfaces configuration
• p8940[0...239] CBE2x Name of Station
• p8941[0...3] CBE2x IP address
• p8942[0...3] CBE2x Default Gateway
• p8943[0...3] CBE2x Subnet Mask
• p8944 CBE2x DHCP mode
• p8945 CBE2x interfaces configuration
Specification
Developed by Siemens, the USS® protocol is a proprietary fieldbus which was already being used
in a variety of applications before PROFIBUS was established.
The USS® protocol is described in the following document:
USS® Protocol Specification: Order number E20125-D0001-S302-A1
Properties
The USS® protocol can only be used as a fieldbus instead of PROFIBUS; USS and PROFIBUS cannot
run at the same time.
The USS® protocol enables one or more SINAMICS DCMs to be connected to a master
station. It is a point-to-point coupling or a bus-type coupling. A maximum of 31 nodes can
be connected in the bus configuration (1 master and a maximum of 30 devices). The bus
terminator must be activated on both bus nodes at each end of the bus line.
The USS® protocol enables access to all relevant process data, diagnostic information, and
parameters for the SINAMICS DCM.
The USS® protocol is purely a master-device protocol in which a SINAMICS DCM can only
ever be a device. In this case, a SINAMICS DCM only sends a telegram to the master if it
has received a telegram from it. Therefore, SINAMICS DCMs cannot use the USS® protocol to
exchange data with one another directly.
Connecting
Terminal X178, X179

Function diagrams
The function diagrams for the fieldbus interface are relevant:
See FP2410, FP2420, FP2440, FP2442, FP2450, FP2452, FP2460, FP2470, FP2472, FP2481,
and FP2483.
Wiring example for a USS bus
0DVWHU 6ODYH 6ODYH 6ODYHQ Q

%XVWHUPLQDWRUDFWLYDWHG %XVWHUPLQDWRUGHDFWLYDWHG %XVWHUPLQDWRUGHDFWLYDWHG %XVWHUPLQDWRUDFWLYDWHG
6,0$7,&6 6,1$0,&6'&0 6,1$0,&6'&0 6,1$0,&6'&0

&3ZLWK56
PRGXOH

-XPSHU; ! 5[ 7[ 5[ 7[ 5[ 7[
ZLUHFDEOH
5[ 7[

;
;
; ; ;
˖
68%'
FRQQHFWRU
SLQ
1) The shields for the interface cables must be connected directly on the devices (using a clamp, for example) to device
or cabinet ground, with a low level of impedance.
2) Twisted cable, e.g. LIYCY 2×0.5 mm2; with longer cables, an equipotential bonding cable should be used to ensure that
the difference in ground potentials between the link partners remains below 7 V.
Figure 10-58 USS bus

10.10 Switch on, switch off, enable
10.10.1 Switch on/Switch off (ON/OFF1) - control word bit 0

The "Switch on/Shutdown" (ON/OFF1) function is controlled using the "ON/OFF1 switch-on
command" (= ANDing the signal from terminal X177.12 with the signal selected using p0840).
The following operating modes are possible here:

p50445 = 0: The "ON/OFF1 switch-on command" takes the form of ANDing the signal from
terminal X177.12 with the signal selected using p0840 (level-controlled, 0 =
shutdown, 1 = switch on).
p50445 = 1: Edge triggering of "ON/OFF1 switch-on command":
The switch-on command is saved when a 0 → 1 transition takes place (see
function diagram 3130 in the SINAMICS DCM List Manual). The binector selec‐
ted using p50444 must be in the log. "1" state at this point. The memory is reset
when this binector enters the log. "0" state.
Sequence of events for switching on the drive:

1. Apply the "Switch on" command (e.g. using the "Switch on/Shutdown" terminal).
2. The system exits operating state o7.
3. The "Line contactor closed" relay (terminal XR1-109 and -110) picks up.
4. The field-current reduction function stops
5. if "Operation enable" is applied:
– With positive brake-release time (p50087):
The "Release holding or operational brake" signal (r53210.0 = 0) is output and p50087 is
awaited in operating state o1.0.
– With negative brake-opening time (p50087 negative):
Go immediately to step 6; brake is still closed (r53210.0 = 1)
6. The ramp-function generator, n controller, and I controller are enabled.
7. Once a negative brake-release time (p50087) has elapsed, the "Release holding or
operational brake" (r53210.0 = 0) signal is output.
Procedure for shutting down the drive:

1. Apply the "Shutdown" command (e.g. using the "Switch on/Shutdown" terminal).
2. Deceleration along the ramp-function generator ramp
3. Wait until n < nmin (p50370, p50371).
4. The "Close holding or operational brake" (r53210.0 = 1) signal is output.
5. The brake-closing time (p50088) is awaited.
6. The ramp-function generator and n controller are disabled.
7. Reduction in armature current
8. The armature firing pulses are disabled.

9. The "Line contactor closed" relay (terminal XR1-109 and XR1-110) drops out.
10.Operating state o7.0 or higher is reached.
11.The wait time for field-current reduction (p50258) elapses.
12.The field is reduced to a parameterizable value (p50257).
"Switch on/Shutdown" overview
2Q
6ZLWFKRQ6KXWGRZQ 6KXWGRZQ
&RQWUROOHUIUHH
,QWHUQDOFRQWUROOHUHQDEOH &RQWUROOHUQRWIUHH
6HWSRLQWHQDEOHG
,QWHUQDOVHWSRLQWHQDEOH 6HWSRLQW
QQPLQ SS Q!QPLQ QQPLQ
S 6HWSRLQWUHDFKHG
6SHHGDFWXDOYDOXH 6HWSRLQWUHDFKHG
%UDNHFRQWUROVLJQDOU 2SHQEUDNH &ORVHEUDNH

+ROGLQJEUDNH
S S
LQWHUQDOVWDQGVWLOOILHOG 1RVWDQGVWLOOILHOG VWDQGVWLOOILHOG
VSHFLILFDWLRQ
p50087 Brake-release time (positive in this case)

p50088 Brake-closing time
p50258 Wait time for automatic field-current reduction
Figure 10-59 Switch on/Shutdown
• An internal interlock becomes active once n < nmin (r50370, r50371) for the first time. This
stops the drive from attempting to decelerate again if the motor is rotated by external
influences; the n < nmin message then disappears.
• Whether level triggering or edge triggering is selected has an overarching effect on "Switch
on", "Switch off", and "Creep".
Note
The "Creep' function is described in the "Creep (Page 545)" chapter.
• Selecting edge triggering causes "Switch on" and "Creep" to replace one another, i.e.:
– A "Switch on" edge at terminal X177.12 cancels a "Creep" function that had previously
been triggered.
– A "Creep" edge at a binector selected using p50440 cancels a "Switch on" function that
had previously been triggered.

• With edge triggering, an automatic restart following a brief interruption in the electronic
power supply voltage is not possible.
• To ensure that "Shutdown" functions even when rewiring is carried out, current or torque
lower limits are specified, or additional setpoints are supplied, certain functions are disabled
automatically when "Shutdown" is applied.
– All torque limits are disabled while braking to n < nmin.
– Of the current limits, only the system current limit (p50171 and p50172), speed-
dependent current limit, and current limit resulting from I2t monitoring of the power unit
are enabled.
10.10.2 OFF2 (disconnection) - control word bit 1

The OFF2 signal is LOW active (log. "0" state = disconnection).
Procedure for applying disconnection:

1. The ramp-function generator, n controller, and Ia controller are disabled.
3. The firing pulses are disabled.
4. "Close operational brake" is output (r53210.0 = 1, where p50080 = 2).
5. Operating state o10.0 or higher is reached.
6. The field current is maintained at a fixed point (i.e. there is no increase in the field current,
even on exiting the field-weakening range).
7. The "Line contactor closed" relay (terminal XR1-109 and XR1-110) drops out.
8. The drive coasts down (or is decelerated by the operational brake).
9. The parameterizable wait time (p50258) elapses.
11.Once n < nmin (p50370, p50371), the "Close holding brake" signal is output (r53210.0 = 1,
where p50080 = 1).
10.10.3 OFF3 (quick stop) - control word bit 2

The OFF3 signal is LOW active (log. "0" state = quick stop).
Procedure for applying "Quick stop":

1. The ramp-function generator is disabled.
2. A speed setpoint of zero is applied.
3. Deceleration along the down ramp acc. to p50296, p50297, p50298
4. Wait until n < nmin (p50370, p50371).
5. "Close operational or holding brake" (r53210.0 = 1) is output.

6. Wait for brake-closing time (p50088)

7. The ramp-function generator and speed controller are disabled.
10.The "Line contactor closed" relay (terminal XR1-109 and XR1-110) drops out.
11.Operating state o9.0 or higher is reached.
12.The wait time for field-current reduction (p50258) elapses.
Procedure for withdrawing "Quick stop":

1. Remove "Quick stop" command.
2. Apply the "Shutdown" command (e.g. using the "Switch on/Shutdown" terminal).
3. The system exits operating state o8.
Quick stop overview
6ZLWFKRQ6KXWGRZQ 2Q 6KXWGRZQ
1RTXLFNVWRS ([WHUQDOTXLFNVWRS
4XLFNVWRS
1RTXLFNVWRS
,QWHUQDOTXLFNVWRS LQWHUQDOTXLFNVWRS
&RQWUROOHUIUHH
,QWHUQDOFRQWUROOHUHQDEOH &RQWUROOHUQRWIUHH
6HWSRLQWHQDEOHG
,QWHUQDOVHWSRLQWHQDEOH 6HWSRLQW
QQPLQ SS Q!QPLQ QQPLQ
6HWSRLQWUHDFKHG
S
6SHHGDFWXDOYDOXH 6HWSRLQWUHDFKHG
%UDNHFRQWUROVLJQDOU 2SHQEUDNH &ORVHEUDNH

+ROGLQJEUDNH
S S
LQWHUQDOVWDQGVWLOOILHOG 1RVWDQGVWLOOILHOG VWDQGVWLOOILHOG
VSHFLILFDWLRQ
p50087 Brake-release time (positive in this case)

p50088 Brake-closing time
p50258 Wait time for automatic field-current reduction
Figure 10-60 OFF3 (quick stop)
• The "Quick stop" command only needs to be present as a short pulse (> 10 ms). It is then
saved internally. It is only possible to reset the memory by applying the "Shutdown"
command.
• The SINAMICS DCM logically combines all "Quick stop" commands in such a way that the
"Quick stop" function is only disabled once all commands are in the "No quick stop" state.

• An internal interlock becomes active once n < nmin (r50370, r50371) for the first time. This
stops the drive from attempting to decelerate again if the motor is rotated by external
influences; the n < nmin message then disappears.
• To ensure that "fast stopping" functions even when rewiring is carried out, current or torque
lower limits are specified, or additional setpoints are entered, certain functions are disabled
automatically when "fast stopping" is applied.
– All torque limits are disabled while braking to n < nmin.
– Of the current limits, only the system current limit (p50171 and p50172), speed-
dependent current limit, and current limit resulting from I2t monitoring of the power unit
are enabled.
10.10.4 Operation enable (enable) - control word bit 3

The enable signal is HIGH active (log. "1" state = enable).
Control word bit 3 and terminal X177.13 (enable) are logically ANDed. See also function
diagram 2580.
Procedure for applying operation enable (if a switch-on command is present):

1. With positive brake-release time (p50087):
The "Release holding or operational brake" signal (r53210.0 = 0) is output and p50087 is
awaited in operating state o1.0.
With negative brake-opening time (p50087 negative):
Go immediately to step 2; brake is still closed (r53210.0 = 1)
2. The ramp-function generator, n controller, and I controller are enabled.
3. Operating state o0 is reached.
4. Once a negative brake-release time (p50087) has elapsed, the "Release holding or
operational brake" (r53210.0 = 0) signal is output.
Procedure for withdrawing operation enable:

1. The ramp-function generator, n controller, and I controller are disabled.
4. The "Close operational brake" signal is output (r53210.0 = 1, where p50080 = 2).
7. Once n < nmin (p50370, p50371), the "Close holding brake" signal is output (r53210.0 = 1,
where p50080 = 1).

10.11 Safety shutdown (E-STOP)
10.11 Safety shutdown (E-STOP)
WARNING
The E-STOP function does not comply with the requirements relating to an Emergency Stop,
Emergency Off or STO function (functional safety)!
• Only use the E-STOP function corresponding to the subsequent description.
The E‑STOP function forces the "line contactor closed" relay to drop out, activating the relay
contact (terminals XR1-109 and -110) for the main contactor control within approximately
15 ms, independent of the semiconductor components and Control Unit (CUD) functions. If
the CUD is operating correctly, entering I = 0 via the closed-loop control means that the main
contactor is switched in a no-current condition. The drive coasts down once E‑STOP has been
entered.
The E-STOP function is triggered when the switch between terminals XS1-105 and ‑106 is
opened.
The E-STOP function causes the drive to enter the "Switching on inhibited" operating state.
This must be acknowledged by activating the "Shutdown" function, e.g. by opening terminal
X177.12.
Procedure for applying E-STOP:
1. The ramp-function generator, n controller, and I controller are disabled.
3. a) p51616 = 0: E-STOP acts like OFF2 (firing pulses are disabled as soon as I = 0).
b) p51616 = 1: E-STOP immediately stops firing pulses from being output (without waiting
for I = 0).
4. The "Close operational brake" signal is output (r53210.0 = 1, where p50080 = 2).
6. The field current is maintained at a fixed point (i.e. there is no increase in the field current,
even on exiting the field-weakening range).
7. The "Line contactor closed" relay (terminal XR1-109 and ‑110) drops out.
9. The wait time (to be set at p50258) elapses.
11.Once n < nmin (p50370, p50371), the "Close holding brake" signal is output (r53210.0 = 1,
for p50080 = 1).
Remark
15 ms after E‑STOP has been applied (even if point 7 in this procedure has not yet been
reached), the "Line contactor closed" relay (terminal XR1‑109 and XR1‑110) will always drop
out; this is triggered by the hardware.

10.12 Setpoint channel
10.12.1 Ramp-function generator
Table 10-85 Definitions
Ramp-up Acceleration from lower positive to higher positive speeds (e.g. 10 % to 90 %) or from lower
negative to higher negative speeds (e.g. ‑10 % to ‑90 %)
Return flow Deceleration from higher positive to lower positive speeds (e.g. 90 % to 10 %) or from higher
negative to lower negative speeds (e.g. ‑90 % to ‑10 %)
Transition from negative to E.g. from -10% to +50%:
positive speeds From -10% to 0 = ramp-down and
From 0 to +50% = ramp-up, and vice versa
Ramp-up time The amount of time the ramp-function generator requires, when initial rounding and final
rounding = 0 and an input variable jump from 0 to 100 % or 0 to -100 % is performed, for
passing through the 100 % range at the ramp-function generator output. For smaller jumps at
the input, the rise at the output is performed at the same rate.
Ramp-down time That time, that the ramp-junction generator requires for start- and final rounding = 0 for an
input variable jump from 100 % to 0 or from ‑100 % to 0 to run through 100 % at the ramp-
function generator output. For smaller jumps at the input, the rise at the output is performed
at the same rate.

Ramp-function generator mode of operation
U
U +/= 5/= 5/=

+/=

$5 (5
$5 (5 W
$5

U $5 (5 $5 $5 (5 $5 $5 $5
GYGW
W
GYGW U
① = Ramp-function generator setpoint ② = Ramp-function generator output

HLZ = Rampup time RLZ = Ramp-down time
AR = Initial rounding ER = Final rounding
1) Transition from ramp-down incline to ramp-up incline
2) Initial rounding makes the transition to final rounding even before the maximum ramp-down incline is reached.
3) Only the last part of final rounding is performed here due to the ramp-function generator setpoint jump.
Figure 10-61 Ramp-function generator mode of operation

Operating modes for ramp-function generator rounding
p50295 = 0:
When a setpoint reversal occurs during ramp-up (or ramp-down), the
ramp-up (or ramp-down) process is interrupted and initial rounding

for the ramp-down (or ramp-up) process starts immediately. This

does not mean any additional increase (or decrease) in the setpoint,
But rather a bend in the signal at the ramp-function generator output
(i.e. a jump in the acceleration).
p50295 = 1:
when a setpoint reversal occurs during ramp-up or ramp-down, the
ramp-up/ramp-down process slowly crosses over into ramping-down/
ramping-up. This results in an additional increase (or decrease) in the
setpoint, as well as a bend in the signal at the ramp-function gener‐
ator output (i.e. there is no jump in the acceleration).
Control signals
Table 10-86 Control signals for the ramp-function generator operating mode
Ramp-function generator enable 0 = Ramp-function generator disabled; ramp-function generator output set to 0
Control word bit 4, p01140[c] 1 = Ramp-function generator enabled
Ramp-function generator start 1 = Setpoint is switched into the ramp-function generator input
Control word bit 5, p01141[c] 0 = Ramp-function generator is stopped at the current value (ramp-function gen‐
erator output is switched in as ramp-function generator input)
Setpoint enable 1 = Setpoint enabled at ramp-function generator input
Control word bit 6, p01142[c] 0 = Switchover to ramp-function generator setting 1 performed and 0 applied to
the input (ramp-function generator output travels to 0)
Set ramp-function generator 1 = The ramp-function generator output is set to the setting value (selection via
(p50640[c]) p50639).
Ramp-function integrator operation See below and description of p50302 in the parameter list found in the SINAMICS
(p50302) DCM List Manual.
Enable switchover of the ramp-func‐ See below.
tion integrator (p50646)
Ramp-function generator settings 2 See below.
and 3
Ramp-function generator tracking ON See below and description of p50317 in the parameter list found in the SINAMICS
(p50317) DCM List Manual.
Set ramp-function generator on switch‐ See description of p50318 in the parameter list found in the SINAMICS DCM List
ing off (p50318) Manual.
Bypass ramp function generator 1 = The ramp-function generator operates with ramp-up time and ramp-down time
= 0.
The function is then controlled via the binector selected using p50641. It is also
possible to select the option of bypassing the ramp-function generator in operating
modes JOG, CREEP, and APPLY FIXED SETPOINT.

Ramp-function generator settings 1, 2, and 3

Selection via the binectors selected using p50637 and p50638.
The ramp-function generator settings that are entered via the binectors selected using
p50637 and p50638 have priority over the ramp-function generator setting entered by the
ramp-function integrator.
Binector state selected via param‐ Ramp-function Active ramp-up Active ramp- Active initial Active final
eters generator set‐ time down time rounding rounding
p50637 p50638 ting
0 0 1 p50303 p50304 p50305 p50306
1 0 2 p50307 p50308 p50309 p50310
0 1 3 p50311 p50312 p50313 p50314
1 1 Not permitted; fault F60041 (setting not unique) triggered
Ramp-function integrator
The ramp-function integrator is activated by setting p50302 to 1, 2, or 3. Once an "ON"
command ("Switch on", "Jog", "Creep") has been applied, ramp-function generator setting 1
(p50303 to p50306) is used until the ramp-function generator output reaches the required
setpoint for the first time.
Following this, the process is controlled by the "Enable switchover of ramp-function
integrator" signal (binector selected using p50646):
• Enable switchover of ramp-function integrator = 1:
If the ramp-function generator output reaches the required setpoint for the first time after
the "ON" command has been applied, the system automatically switches over to the ramp-
function generator setting selected according to p50302.
• Enable switchover of ramp-function integrator = 0:
Once the ramp-function generator output has reached the setpoint, ramp-function
generator setting 1 (p50303 to p50306) remains active until "Enable switchover of ramp-
function integrator" is switched to 1. The system then switches over to the ramp-function
generator setting selected according to p50302.
If the "Enable switchover of ramp-function integrator" signal is withdrawn (→ 0), the system
switches back to ramp-function generator setting 1 and, when the signal is applied again
(→1), remains at this setting until the ramp-function generator output has reached the
setpoint again. Following this, the system switches back over to the ramp-function generator
setting selected according to p50302.
When the "Switch off" command is applied, the drive is switched off via ramp-function
generator setting 1.
Note
Activating "Ramp-function generator setting 2" (p50307 to p50310; selection via p50637) or
"Ramp-function generator setting 3" (p50311 to p50314; selection via p50638) has priority over
the ramp-function generator setting requested by the "Ramp-function integrator" function.

Ramp-function-generator tracking
The ramp-function generator output (r52190) is limited to the following values when ramp-
function generator tracking is active:
(-Mlimitx 1.25 / Kp + nact) < HLG output < (+Mlimit x 1.25 / Kp + nact)
When p50170 = 1 (closed-loop torque control), the following applies:
(-IA.limit x ΦMotor x 1.25 / Kp + nact) < HLG output < (+IA.limit x ΦMotor x 1.25 / Kp +
nact)
When p50170 = 0 (closed-loop current control), the following applies:
(-IA.limit x 1.25 / Kp + nact) < HLG output < (+IA.limit x 1.25 / Kp + nact)
Φmotor Scaled motor flux (1 at rated excitation current)

nact Actual speed value (r52167)
+Mlimit Smallest positive torque limit (r52143)
-Mlimit Smallest negative torque limit (r52144)
+IA.limit Smallest positive current limit (r52131)
-IA.limit Smallest negative current limit (r52132)
Kp Active speed controller gain
If, however, the value added to nact would be less than 1 %, then +1 % or is ‑1 % is added.
The "Ramp-function generator tracking" function prevents the ramp-function generator value
from moving too far from the actual speed value if the torque or current limit has been
reached.
Note
When ramp-function generator tracking is active, the filtering time of the speed setpoint p50228
should be low (ideally = 0).
Limiting after ramp-function generator

This limiting stage can be used by freely selecting the input signal, independently from the ramp-
function generator.
A distinguishing feature of this type of limiting is that lower limiting can also be set to
positive values and upper limiting to negative values (see p50300 and p50301). In this case,
a limit set using this method acts as a lower limit (lower limiting value) for the output signal
of the ramp-function generator, with the sign inverted.
Example:
p50632.01 ... 04 = 1 (= 100.00%)
p50300 = 100.00 (%)
p50301 = 10.00 (%)
p50633.01-04 = 9 (= -100.00%)
results in the value range of r52170 being limited to between +10.00% and +100.00%.

Acceleration signal dv/dt (r52191)

This signal specifies the change in ramp-function generator output r52190 during the time set
in p50542.
Braking distance (r52047, r52048)

This signal specifies the distance that the drive would travel if, e.g. it would be stopped using an
OFF1 command.
This braking distance is calculated under the assumption that at the ramp-function generator
input, a speed setpoint of 0 would be input and the speed actual value would go down to 0
with the set ramp-down time and the set rounding-off.
The calculation of the braking distance is only then correct if the ramp-down time and
rounding elements do not change during the braking process.
The braking distance is output in the same unit as the encoder position actual value r0482.
This means that one encoder revolution corresponds to a value of p0400×2^p0418
The braking distance is available in two different data formats:
• r52047 has the Unsigned32 data type
• r52048 has the FloatingPoint32 data type
10.12.2 Jogging
See also function diagram 3125 in the SINAMICS DCM List Manual
The JOG function can be applied via the binectors selected using p50435 index .00 to .07,
and via control word bit 8 and bit 9 (r0898.8 & r0898.9) (see function diagram for logic
operation).
The "Jog" function can only be executed if "Switch off" and "Operation enable" have been
applied.
The "Jog" function is applied by one or more of the sources referred to (binectors, control
word bits) entering the log. "1" state. During this, each source is assigned a setpoint (to be
selected using p50436).
If two or more sources apply the "Jog" function at the same time, then 0 is applied as the jog
setpoint.
For each source (binector, control word bit) with which the "Jog" function can be applied,
p50437 may be used to determine whether the ramp-function generator is bypassed
(binector r53170.11). In this case, the ramp-function generator operates with ramp-up time
= 0 and ramp-down time = 0.
Procedure for applying jog:

If "Jog" is applied, the system is switched on and the jog setpoint applied via the ramp-
function generator. For this procedure, refer to the section titled "Switch on/Switch off (ON/
OFF1)".

Procedure for withdrawing jog:

Once the "Jog" function has been withdrawn, the procedure begins in the same way as the
"Switch off" function, as outlined in the section titled "Switch on/Switch off (ON/OFF1)". Once
n < nmin, the controller is disabled and, following a parameterizable time (p50085) of 0 to
60 s, the line contactor is opened (operating state o7.0 or higher). While the wait time that
can be parameterized using p50085 (max. 60.0 s.) is running, the drive remains in operating
state o1.3.
10.12.3 Creep
See also function diagram 3130 in the SINAMICS DCM Parameter Manual.
The "Creep" function can be activated in operating state o7 and the "Operation" state while
"Operation enable" applies.
"Creep" is applied by means of one or more of the binectors selected using p50440 entering
the log. "1" state. During this, each binector is assigned a setpoint (to be selected using
p50441). If "Creep" is applied by several binectors, their corresponding setpoints are added
together.
For each source (binector) with which the "Creep" function can be applied, p50442 may be
used to determine whether the ramp-function generator is bypassed (binector r53170.12). In
this case, the ramp-function generator operates with ramp-up time = 0 and ramp-down time
= 0.
Level/Edge
p50445 = 0: Level-controlled
Binector selected using p50440= 0: No creep
Binector selected using p50440= 1: Creep
p50445 = 1: Edge-triggered
The application of the "Creep" function is saved when the binector makes the 0
→ 1 transition. The binector selected using p50444 must be in the log. "1" state
at this point. The memory is reset when this binector enters the log. "0" state.
Procedure for applying creep:

If "Creep" is applied in operating state o7, the system is switched on and the creep setpoint is
applied via the ramp-function generator.
If "Creep" is applied in the "Operation" state, the drive uses the ramp-function generator to
travel from the operating speed to the creep setpoint.
Procedure for withdrawing creep:

• For "Creep" when the "Switch on" command is not present:
If all binectors that apply the "Creep" function enter the log. "0" state, the controller is
disabled and the line contactor is opened (operating state o7.0 or higher) after n < nmin.
• For "Creep" from the "Operation" state:
If all binectors that apply the "Creep" function enter the log. "0" state, and the conditions for
the "Operation" state are still present, the drive uses the ramp-function generator to travel
from the set creep speed to the operating speed.

10.13 Encoder evaluation
See also the section titled "Switch on/Switch off (ON/OFF1)" for information on edge
triggering, automatic restart, and the effect of current and torque limits when decelerating.
10.12.4 Fixed setpoint

See also function diagram 3115 in the SINAMICS DCM List Manual.
The “Fixed setpoint” function can be applied via the binectors selected using p50430 index
.00 to .07, and via p50680 and p50681 (see function diagram for logic operation).
"Fixed setpoint" is applied by one of more of the sources referred to (binectors) entering the
log. "1" state. During this, each source is assigned a setpoint (to be selected using p50431). If
"Fixed setpoint" is applied by several sources at the same time, their corresponding setpoints
are added together (limited to ±200%).
For each source with which "Fixed setpoint" can be applied, p50432 may be used to
determine whether the ramp-function generator is bypassed. In this case, the ramp-function
generator operates with ramp-up time = 0 and ramp-down time = 0.
Response when "Fixed setpoint" is applied:

The fixed setpoint is switched in instead of the r52211 setpoint.
Withdrawal of "Fixed setpoint":

If all possible sources for switching in the fixed setpoint are in the log. "0" state again, r52211
is switched through as a setpoint.

SINAMICS DCM can evaluate speed/position encoders.
Two encoders can be evaluated simultaneously. Encoder 1 is connected to connector X177
on the CUD. Encoder 2 is connected to an encoder module SMC10 or an encoder module
SMC30, which is connected via DRIVE-CLiQ with the CUD.
Encoder 1 is often referred to as the motor encoder as it is normally attached directly to the
motor.
Encoder 2 is often referred to as the load encoder as it is normally attached directly to the
load.
Table 10-87 Supported encoder types
Setting for p0400 Encoder type Encoder 1 Encoder 2

p0400[0] p0400[1]
0 No encoder ✓ ✓
1001 Resolver 1 speed x ✓
3001 1024 HTL A/B R ✓ ✓

Setting for p0400 Encoder type Encoder 1 Encoder 2

p0400[0] p0400[1]
3002 1024 TTL A/B R ✓ ✓
3003 2048 HTL A/B R ✓ ✓
3005 1024 HTL A/B ✓ ✓
3006 1024 TTL A/B ✓ ✓
3007 2048 HTL A/B ✓ ✓
3008 2048 TTL A/B ✓ ✓
3009 1024 HTL A/B unipolar ✓ ✓
3011 2048 HTL A/B unipolar ✓ ✓
3020 2048 TTL A/B R, with sense x ✓
3081 SSI, singleturn, 24 V x ✓
3082 SSI, multiturn 4096, 24 V x ✓
3088 1024, HTL, A/B, SSI, singleturn x ✓
3090 4096, HTL, A/B, SSI, singleturn x ✓
9999 User defined ✓ ✓
20000 Encoder from OEM list x ✓
✓ = encoder type is supported
x = encoder type is not supported, setting not permitted
The encoder evaluation determines the current actual speed value and the actual position
value for both encoders (see function diagrams 4704, 4710 and 4711 in the SINAMICS DCM
List Manual).
Furthermore, for both encoders the encoder control word and the encoder status word
according to PROFIdrive are available (see function diagrams 4720, 4730 and 4735 in the
SINAMICS DCM List Manual).
10.13.1 Actual speed values
The calculation of the actual speed value can be seen in the following function diagrams:
• FP4710 (for encoder 1)
• FP4711 (for encoder 2)
The actual speed values of the encoders are always available as freely interconnected BICO
outputs.
• r0061[0]: Actual speed value for encoder 1
• r0061[1] = r3370: Actual speed value for encoder 2
If you want to use an actual speed value from the encoder as an actual-value input for the
speed controller, you need to set the actual speed value selection p50083 to 1 (for encoder
1) or to 5 (for encoder 2). See FP6810.
The maximum speed (i.e. the 100% speed) is set via p2000 in both cases.

10.14 Speed controller
Actual position values
G1_XIST1 Encoder 1 actual position value 1

Gn_XIST2 Fault code
G2_XIST2) Encoder 2 actual position value 2
For description, refer to Chapter "Control and status words for encoders (Page 398)".
10.13.2 Control and status words for encoders
An encoder interface is defined in the PROFIBUS Profile for drive technology (PROFIdrive
V4.1). This interface defines a control and status word for encoders.
They are available in the following parameters:
• r0480[0] = G1_STW encoder 1 control word
• r0480[1] = G2_STW encoder 2 control word
• r0481[0] = G1_ZSW encoder 1 status word
• r0481[1] = G2_ZSW encoder 2 status word
The bit assignments of the control and status words for the encoders can be seen in the
following function diagrams:
• FP4720 (control word for encoders 1 and 2)
• FP4730 (status word for encoders 1 and 2)
For description, refer to Chapter "Control and status words for encoders (Page 398)".

The speed controller is a PI controller with the following additional properties:
Start pulse
When starting the speed controller (i.e. when the controller is enabled) the I component
can start with a selectable value. This is necessary for suspended/hanging loads in order to
prevent the load from briefly sagging.
Adaptation
P gain and integral action time can be changed as a function of any signal (e.g. from the
actual speed value).
Droop
Droop (which can be switched in) can be implemented by feeding back the I component to
the input. As a consequence, the controller does not precisely control to the setpoint, but
permits a continuous setpoint-actual value deviation.

This is required, for example, if two drives are mechanically coupled with one another
(e.g. for a production machine where drives are coupled through the material web being
processed). In this case, the droop prevents that the two drives start to operate against one
another, although both operate with closed-loop speed control. In the case that a mechanical
connection is interrupted (e.g. if the material web breaks), then the speed of the drive
operating with droop only slightly changes.
Lead/lag element
The lead/lag element is used to improve the stability of the speed control. If required, it can
be inserted in the actual speed value channel.
Remark: The functions shown in function diagram 6810 have the following execution
sequence:
• Generation of the speed setpoint (r52174)
• Selection of the actual speed value (r52167)
• PT1 element (r52179)
• Bandstop filter 1 (r52177)
• Bandstop filter 2 (r52178)
• DT1 element (r52169)
• Lead/lag element (r52156)
• Generation of the setpoint/actual-value difference (r52165)
Reference model
The reference model represents the P-controlled speed control loop and creates an
appropriately processed speed setpoint for the I-component. This means that the I-
component largely plays no role for setpoint changes, with the consequent improved,
overshoot-free response.
The reference model contains a PT2 element and a dead time element to emulate the
controlled system. See function charts 6810 and 6815.
Further, it is possible to feed in an external reference model (e.g. generated using DDC
function diagrams).
The reference model is set using the following parameters:
p50237 natural frequency
p50238 damping
p50239 deadtime
p50240 activation
The reference model is correctly set when the characteristics of the reference model output
(r52154) and the actual speed value (r52167) are virtually identical when the I-component
of the speed controller (p50224 = 0) is disabled.
Example
The following diagram shows the step response of the speed controller after carrying out the
optimization run, if the reference model is not activated.
r52174 Speed setpoint

r52167 Actual speed value

The following diagram shows the setting of the reference model.
r52154 Reference model output

The following diagram shows the step response of the speed controller if the same controller
parameters are set as shown previously, however, with the reference model activated.
r52174 Speed setpoint


10.15 Adaptation of the armature and field current controller
Note
For the procedure to manually optimize the speed controller, see Chapter "Manual optimization
(Page 315)".
Using the speed controller for other applications

If the SINAMICS DCM is not used to control the speed of a motor, but instead to control
the voltage of a capacitive load, it may be advantageous to support the speed controller
operating as voltage controller with a load connection. The "Load connection" function block
is available for this purpose. This function block is shown in function diagram 6851. It
provides an additional current setpoint that is preferably fed in at p50601[3] (see function
diagram 6840).

The current controller (armature current controller and field current controller) of the SINAMICS
DCM operate with a controlled system that is very non-linear.

Types of non-linearity
There are 2 types of non-linearity:
1. Non-linearity of the gating unit
In the armature circuit, there is a significant difference in the controlled system gain (= line-
commutated thyristor converter in the B6 bridge connection) between discontinuous and
continuous current.
,D
'LVFRQWLQXRXV &RQWLQXRXV
4XDOLWDWLYHFKDUDFWHULVWLF
RSHUDWLRQ
RIWKHORRSJDLQ
FXUUHQW
,D I DOSKD
YDOLGIRU(0)
RSHUDWLRQ
FXUUHQW
DOSKD
r r r
In the field circuit, the system is essentially always in the discontinuous current range, but the
control characteristic of the B2Z or B2 bridge manifests a significant degree of non-linearity.
,I
4XDOLWDWLYHFKDUDFWHULVWLF
RIWKH
ORRSJDLQ
,I I DOSKD
DOSKD
r r r
2. Non-linearity of the load inductance (= armature circuit or field circuit of the motor):
At higher currents, both the armature winding as well as the field winding - or also when
there is a smoothing reactor available in the armature circuit, can go into the magnetic
saturation range; as a consequence, they can have a significantly lower inductance than at
low currents.
The inductance as a function of the current is modelled according to the following diagram:

/L
/
/ L
/ L
/ ,B027
L L 5DWHGPRWRUFXUUHQW L
Inductance at a very low current:

L(0) = p50111 (La) or p50116 (Lf)
Inductance at the rated motor current:
L(I_Mot) = p50111×p51591 (La×λa) or p50116×p51597 (Lf×λf)
Effect of the adaptation

The SINAMICS DCM converter provides the option of adapting the gain of the armature
current controller or the field current controller to the existing non-linearities:
• Compensating gating unit non-linearities:
The controller gain is normally set so that in the range of the largest controlled system gain
(i.e. where the armature is in the discontinuous current range or for the field, with a firing
angle of 90°) the required control behavior is obtained. For other currents, the current
controller becomes appropriately slower. When the current controller adaptation is
activated, the current controller gain is increased inversely proportional to the controlled
system gain. As a consequence, the controller behavior is approximately the same at any
current.
• Compensating non-linear inductances
The controller gain is normally set so that at a high current, the required control behavior is
obtained. At low currents, the current controller becomes appropriately slower. When the
current controller adaptation is activated, the current controller gain is increased
proportionally to the inductance. As a consequence, the controller behavior is approximately
the same at any current.
Activating the controller adaptation

The current controller adaptation is not activated in the factory setting.
Reason:
When the adaptation is set, this means that the control behavior must be precisely checked
at various currents. In many applications, the improved control behavior that can be thus
achieved isn't necessary anyway. This is why in these cases it doesn't make any sense to
"invest" this time when commissioning the system.
Setting the armature current controller adaptation

With the armature current controller, it is possible to calculate the adaptation using p50570
from the actual value or from the setpoint of the armature current. The adaptation
to non-linear inductances can be activated using p50571, the discontinuous-continuous
current adaptation can be activated using p50572. The adaptation factor can be limited

10.16 Technology controller
using p50573. In order to be able to incorporate the adaptation at the armature current
controller, connector output r52350 must be interconnected to connector input p50175
(Kp adaptation). With this intervention, the armature current controller gain is increased or
decreased depending on the armature current actual value and/or setpoint (this is selected
using p50570). The calculations of the adaptations are now created to change the gain.
Setting the field current controller adaptation

For the field current controller, it is possible to calculate the adaptation from the actual
value or from the setpoint of the field current using p50575. The adaptation to non-linear
inductances can be activated using p50576; the adaptation to the non-linearity of the gating
unit, can be activated using p50577. The adaptation factor can be limited using p50578.
In order to be able to incorporate the adaptation at the field current controller, connector
output r52355 must be interconnected to connector input p50267 (Kp adaptation). With this
intervention, the field current controller gain is increased or decreased depending on the field
current actual value and/or setpoint (this is selected using p50575). The calculations of the
adaptations are now created to change the gain.
The corresponding function diagrams show additional details regarding how to activate the
gain adaptation and the various setting options:
FP 6853 Calculating the adaptation factor for the armature current controller gain
FP 6855 Intervention to adapt the armature current controller gain
(p50175 = r52350 establishes the intervention)
FP 6908 Calculating the adaptation factor for the armature current controller gain inter‐
vention to adapt the armature current controller gain
(p50267 = r52355 establishes the intervention)
Features
Simple control functions can be implemented with the technology controller, e.g.:
• Level control
• Temperature control
• Dancer role position control
• Pressure control
• Flow control
• Simple control without higher-level controller
• Tension control
The technology controller features:
• Two scalable setpoints
• Scalable output signal

• The output limits can be activated and deactivated via the ramp-function generator.
• The D component can be switched into the control deviation or actual value channel.
Description
The technology controller is designed as a PID controller, whereby the differentiator can be
switched to the control deviation channel or the actual value channel (factory setting). The P, I,
and D components can be set separately. A value of 0 deactivates the corresponding
component. Setpoints can be specified via two connector inputs. The setpoints can be scaled via
parameters (p2255 and p2256). A ramp-function generator in the setpoint channel can be used
to set the setpoint ramp-up/ramp-down time via parameters p2257 and p2258. The setpoint
and actual value channel each have a smoothing element. The smoothing time can be set via
parameters p2261 and p2265.
Pre-control can be integrated via a connector input.
The output can be scaled via parameter p2295 and the control direction reversed. It can be
limited via parameters p2291 and p2292 and interconnected as required via a connector
output (r2294).
The actual value can be fed in, for example, via an analog input.
If a PID controller has to be used for control reasons, the D component is switched to the
setpoint / actual value difference (p2263 = 1) unlike in the factory setting. This is always
necessary when the D component is to be effective, even if the reference variable changes.
The D component is only activated if p2274 > 0.
Commissioning with STARTER

The "technology controller" function module can be activated via the commissioning wizard or
the drive configuration (configure DDS).
You can check the actual configuration in parameter r0108.16.
Application example: Level control

The objective here is to maintain a constant level in the container.
This is carried out by means of a variable-speed pump in conjunction with a sensor for
measuring the level.
The level is determined via an analog input and sent to the technology controller. The level
setpoint is defined in a fixed setpoint. The resulting controlled variable is used as the setpoint
for the speed controller.

6HQVRU
;DFW
Figure 10-62 Level control: Application
7HFBFWUO.S 7HFBFWUO7Q
S S
;6HW 5DPSIXQFWLRQJHQHUDWRU
QBVHW
7HFBFWUO S
VHWSRLQW

S 7HFBFWUOW\S
S
;$FWXDO G
GW
$FWXDOYDOXH

S
Figure 10-63 Level control: Controller structure
Table 10-88 Important parameters for the level control
Parameter Designation Example

p50625 n_set after the ramp-function generator p50625= r2294 Tec_ctrl outp_sig
p2200 BI: Technology controller enable p2200 = 1 Technology controller enabled
p2253 CI: Technology controller setpoint 1 p2253 = r52401 fixed value
p2263 Technology controller type p2263 = 1 D component in fault signal
p2264 CI: Technology controller actual value p2264 = r52015 analog input AI1 of the CUD
(XACTUAL)
p2280 Technology controller p-gain p2280 Determine by optimization
p2285 Technology controller integral action time p2285 Determine by optimization
Function diagrams (see SINAMICS DCM List Manual)

• 7958 Closed-loop control (r0108.16 = 1)

10.17 Switch-on command for holding or operational brake

• p2200 BI: Technology controller enable
• p2253[0...n] CI: Technology controller setpoint 1
• p2254[0...n] CI: Technology controller setpoint 2
• p2255 Technology controller setpoint 1 scaling
• p2256 Technology controller setpoint 2 scaling
• p2257 Technology controller ramp-up time
• p2258 Technology controller ramp-down time
• p2261 Technology controller setpoint filter time constant
• p2263 Technology controller type
• p2264[0...n] CI: Technology controller actual value
• p2265 Technology controller actual value filter time constant
• p2280 Technology controller proportional gain
• p2285 Technology controller integral action time
• p2289[0...n] CI: Technology controller pre-control signal
• p2295 Technology controller output scaling

See also the SINAMICS DCM List Manual, function diagram 2750
The signal for controlling the brake is available at binector r53210[0]:
r53210[0] = 1 ⇒ close brake
r53210[0] = 0 ⇒ release brake
This binector must be wired to a digital output in order to activate a brake; see function
diagrams 2055, 2060, and 2065 in the SINAMICS DCM List Manual.
The following parameters affect the function of the brake-control signal:
p50080 = 0 No brake
p50080 = 1 The brake is a holding brake:
The "Close brake" command is only applied when n < nmin (p50370, p50371).
p50080 = 2 The brake is an operational brake:
The "Close brake" command is applied even if the motor is running.
p50087 Brake-release time:
• A positive value prevents the motor from working against a brake that is
currently being opened
• A negative value causes the motor to work against a brake that is still closed
in order to prevent a short-term torque-free state.

p50088 Brake-closing time:

Causes the motor to keep applying torque while the brake is closing
p50319 Delay time for ramp-function generator enable:
Following a controller enable, the setpoint 0 is applied during the time set here.
This time should be set so that the brake has actually been released once it has
elapsed. This is mainly necessary when p50087 is set to a negative value.
The figures below illustrate the brake control timing interval when a level change occurs at
the "Switch on/Shutdown" (terminal X177.12) and "Operation enable" (terminal X177.13)
inputs.
Where brake control is concerned, the "Jog", "Creep", or "Quick stop" input commands
act in the same way as "Switch on/Switch off", and the "Disconnection" or "E-STOP" input
commands act in the same way as when the "Operation enable" command is withdrawn.
The "Close brake" command is output during the optimization run for precontrol and current
controller (p50051 = 23, 24 and 25).
Brake-release time (p50087) positive
2SHUDWLQJHQDEOH HQDEOH LQKLELW

7HUPLQDO;
21
6ZLWFKRQ6KXWGRZQ
7HUPLQDO; 2))
S S
,QWHUQDOFRQWUROOHUHQDEOH
QQPLQ S
SS
U>@
6SHHGVHWSRLQW
6SHHGDFWXDOYDOXH
S ! S

2SHUDWLQJVWDWH R RRR
R R RRR R R
!
! !
%UDNHFRQWUROVLJQDO
U>@
RSHQ FORVH
W
Figure 10-64 Operational brake (p50080 = 2), brake-release time (p50087) positive

2SHUDWLQJHQDEOH HQDEOH LQKLELW

7HUPLQDO;
6ZLWFKRQ6KXWGRZQ 21
7HUPLQDO; 2))
S
S
QQPLQ
SS
U>@
6SHHGVHWSRLQW
6SHHGDFWXDOYDOXH !
S
2SHUDWLQJVWDWH R R RRR R RRR R
!
!
%UDNHFRQWUROVLJQDO RSHQ FORVH
U>@
W
Footnotes for the two figures above

<1> Mechanical deceleration of drive by means of operational brake
<2> Drive coasting down; "Close holding brake" first applied when n < nmin
<3> Time for brake to be released before motor applies torque (p50087 positive)
<5> Time for brake to be closed, during which motor continues to apply torque (p50088)
Figure 10-65 Holding brake (p50080 = 1), brake-release time (p50087) positive
Brake-release time (p50087) negative
HQDEOH LQKLELW
2SHUDWLQJHQDEOH
7HUPLQDO;
6ZLWFKRQ6KXWGRZQ 21
7HUPLQDO; 2))
QQPLQ S
SS
U>@
6SHHGVHWSRLQW
6SHHGDFWXDOYDOXH
S ! S
2SHUDWLQJVWDWH R RRR R RRR R

! ! !
S S
%UDNHFRQWUROVLJQDO
U>@
RSHQ FORVH W
Figure 10-66 Operational brake (p50080 = 2), brake-release time (p50087) negative

10.18 Switching on auxiliary circuits
HQDEOH LQKLELW
2SHUDWLQJHQDEOH
7HUPLQDO;
21
6ZLWFKRQ6KXWGRZQ
7HUPLQDO; 2))
QQPLQ S
SS
U>@
6SHHGVHWSRLQW
6SHHGDFWXDOYDOXH !
S
2SHUDWLQJVWDWH R RRR R RRR R

!
!
%UDNHFRQWUROVLJQDO
RSHQ FORVH
U>@
S W
Footnotes for the two figures above

<1> Mechanical deceleration of drive by means of operational brake
<2> Drive coasting down; "Close holding brake" first applied when n < nmin
<4> Here, motor works against the brake, which is still closed (p50087 negative)
<5> Time for brake to be closed, during which motor continues to apply torque (p50088)
Figure 10-67 Holding brake (p50080 = 1), brake-release time (p50087) negative
10.18 Switching on auxiliary circuits

This function serves as a switch on command for auxiliaries (e.g. motor fans).
The "Switch on auxiliary circuits" signal is available at binector r53210.2:
r53210[2] = 0 ⇒ auxiliaries OFF
r53210[2] = 1 ⇒ auxiliaries ON
This binector must be wired to a digital output in order to activate the auxiliary circuit; See
SINAMICS DCM List Manual, function diagrams 2055, 2060 and 2065.
The "Switch on auxiliaries" goes to 1 at the same time as the "Switch on" command.
Following this, the system remains in operating state o6.0 for a parameterizable time
(p50093); only once this has elapsed is the line contactor closed.
When the "Switch off" command is applied, the firing pulses are disabled and the line
contactor drops out after n < nmin. After a parameterizable time (p50094), the "Switch on
auxiliaries" signal goes to 0 If, however, the "Switch on" command is issued again before this
time elapses, operating state o6.0 is not retained; instead, the line contactor is immediately
closed.

10.19 Operating hours counter, unit fan
10.19 Operating hours counter, unit fan

A fan for the power unit can be controlled via r53135[0]. The isolated relay output terminal
120/121 is available to control the fan.
Operating hours counter

Every unit fan has an operating hours counter. The counter states are displayed at parameter
r50960[0..4].
r50960[0..3] Operating hours counter for the fans connected at the internal unit connectors
XV1 to XV4
r50960[4] For SINAMICS DCM Control Modules, operating hours counter for the fan con‐
trolled via r53135[0].
The operating hours counter is incremented, if
• SINAMICS DCM switches-on the corresponding fan AND
• it actually rotates
i.e. the speed is higher than 5 % of the response threshold of the fan monitoring (this does
not apply to r50960[4])
The operating hours counters for unit fans that are not available are not incremented.
Monitoring the fan lifetime

The planned lifetime for each fan is set at p50961[0...4]; the factory setting is 30000 hours.
Alarm A60165 is output 500 hours before the planned lifetime is reached. It is recommended
that the corresponding fan is replaced at the next opportunity when the system is not
operational (scheduled downtime).
If the lifetime for a fan is set to zero (p50961[0...4] = 0.0 hours), then the fan lifetime
monitoring for this fan is disabled.
The corresponding operating hours counter is reset to 0 by setting parameter p50962[0...4]
to 1. This should be done each time that a fan is replaced!
See also the SINAMICS DCM List Manual, function diagram 8045.

10.20 Thermal overload protection for the DC motor (I2t monitoring of the motor)
10.20 Thermal overload protection for the DC motor (I2t monitoring of

the motor)
I2t monitoring protects the motor against impermissible loads.
NOTICE
No full motor protection
I2t monitoring only provides an approximate representation of the motor's thermal image.
In the factory setting, when switching off the drive, the calculated temperature is saved in a
non-volatile fashion; when the drive is switched on again, the saved value is taken into account
when continuing to calculate the temperature.
This response can be adapted using p50140.
When p50114 = 0, I2t monitoring is disabled.
Note
• Please observe the manufacturer's specifications if you are using other motor types.
• If you are using DC motors 1G.5/1H.5 as per Catalog DA12, p50113 must be set to 1.00.
Note
The I2t monitoring model calculates the temperature of the DC motor based on constant
ventilation conditions. Axial fans mounted on the main axis are not common in the application
of DC drives; therefore, they are not covered by the I2t monitoring model for DCM.
Adaptation
Table 10-89 Parameter settings for I2t monitoring
Parameter Data
p50114 Thermal time constant Time constant [s] with which I2t monitoring is to operate
p50100 Rated armature current Determination of permissible continuous current for motor:
p50113 Continuous-current factor Permissible continuous current = p50100 × p50113
p50140 Motor I2t monitoring, response Sets the response when starting for the motor I2t monitoring:
when starting 2: start I2t at zero
12: start I2t with the saved value (factory setting)
Advance-alarm characteristic/Shutdown characteristic

If, for example, the motor load is continuously at approximately 125% of the permissible
continuous current for the motor, alarm A60037 responds after a time constant (p50114) has
elapsed. If there is no reduction in the load, the drive is shut down when the shutdown
characteristic is reached, and error message F60137 is displayed.
Advance-alarm/shutdown times for other loads may be taken from the diagram below.

Alarm and fault initiation from the motor I2t monitoring

The diagrams below show the time after which an alarm or fault is triggered when a new,
constant load is suddenly switched in following an extended period of preloading (> 5×T_th).
T_th = p50114 (motor thermal time constant)
0%
4,5 20%
40%
4 60%
\ 80%
3,5
2,5
2
1,5

0,5
0
0 0,5 1 1,5 2 2,5 3
[
y ... Load current/permissible continuous current (p50100 × p50113)

x ... time/thermal time constant of motor
Figure 10-68 I2t monitoring of the motor: Alarm triggering

\ 5
0%
4,5 20%
40%
4 60%
80%
3,5
2,5

2
1,5
0,5
0
0 0 ,5 1 1 ,5 2 2,5 3
[
y ... Load current/permissible continuous current (p50100 × p50113)

x ... time/thermal time constant of motor
Figure 10-69 I2t monitoring of the motor: Fault triggering
Determining the thermal equivalent time constant (p50114)

It should be noted that the thermal equivalent time constant depends on the maximum
overcurrent.
Thermal equivalent time constant of DC motors 1G . 5/1H . 5 according to Catalog DA12 T
(configuring notes for Catalog DA 12):

10.21 Measuring the motor temperature

\ PLQ

[
y ... Ttherm, thermal equivalent time constant [min] (p50114)

x ... I/IN [%]
I = Maximum overcurrent at which the motor is operated
IN = Rated armature current for the motor (p50100)
Figure 10-70 Thermal equivalent time constant

SINAMICS DCM provides the possibility of evaluating a temperature sensor integrated in the
motor (see the SINAMICS DCM List Manual, function diagram 8030).
WARNING
Electric shock in the event of voltage flashovers at the temperature sensor
Voltage flashovers in the signal electronics can occur for motors without safe electrical
• Use temperature sensors that comply with the specifications relating to safe electrical
separation.

The following measuring sensors can be evaluated.

• KTY84
approx. 350 Ω up to approx. 2600 Ω at -40 °C to +300 °C
positive temperature coefficient, almost a linear characteristic

r&

Ω
Figure 10-71 Characteristic KTY84
• PTC thermistor acc. to DIN 44081 / 44082

600 Ω, 1200 Ω, 1330 Ω or 2660 Ω response temperature
positive temperature coefficient, the resistance changes suddenly at the response
temperature
Note:
It is not possible to determine the actual temperature, it is only possible to identify as to
whether the response temperature has been exceeded or not.
• PT100

10.22 Speed-dependent current limiting
• PT1000
• NTC thermistor K227/S1/1.8 kΩ/KER
approx. 200 Ω at 190 °C to 1.8 kΩ at 100 °C

r&

Ω
Figure 10-72 Characteristic K227

Speed-dependent current limiting protects the DC motor's commutator and brushes at high
speeds.
The settings required for this (p50104 to p50107) must be taken from the motor rating plate.
Additionally, the maximum operating speed of the motor (p50108) must be entered; this
must match the actual maximum operating speed.
The actual maximum operating speed is determined as follows:
• Using p2000 in cases where the actual speed value comes from an incremental encoder
• Using p50741 in cases where the actual speed value comes from an analog tachometer
• Using p50115 in the case of operation without a tachometer
In addition, speed-dependent current limiting must be activated by setting p50109 = 1.
NOTICE
Excessive stress on the commutator and brushes due to incorrect setting
Making an incorrect setting for speed-dependent current limiting can lead to excessive stress
on the commutator and brushes, which in turn results in a significantly reduced service life for
the brushes.

Setting speed-dependent current limiting for motors with a bend in the commutation
characteristic
5DWHG'&FXUUHQWRIWKHXQLW
,$ 3 $SSOLFDWLRQSRLQW
&XUUHQWOLPLW
aQ FRPPXWDWLRQ
, OLPLWFXUYH
,
,
,1 ,
,1 6 ,
31
6 ,
3
Q1 Q Q Q
Q( QPRWRU
☐ Motor rating plate data Q Maximum operating speed

● Permissible limit values I10 1.4 x I1
nE Point where the speed-dependent cur‐ I20 1.2 x I2
rent limiting takes effect
Figure 10-73 Setting speed-dependent current limiting for motors with a bend in the commutation
characteristic
The current limiting curve is determined using n1, I10, n2, and I20.
Parameter:
p50104 = n1
p50105 = I1 (unit calculates I10 from this)
p50106 = n2
p50107 = I2 (unit calculates I20 from this)
p50108 = n3 (defines the speed scaling)
p50109 = 0 ... speed-dependent current limiting switched off
= 1 ... speed-dependent current limiting switched on
6+817027 ****+8=
15((1
9Q0,1 Q,$,.:

5(*
(559$7+<5%&/9 0+9+=
6(3,3,0%
,&/)
=$*..
6(39(17,/
Figure 10-74 Example of a motor rating plate

10.23 Thyristor blocking voltage calculation
Setting speed-dependent current limiting for motors without a bend in the commutation
characteristic
5DWHG'&FXUUHQWRIWKHXQLW
,$ 3 $SSOLFDWLRQSRLQW
&XUUHQWOLPLW
aQ FRPPXWDWLRQ
OLPLWFXUYH
,
,
,
,1 , ,
,1 6
31 3
6
Q1 Q( Q Q Q
QPRWRU
☐ Motor rating plate data Q Maximum operating speed

● Permissible limit values I20 1.2 x I2
nE Point where the speed-dependent cur‐
rent limiting takes effect
Figure 10-75 Setting speed-dependent current limiting for motors without a bend in the
commutation characteristic
6+817027 **)++8=
15((1
9Q Q0,1$.:

5(*, ,
(559$7+<5%&/9 0+9+=
6(3,3,0%
,&/)
=$*..
6(39(17,/
Figure 10-76 Example of a motor rating plate

The SINAMICS DCM converter offers the possibility of continually determining the voltage
available at each individual thyristor of the armature converter. The voltage is used to identify
which armature thyristors are presently conducting and which are presently blocked.
This information is available via BICOs (see function diagram 6950).

This information is used for the following functions as input variable:

• Converter commutation fault detection and initiation of the CCP
The thyristor that is relinquishing the current must assume the blocking voltage, otherwise,
commutation was unsuccessful.
• Torque direction changeover (sequential logic module)
Before a thyristor of the new torque direction is triggered, all thyristors associated with the
old torque direction must be blocked. The condition is evaluated in addition to the Ia=0
message.
The voltage at the armature thyristors is determined from the following measured values:
• Two phase-to-phase line supply voltages (UV, VW)
• Voltage at a thyristor (for 4Q: Anti-parallel thyristor pair) (X13/X26)
• DC voltage (Va)
Selecting the thyristor blocking voltage calculation using p50166

This parameter is only evaluated once during power up, i.e. a change only takes effect after a
restart or power up with saved parameters (p0976 = 11).
The thyristor blocking voltage calculation is only really required in just a few applications
and requires approx. 5% processor utilization; this is the reason that it is deactivated in the
factory setting.
p50166 = 0 Thyristor blocking voltage monitoring not active (factory setting)

= 1 Thyristor blocking voltage monitoring active
Activation is recommended if a motor is not connected to the armature converter, but rather a
very large inductance.
Note
The thyristor blocking voltage calculation function is available as product version 5 of the
"Voltage measurement" module. You can find this information on the bar code label of the
module.
Note
The thyristor blocking voltage calculation only functions for the armature voltage measurement
via the "Voltage measurement" module.
If the thyristor blocking voltage calculation is activated with p50166 = 1 when the hardware
version of the power interface is not suitable, fault message F60058 with fault value
r0949[0] = 6 appears after the next power-up with the saved parameters.

10.25 Operation on a single-phase line supply
10.24 Automatic restart

"Automatic restart" means:
For brief line supply disturbances (e.g. line supply dips), SINAMICS DCM does not immediately
go into the "FAULT" operating state, but inhibits the armature firing pulses, and once the line
supply returns, automatically enables them again.
"Brief" refers to a time that is: shorter than the time set at p50086 (= hot restart time)
During the brief pulse inhibit period, which is initiated when faults occur in the line supply,
the SINAMICS DCM waits in operating state o4.0 (for line system faults in the armature
circuit) or o5.1 (for line system faults in the field circuit).
If the network does not return to normal during the hot restart time, the relevant fault is
triggered as soon as it elapses.
The following faults relate to the "Automatic restart" function:
F60004 Armature circuit phase failure (1U1, 1V1, 1W1)

F60005 Field circuit phase failure (3U1, 3W1)
F60006 Undervoltage (armature circuit or field circuit)
F60007 Overvoltage (armature current or field current)
F60008 Line frequency too low (armature current or field current)
F60009 Line frequency too high (armature current or field current)
Note
There is no automatic restart when the electronics power supply fails.

SINAMICS DCM converters can also be operated on single-phase line supplies.
Fields of application for this operating mode include:
• Replacement of older single-phase converters employing analog technology
• Plants and systems where there is no 3-phase line supply
• Presenting and demonstrating SINAMICS DCM in seminar hotels and demonstration rooms
where generally there is no three-phase line supply
Note
For single-phase operation, dynamic overload of the devices is not possible. The I2t monitoring
must be deactivated (p50075=0). If the I2t monitoring is activated, for single-phase operation,
fault 60058 is output with fault value 4.

Connection
8 9 :
Figure 10-77 Connection to a single-phase line supply
The converter is connected to the line supply (one phase and the neutral conductor, e.g.
230 V or two phase conductors of a three-phase line supply, e.g. 400 V) via terminals 1U1
and 1V1. Connection 1W1 remains free.
It is mandatory that a single-phase line reactor or a transformer with 4% uk is provided, which
only supplies the DC converter involved.
Commutating reactor and transformer should be selected according to the rated motor
current of the armature circuit.
In this B2 circuit, the line current is equal to the DC current in the armature circuit. All of the
other line-side drive components should be dimensioned according to this. Further, due to
the higher current ripple when compared to six-pulse operation, a smoothing reactor must
be provided in the DC circuit. Please contact the motor manufacturer when dimensioning the
smoothing reactor.
Parameterization
Selecting operation on a single-phase line supply with p51799 = 1
The high current ripple in this mode causes ripple in the actual speed. For smooth speed
control, it is recommended to set the actual speed smoothing to approx. 10 ms (p50200 =
10 ms)
Derating
When selecting operation on a single-phase line supply, the rated DC current (r50072[1]) is
automatically reduced to 67% of the value for 3-phase operation. The reason for this is the
uneven distribution of the current in the thyristors in the power unit of the drive converter.
As a consequence, the rated output voltage is also reduced. See also Chapter "Technical data
(Page 43)".

10.26 Connecting units in parallel and in series
Topology overview
Several SINAMICS DCM converters can be arranged in various topologies. The following
topologies are supported:
• 6-pulse parallel connection
This topology is used in order to realize converter power ratings that are above the highest
available SINAMICS DCM rating.
• 12-pulse parallel connection
This topology is especially used at higher power ratings to achieve lower line harmonics. In
addition, by using this circuit, a lower DC current ripple is obtained when compared to a 6-
pulse connection. One or several 6-pulse converters can be connected in parallel to each of
the two 12-pulse converters connected in parallel.
• 6-pulse series connection
This topology is used to achieve a higher no-load DC voltage.
The following versions are available:
– Both converters are operated with the same firing angle.
– Sequence control (one of the two converters is always at a control limit, the other
converter controls the armature current)
– Series connection of a controlled converter with an uncontrolled converter (thyristor
bridge B6 + diode rectifier)
One or several converters can be connected in parallel to each of the converters connected
in series to increase the power rating.
• 12-pulse series connection
The topology corresponds to a 6-pulse series connection. In addition, a lower DC current
ripple is obtained when compared to a 6-pulse connection. One or several converters can be
connected in parallel to each of the converters connected in series to increase the power
rating.
Note
• All of the topologies listed here are only permissible in the restricted line frequency range
from 20 Hz to 65 Hz.
• For all of the topologies listed here, only power units with the same rated DC current, the
same commutating reactors, and the same wiring/busbars may be used!
• For all of the topologies listed here, only units with the same firmware version may be used.
Note
More information about design is given in the associated application notes (see link "Preface
(Page 3)").

Communication
Note
Before activating the parallel interface (i.e. before setting p51800 > 0), a unique station address
must be set at p51806 on all SINAMICS DCMs. Otherwise, the parallel interface will not work
property.
Remedy in this case: Switch the electronics power supply off and then on.
• In the particular topology, communication between all converters is established via the
parallel interface. The CUDs of all converters should be connected with one another.
• The parallel interface allows a maximum of 16 nodes to communicate.
• The devices are connected using 8-core shielded patch cables, type UTP CAT5 according to
ANSI/EIA/TIA 568, such as those that are used to network PCs. A standard 5 m long cable can
be directly purchased from Siemens (article number: 6RY1707-0AA08). (n-1) cables are
required to connect n devices. The bus termination must be activated at the units connected
at the start of the bus and at the end of the bus (p51805 = 1).
Note
A patch cable according to TIA568A (European) or TIA568B (American) can be used.
However, both cable ends must be wired according to the same standard (patch cable = 1:1).
A crossover cable is not suitable.
• The parallel interface also enables any BICOs (that can be parameterized by the user) to be
exchanged between nodes. See function block diagrams 9352 and 9355. Exchanging data
in this way is not required for closed-loop control of the firing pulses or for generating them,
and is available for the user for any purpose.
Note
For a 12-pulse series connection, it is not permissible that the parallel interface is used to
transfer BICOs, i.e. p51801 = 0 must be set. Failure to comply with this remark can result in
sporadic current peaks.
• For additional details on how devices are connected in parallel, please refer to function
diagrams 9350, 9352, and 9355.
Control system
• For all of the topologies, a SINAMICS DCM is used as the master converter. The other con‐
verters are called follower converters.
• The control commands - switch-on/stop, operating enable, quick stop, etc. are fed to the
master converter for all topologies.
At the follower converters, terminals 12 and 13 must be permanently connected to terminal
9. If, in spite of this, a control command is entered at a follower converter, then it has the
following consequences:
OFF1 Has no effect, as long as n<nmin has not been reached, then the
current is reduced to zero at the follower and the follower goes into
operating state o7.0 or o7.1

OFF2 The current is reduced to zero at the follower, then the follower goes
into operating state o10.1 or o10.2
OFF3 no effect, as long as n<nmin has not been reached, then the current
is reduced to zero at the follower and the follower goes into operating
state o9.1 or 9.2
E-STOP The current is reduced to zero at the follower, then the follower goes
into operating state o10.3
Operating enable The current is reduced to zero at the follower, then the follower goes
into operating state o1.1 or o1.
As long as the master does not receive a switch-on command, the slaves stay in operating
state o10.0 (wait for switch-on from the master).
If the master receives a switch-on command, then it automatically transfers this to the
slaves. Then, all devices carry out their switch-on sequence, i.e. they attempt to go into
operating state o0. However, the master waits in operating state o1.7 until all slaves have
reached operating state o0 (exception: n+m operation for a 6-pulse parallel connection)
If a follower leaves operating state o0, then the master outputs fault message F60044
(exception: n+m operation for a 6-pulse parallel connection)
• The speed setpoint and the actual speed value should be entered at the master converter.
• The optimization runs should be started at the master converter. The follower converters
must be connected and ready for operation at this point.
Miscellaneous
Note
For a follower converter the i2t monitoring of the motor should be deactivated (p50114 = 0),
because for a non-symmetrical current, this would then respond at the follower.

10.26.1 6-pulse parallel connection
10.26.1.1 Basic topology

The topology of a 6-pulse parallel connection, comprising a master converter and two slave
converters is shown in the following diagram.
$&99+]
$&9+]
'& 9 '& 9 '& 9

8 : 8 : 8 :
8
9
:
8
9
:

8
9
:
8
9
:
8
9
:
8
9
:
3RZHUVXSSO\ 3RZHUVXSSO\ 3RZHUVXSSO\
)LHOG )DQ $UPDWXUH )LHOG )DQ $UPDWXUH )LHOG )DQ $UPDWXUH
6,1$0,&6'&0 6,1$0,&6'&0 6,1$0,&6'&0

&RQWURO0RGXOH &RQWURO0RGXOH &RQWURO0RGXOH
6ODYH 0DVWHU 6ODYH
; ; ; & ' ; ; ; & ' ; ; ; & '
& ' ' & & ' ' & & ' ' &

2))
(QDEOH 0
1) The same phase sequence is required between 1U1/1V1/1W1.

2) The same phase sequence is required between 1C1/1D1.
3) The devices are connected using (8-pin) shielded patch cables of type UTP CAT5 in acc. with ANSI/EIA/TIA 568, such as
those that are used in PC network technology.
A standard, 5 m cable can be obtained directly from Siemens (article number: 6RY1707-0AA08).
(n-1) cables are required for connecting n devices in parallel.
The bus terminator must be activated for each device positioned at the start or end of the bus (p51805 = 1).
Figure 10-78 Parallel connection
• Up to six devices can be connected in parallel.

• When connecting several devices in parallel, the master device should be positioned
centrally due to the signal runtimes. Maximum cable length of the parallel-connection
interface cable between master and slave devices at each bus end: 15 m.
• Separate line reactors of the same type are required for each power unit for current splitting
purposes. The difference in reactor tolerances determines the current splitting. For operation
without derating (current reduction), a tolerance of 5% or less is recommended.
10.26.1.2 Extended topology

The topology of a 6-pulse parallel connection, comprising a master converter, one substitute
master, two follower converters, as well as an independent converter is shown in the following
diagram.

The converters SINAMICS DCM 1, DCM 2, DCM 3 and DCM 4 are operated in the n+m
operating mode. The SINAMICS DCM 5 converter is, regarding its power unit, independent of
the others. It only exchanges BICOs with them via the parallel interface.
|
}
~
mGGGG
mGGGG
mGGGG
zpuhtpjz zpuhtpjz zpuhtpjz zpuhtpjz zpuhtpjz
kjtGZ kjtGX kjtGY kjtG[ kjtG\
zG t m m pG
ipjv
ipjv
ipjv
ipjv
ipjv

\X_WWGdGXZ \X_WWGdGXX \X_WWGdGXY \X_WWGdGXY \X_WWGdGX
jGGGGGGk jGGGGGGk jGGGGGGk jGGGGGGk jGGGGGGGk
wG
ySGs
t t
Figure 10-79 6-pulse parallel connection, extended topology
10.26.1.3 Operating modes

There are two operating modes:
• Standard mode
• n+m operation (also known as redundancy mode or redundant operation)
Standard mode
A SINAMICS DCM is defined as the master. This device carries out the closed-loop speed control,
the closed-loop armature current control, line synchronization and determines the firing points.
The firing points and the thyristor pair to be fired are transferred to the follower devices; all the
followers then fire the thyristor pairs at these points.
n+m mode
n+m converters are connected in parallel. When up to m converters fail (e.g. a fuse ruptures in
the power unit, a fault message occurs), operation is maintained without any interruption.
For n+m operation, a SINAMICS DCM is defined as master. Additional SINAMICS DCM are
defined as substitute masters. As with the standard mode, the device defined as the master
carries out the closed-loop speed control, the closed-loop armature current control, line
synchronization and determines the firing points.

If a follower fails (due to a fuse blowing in the power unit or a fault being output, for
example), operation continues with the remaining converters. The SINAMICS DCMs that are
still in proper working order continue to operate uninterrupted.
If a master fails (due to a fuse blowing in the power unit or a fault being output, for example)
a substitute master automatically becomes the master and the remaining devices continue
to operate uninterrupted. If several SINAMICS DCMs are parameterized as substitute masters,
the substitute master with the lowest bus address (p51806) that is ready for operation takes
over.
Parameter r53311.0 indicates whether the SINAMICS DCM is currently operating as master
(see FP9350).
When configuring, it is important to note that the power produced by n devices alone (rather
than n+m devices) must also be sufficient for the application in question.
When operating the SINAMICS DCM together with a SIMOREG DC-MASTER Converter
Commutation Protector (CCP), n+m operation must be deactivated.
Optimization runs:
n+m operation must be deactivated before starting the optimization runs. P51803 must be
set = 0 at the master and at the substitute master units.
Otherwise, during the optimization runs, monitoring functions can inadvertently respond
(e.g. for p51803 = 2, fault message F60105 with fault value 1 can be output).
Versions of the n+m operating mode:
1. n+m mode only in the armature circuit
In this operating mode, when the master fails, only the armature firing pulses and the
upstream closed-loop control (setpoint channel, speed control, armature current control) are
transferred to the substitute master; however, not the field firing pulses and the upstream
control (EMF control, field current control).
The main application for the operating mode is to supply large inductances (e.g. field
windings of synchronous generators) with the SINAMICS DCM armature converter.
Activation:
At the master and substitute master devices, set p51803=1.
2. n+m mode in the armature circuit and in the field circuit
In this operating mode, when the master fails the following values are forwarded to the
substitute master:
– the armature firing pulses and the upstream control (setpoint channel, speed control,
armature current control)
– the field firing pulses and the upstream control (EMF control, field current control)
Activation:
On the master and substitute master devices, set p51803 = 2.
Connection:
Outputs 3C and 3D (field DC voltage output) of the master and all substitute masters must be
connected to the motor field winding in parallel.

Remarks on n+n mode:

• When commissioning, after carrying out the optimization (by starting optimization runs, for
example), all parameters set by the optimization runs must be transferred to all substitute
masters according to Chapter "Parameterization (Page 579)"
• Since the field supplies are connected in parallel, part of the overall motor-field current flows
through the freewheeling arm of the respective field power units with disabled field firing
pulses. To sense the total motor field current (indicated at parameter r50035), in the actual
master, the free-wheeling current detected by the "partner" device is therefore automatically
added.
Therefore, for this operating mode, there must be an intact parallel connection as well as an
intact electronic power supply of the master and the substitute master – these are
prerequisites.
If this operating mode is also to be used after the electronics power supply of the master or
the substitute master fails, then the total motor actual field current value must be externally
sensed. The value must be supplied to the master and substitute master using p50612.
• Generally speaking, the master function is only transferred from the active master to the
substitute master via telegram and a sound parallel-connection interface. Even if the
master's electronic power supply fails, the master still has enough time to transmit a
telegram for the purpose of transferring the master function.
• As soon as the parallel connection is interrupted (by disconnecting the parallel connecting
cable), it can no longer be guaranteed that the master/follower assignment will be correct.
The electronic power supply must be switched off and back on again at all devices!
Note
The control commands - switch-on/stop, operating enable, quick stop, etc. - must also be
entered at all of the substitute master devices.
The speed setpoint and the actual speed value must be entered at all substitute master devices.
If the thermal overload protection of the DC motor (I2t motor monitoring) is used, as explained
in Chapter "Thermal overload protection for the DC motor (I2t monitoring of the motor)
(Page 562)", the following should be observed:
After a device fails, the calculated motor temperature of this device deviates from the devices
still operational. In this particular case, thermal overload protection as described in Chapter
"Thermal overload protection for the DC motor (I2t monitoring of the motor) (Page 562)" no
longer applies.
10.26.1.4 Parameterization
6-pulse parallel connection, standard operation
Table 10-90 Standard mode
Parameter Master Follower or parallel units

p51799 Operating principle 0 The same as at the master
p51800 Position in the topology 11 (Master) 12 (Follower)
p51801 Number of send data Any Any


p51802 Minimum number of nodes Number of SINAMICS DCM units in Number of SINAMICS DCM units in
this topology this topology
p51803 n+m mode 0 0
p51804[..] Send data Any Any
p51805 Bus terminator 0 or 1 1)
0 or 1 1)
p51806 Station address Unique address Unique address
p51807 Telegram failure time 0.1 s 0.1 s
p51815 Paralleling interface number of no‐ Number of all DCM connected to The same as at the master
des the paralleling interface
p50082 Field operating mode ≠0 0 (no field)
p50076[..] Reduction in rated unit DC current - The same as at the master
p50078[..] Rated value for supply voltage - The same as at the master
p50100 Rated motor current Rated motor current/number of SI‐ The same as at the master
NAMICS DCM
p50110 Armature resistance Ra 2) Actual armature resistance × num‐ The same as at the master
ber of SINAMICS DCM
p50111 Armature inductance La 2) Actual armature inductance × num‐ The same as at the master
ber of SINAMICS DCM
p50114 Motor thermal time constant Motor thermal time constant in s The same as at the master
p50140 Motor I2t monitoring, response Application-specific The same as at the master
when starting
p51591 La reduction factor 2) - The same as at the master
p50357 Threshold for interrupted tachome‐ Application-specific 100% (tachometer interruption
ter monitoring not active)
1)
= 1 at the two outermost units (= at the physical ends of the bus line)
= 0 on all of the other units
2)
The optimization run for current controller and precontrol (p50051 = 23 or 25) sets the correct values for these parameters.
6-pulse parallel connection n+m operation
Table 10-91 n+m mode
Parameter Master Substitute master Follower

p51799 Operating principle 0 The same as at the master The same as at the master
p51800 Position in the topology 11 (Master) 13 (Substitute master) 12 (Follower)
p51801 Number of send data Any Any Any
p51802 Minimum number of no‐ n The same as at the master The same as at the master
des
p51812 Total number of nodes n+m The same as at the master The same as at the master
p51803 n+m mode 1 (only armature) The same as at the master 0
2 (armature + field)
p51804[..] Send data Any Any Any
p51805 Bus terminator 0 or 1 1)
0 or 1 1)
0 or 1 1)
p51806 Station address Unique address Unique address Unique address
p51807 Telegram failure time 0.1 s 0.1 s 0.1 s

Parameter Master Substitute master Follower

p51815 Paralleling interface num‐ Number of all DCM con‐ The same as at the master The same as at the master
ber of nodes nected to the paralleling
interface
p50082 Field operating mode ≠0 0 (if only armature) 0 (no field)
≠ 0 (if armature + field)
p50076[..] Reduction in rated unit DC - The same as at the master The same as at the master
current
p50078[..] Rated value for supply - The same as at the master The same as at the master
voltage
p50100 Rated motor current Rated motor current/ The same as at the master The same as at the master
number of SINAMICS DCM
p50110 Armature resistance Ra 2) Actual armature resist‐ The same as at the master The same as at the master
ance × number of SINAM‐
ICS DCM
p50111 Armature inductance La 2) Actual armature induc‐ The same as at the master The same as at the master
tance × number of SINAM‐
ICS DCM
p50114 Motor thermal time con‐ Motor thermal time con‐ The same as at the master The same as at the master
stant stant in s
p50140 Motor I2t monitoring, re‐ Application-specific The same as at the master The same as at the master
sponse when starting
p50115 to Field characteristic - The same as at the master The same as at the master
p50139 (only if n+ m operation for
armature + field)
p51591 La reduction factor 2) - The same as at the master The same as at the master
p50357 Threshold for interrupted Application-specific The same as at the master 100% (tachometer inter‐
tachometer ruption monitoring not ac‐
tive)
1)
2)
10.26.2 12-pulse parallel connection
Note
12-pulse applications
The circuit diagrams in this chapter are block diagrams.
You can find detailed information on interconnecting, dimensioning and parameterizing in the
application document "12-pulse applications (https://support.industry.siemens.com/cs/ww/en/
view/109822407)".
Support is also available through our Technical Support organization (for contact address, see
"Preface (Page 3)").

Topology
The following diagram shows the topology of a 12-pulse parallel connection.
|XG |YG
}XG }YG
~X ~Y
zpuhtpjz zpuhtpjz
kjtGX kjtGY
t m
jG
\X_WWGdGYX {G \X_WWGdGYY
ipjv
jGGGGGGGk wG jGGGGGGGk
y s ySGs s y
Figure 10-80 12-pulse parallel connection (1), block diagram
The following diagram shows the topology of a 12-pulse parallel connection, where an
additional 6-pulse converter is connected in parallel to each of the two 12-pulse converters
connected in parallel.

|XG |YG
}XG }YG
~X ~Y
zpuhtpjz zpuhtpjz zpuhtpjz zpuhtpjz

kjtGZ kjtGX kjtGY kjtG[
m t m m
\X_WWGdGYZ \X_WWGdGYX \X_WWGdGYY \X_WWGdGY[
jG
jGGGGGGGk jGGGGGGGk {G jGGGGGGGk jGGGGGGGk
ipjv
wG
y s ySGs s y
Figure 10-81 12-pulse parallel connection (2), block diagram
Note
If additional converters are connected in parallel to the master converter, then exactly the same
number of converters must also be connected in parallel with the follower converter.

10.26.3 6-pulse series connection
Topology
The following diagram shows the topology of a 6-pulse series connection of two SINAMICS DCM.
|XG |YG
}XG }YG
~X ~Y
zpuhtpjz zpuhtpjz
kjtGX kjtGY
t m
mGSGG
\X_WWGdGZX | \X_WWGdGZY
ipjv
kGGGGGGGj wG kGGGGGGGj
ySGs
Figure 10-82 6-pulse series connection (1)
The following diagram shows the topology of a 6-pulse series connection, where additional
converters are connected in parallel to each of the two 6-pulse converters connected in
series.

|XG |YG
}XG }YG
~X ~Y

m m m m
\X_WWGdGZZ \X_WWGdGZX \X_WWGdGZY \X_WWGdGZ[
jGGGGGGGk jGGGGGGGk
mGSGG jGGGGGGGk jGGGGGGGk
|
ipjv
wG
ySGs
t
Figure 10-83 6-pulse series connection (2)
The instructions for dimensioning the balancing resistors can be found in an FAQ (for the
link, see the Preface).
Operating modes
There are 2 operating modes:
• Operation with the same firing pulses (p51799 = 0 or p51799 = 31):
Both partial converters are fired at precisely the same point. The master calculates the firing
point and this is transferred to the follower via the parallel interface. Synchronization to the
line supply is exclusively performed by the master. The follower must be connected to the line
supply with the same phase sequence as the master.
• Operation with sequence control (p51799 = 32):
Both partial converters synchronize to the line supply and generate their own firing points.
The firing angle for the master and the firing angle for the follower are calculated by the
master and the firing angle and the torque direction for the follower are transferred to the
follower via the parallel interface. The firing angle for the master and follower are generated
so that the reactive power load of the line supply is as low as possible. This is the case if one
of the two partial converters is at a control limit and the other carries-out the closed-loop
control. This type of closed-loop control is only possible for continuous current. Operation
with the same firing points is automatically selected in the discontinuous (pulsating) current
range.
Note
The phase sequence at the master and the follower must be the same.

Parameter assignment
The following parameters should be specifically set for operation with this converter topology:
Table 10-92 Parameter assignment, 6-pulse series connection

p51799 Operating principle 0, 31 or 32 The same as at the master
p51800 Position in the topology 31 (Master) 32 (follower)
33 (parallel to the master)
34 (parallel to the follower)
p51801 Number of send data Any Any
p51803 n+m mode 0 0
p51804[..] Send data Any Any
p51805 Bus terminator 0 or 1 1) 0 or 1 1)
p51806 Station address Unique address Unique address
p50100 Rated motor current - The same as at the master
p50110 Armature resistance Ra 2) - The same as at the master
p50111 Armature inductance La 2) - The same as at the master
p50114 Motor thermal time constant Motor thermal time constant in s The same as at the master
p50140 Motor I2t monitoring, response Application-specific The same as at the master
when starting
1)
2)

10.26.4 6-pulse series connection: controlled converter + uncontrolled converter
Topology
The following diagram shows the topology of a 6-pulse series connection of a SINAMICS DCM 2-
quadrant unit and a diode rectifier (thyristor bridge B6 + diode rectifier).
Note
The AC input voltage of the controlled converter should be between 10 % and 15 % higher than
that of the uncontrolled converter, so that the current can be reliably reduced down to 0.
8 8
9 9
: :
6,1$0,&6 'LRGH
'&0 UHFWLILHU
0DVWHU
S
'& '&
5D/D
Figure 10-84 6-pulse series connection: controlled + uncontrolled rectifier
The instructions for dimensioning the balancing resistors can be found in an FAQ (for the
link, see the Preface).
Parameterization
The following parameters should be specifically set for operation with this converter topology:
Table 10-93 Parameterization, 6-pulse series connection
Parameter Master Units connected in parallel with

the master
p51798 Voltage at an uncontrolled rectifier Actual voltage as a percentage of The same as at the master
the voltage at the master (standard:
85 %)
p51799 Operating principle 0 0
p51800 Position in the topology 35 (Master for diode rectifier) 33

Parameter Master Units connected in parallel with

the master
0.1 s if units connected in parallel
are available
p50100 Rated motor current Rated motor current/number of SI‐ The same as at the master
NAMICS DCM
p50110 Armature resistance Ra 2) Actual armature resistance × num‐ The same as at the master
ber of SINAMICS DCM
p50111 Armature inductance La 2) Actual armature inductance × num‐ The same as at the master
ber of SINAMICS DCM
2)
10.26.5 12-pulse series connection
Note
view/109822407)".

Topology
The following diagram shows the topology of a 12-pulse series connection of two SINAMICS
DCM.
|XG |YG
}XG }YG
~X ~Y
zpuhtpjz zpuhtpjz
kjtGX kjtGY
t m
mGSGG
\X_WWGdG[X } \X_WWGdG[Y
ipjv
kGGGGGGGj wG kGGGGGGGj
ySGs
Figure 10-85 12-pulse series connection (1), block diagram
The following diagram shows the topology of a 12-pulse series connection, where additional
converters are connected in parallel to each of the two 12-pulse converters connected in
series.
|XG |YG
}XG }YG
~X ~Y

m t m m
\X_WWGdG[Z \X_WWGdG[X \X_WWGdG[Y \X_WWGdG[[
jGGGGGGGk jGGGGGGGk mGSGG jGGGGGGGk jGGGGGGGk

}
ipjv
wG
ySGs
t
Figure 10-86 12-pulse series connection (2), block diagram

Operating modes
There are two operating modes:
• Operation with the same firing times (p51799 = 41):
Both partial converters are fired at precisely the same instant. The master calculates the
firing point and this is transferred to the follower via the parallel interface. Synchronization
to the line supply is exclusively performed by the master. The follower must be connected to
the line supply with the same phase sequence as the master.
• Operation with sequence control (p51799 = 42):
Both partial converters synchronize to the line supply and generate their own firing points.
The firing angle for the master and the firing angle for the follower are calculated by the
master and the firing angle and the torque direction for the follower are transferred to the
follower via the parallel interface. The firing angle for the master and follower are generated
so that the reactive power load of the line supply is as low as possible. This is the case if one
of the two partial converters is at a control limit and the other carries-out the closed-loop
control. This type of closed-loop control is only possible for continuous current. Operation
with the same firing points is automatically selected in the discontinuous (pulsating) current
range.
Note
The current ripple is significantly higher when the two partial converters operate with sequence
control than when they operate with the same firing times. In this case, the current ripple
approximately corresponds to that for 6-pulse operation. Especially in older motors, under
certain circumstances this ripple can cause problems (for example, during commutation).
Therefore, a conscious decision must be made:
• Low ripple, but no reduction of the reactive power:
→ operation with the same firing times (p51799 = 41)
• Low reactive power, but no reduction of the ripple:
→ Operation with sequence control (p51799 = 42)
Note
Connecting the follower converter to the 12-pulse transformer
The power unit of the follower converter must be connected to the 12-pulse transformer so that
its phases lag the phases of the line supply at the master by 30°. The phase sequence must be
the same.

10.26.6 12-pulse series connection: controlled converter + uncontrolled converter
Note
view/109822407)".
Topology
The following diagram shows the topology of a 12-pulse series connection of a SINAMICS DCM
2-quadrant unit and a diode rectifier (thyristor bridge B6 + diode rectifier).
Note
The AC input voltage of the controlled converter should be between 10 % and 15 % higher than
that of the uncontrolled converter, so that the current can be reliably reduced down to 0.
8 8
9 9
: :
6,1$0,&6 'LRGH
'&0 UHFWLILHU
0DVWHU
S
'& '&
5D/D
Figure 10-87 12-pulse series connection: Controlled + uncontrolled rectifier, block diagram

10.27 Field reversal
10.26.7 Switchover of the power unit topology - option S50
Ordering information for option S50, see Chapter "Ordering information (Page 31)"
Note
SINAMICS DCM can only be retrofitted with option S50 in the manufacturers factory.
Note
application document "12-pulse applications". Support is also available through our Technical
Support organization (for contact address, see "Preface (Page 3)").
In certain applications, it is necessary to switch between a 12-pulse parallel connection and a

12-pulse series connection during operation using a control command.
External contactors must be used to switch over the power unit topology. Option S50
provides the required firmware functionality.
Requirements for using this functionality

• All SINAMICS DCMs involved must be equipped with option S50.
• It is not permissible that the "n+m" mode is used.
• The function of the "parallel switching master" must remain on the same SINAMICS DCM in
both power unit topologies.

See also the SINAMICS DCM List Manual, function diagram 6920
When using a two-quadrant unit (with only one armature current flow direction) by reversing
the current in the excitation winding of the DC motor (field reversal) operation in additional
quadrants of the speed-torque characteristic is possible (direction of rotation reversal and
braking).
Two contactors are required in the field circuit to reverse the field voltage.
The functions "Direction of rotation reversal using field reversal" and "Braking using field
reversal" control connector outputs r53195[0] (close field contactor 1) and r53195[1] (close
field contactor 2), which are then used to control the two field contactors.
A protection circuit is required in the field circuit.
r53195[0] = 0 No contactor control

=1 Control for a contactor to switch-in the positive field direction
r53195[1] = 0 No contactor control
=1 Control for a contactor to switch-in the negative field direction

10.27.1 Direction of rotation reversal using field reversal

The function "Direction of rotation reversal using field reversal" is controlled using the signal
source (binector) selected at binector input p50580 and this has a switch-type function. It
defines the field direction and therefore also the direction of rotation for a positive speed
setpoint.
Binector = 0 A positive field direction is selected.

"Close field contactor 1" (r53195.0) = 1, "Close field contactor 2" (r53195.1)
=0
Binector = 1 A negative field direction is selected.
"Close field contactor 1" (r53195.0) = 0, "Close field contactor 2" (r53195.1)
=1
Changing the logical level of the binector controlling the function "Direction of rotation
reversal using field reversal " brakes the drive and accelerates it in the opposite direction of
rotation.
Field reversal is completely executed. Level changes at the connector input have no effect
while the field is being reversed.
Note
Only positive speed setpoints make sense.
Control sequence when specifying "Direction of rotation using field reversal"

1. Drive rotates in direction of rotation 1 or 2 (or is at a standstill)
2. Specify "Direction of rotation reversal using field reversal" by changing the logical state of the
binector selected using p50580

3. Field reversal is executed

Precondition: No braking was initiated using the key function "Braking using field reversal"
– Wait until armature current IA = 0, then armature pulse inhibit (the drive then remains in
operating state ≥ o1.4)
– Inhibit field firing pulses (r52268=0 also initiates this)
– Wait until Ifield (r52265) < Ifield min (p50394)
– Wait time according to p50092[00] (0.0 to 10.0 s, factory setting 3.0 s)
– Open current field contactor (r53195.0 = 0 or r53195.1 = 0)
– Control new field contactor (r53195.0 = 1 or r53195.1 = 1)
– Reverse the speed actual value (with the exception, for p50083 = 3 ... EMF as speed actual
value)
– Enable field firing pulses
– Wait until Ifield (r52265) > Ifield set (r52268) * p50398
– Enable armature firing pulses (operating state o1.4 can be exited)
4. Drive brakes and then rotates in direction of rotation 1 or 2 (or is at a standstill)
Note
In the case of an internal speed actual value reversal as a result of field reversal, p50083 is
supplied with inverted signal values (exception: p50083 = 3, see the SINAMICS DCM List Manual,
function diagram 6810).
When using the ramp-function generator, it is recommended to parameterize p50228 = 0 (no
speed controller setpoint filtering). If this is not done, then initial braking can occur at the current
limit as a result of the speed actual value reversal and setting the ramp-function generator
output to the (reversed) speed actual value or to the value according to p50639 in operating
state o1.4.
10.27.2 Braking using field reversal

The function "Braking using field reversal" is controlled using the signal source (binector) set at
binector input p50581 and this has a key-type function.
Binector = 1 (for ≥30 ms) in operating state ≤o5 (line contactor closed) causes the drive to
brake to n < nmin.
After this, the original field direction is selected.
The motor can run-up in the original direction of rotation after the braking command has
been withdrawn (binector = 0) and acknowledged using "Stop" and "Switch-on".

Control sequence when specifying "Braking using field reversal"

1. Drive rotates with direction of rotation 1 or 2
2. Specify "Braking using field reversal" using a logical 1 (for ≥30 ms) selected at binector using
p50581
3. Field reversal is executed.
Preconditions: Line contactor is closed (for operating state ≤o5) and the drive is not already
braking.
Braking is identified by the negative internal actual speed (whereby, this is obtained in the
negative field direction by reversing the real actual speed):
– Inhibit field firing pulses (r52268 = 0 also initiates this)
value)
– Wait until Ifield (r52265) > Ifield set (r52268) × p50398
– Enable armature firing pulses (operating state o1.4 can be exited)
4. Sequence when braking the drive:
– nset = 0 internally entered at the ramp-function generator input, the drive brakes
– Wait until n < nmin (p50370)
– Wait until armature current IA = 0, then armature pulse inhibit (drive goes into operating
state o7.2)
– Wait until the braking command has been withdrawn by logical 0, on the binector
selected with p50581
(as long as level = 1 is present, the drive is kept in operating state o7.2)

5. Sequence to change over to the original field direction

Precondition: The present field direction does not match the field direction requested using
the function "Direction of rotation reversal using field reversal"
– Inhibit field firing pulses (r52268 = 0 also initiates this)
value)
– Wait until Ifield (r52265) > Ifield set (r52268×p50398)
– Armature firing pulses are again possible
6. The drive is in operating state o7.2
Running up is possible in the original direction of rotation when acknowledging using an
external "Stop" and "Switch-on"
Please also read the note at the end of Chapter "Direction of rotation reversal using field
reversal (Page 593)".

10.28 Serial interface with peer-to-peer protocol
,D
W
,)
S>@
S
U S W
S>@
)LHOGFRQWDFWRU
U
&ORVHG 2SHQ
W
)LHOGFRQWDFWRU S>@ S>@

U
2SHQ &ORVHG
W
Figure 10-88 Wait times for field reversal (parameter p50092)
General information
The peer-to-peer interface enables BICO interconnections across multiple SINAMICS DCMs.
Further, the peer-to-peer interface allows signal connections to be established between
SINAMICS DCM converters (article number = 6RA80...) and other converters such as the
SIMOREG DC MASTER (article number = 6RA70...) and SIMOREG K (article number = 6RA24...).
Properties
"Peer-to-peer connection" refers to a "connection between partners with equal status". Contrary
to classic master-device bus systems (such as PROFIBUS or USS), peer-to-peer connections
enable the same converter to act as both a master (setpoint source) and a follower (setpoint
recipient).

Signals can be transferred via the peer-to-peer connection from one converter to another in
fully digital format.
• Velocity setpoints for creating a setpoint cascade, e.g. in paper making machines, film
manufacturing machines, and wire drawing machines, as well as fiber stretching plants
• Torque setpoints for load distribution control systems on drives that are coupled either
mechanically or by means of the material, e.g. horizontal-shaft drives on a printing machine
or S-roll drives
• Acceleration setpoints (dv/dt) for acceleration precontrol in multi-motor drives
• Control commands
The peer-to-peer interface uses the RS485 interface at connector X177 (terminals 37, 38, 39,
and 40).
Function diagrams
Function diagram FP9300 shows the settings and BICO interconnection options for the "peer-to-
peer connection".
Diagnostics
Parameter r50799 contains information about the distribution of error-free telegrams and
telegrams with errors over time, as well as the type of any communications errors that occur.
Table 10-94 Peer-to-peer interface diagnostics
Function Parameter
Communication diagnostics r50799
Information about the distribution of error-free telegrams and
telegrams with errors over time, as well as the type of any
communication errors that occur.
Displaying send data r50799[0...4]
Mirrored display of the send data in p50794[0...4].

Topologies
The peer-to-peer interface supports three topologies:
• Series connection / point-to-point connection
– Every converter is connected to the previous and following converters through a 2-wire
connection.
– Data is only transferred from the upstream to the downstream converter.
In addition, the ring can be closed from the last back to the first drive.
– A classic setpoint cascade can be implemented using this topology.
• Parallel connection
– The receive terminals of slave drives are connected to the send terminals of the master
drive through a 2-wire connection.
– All following drives receive the setpoints from a common master drive.
• Bus connection
– All converters are connected with one another through a common 2-wire connection.
– Data is transferred in one direction only.
– The drive sending data must be selected using p50817.
This binector may only be connected to a 1 signal for one converter on the bus.
Converters where p50817 has a 0 signal bring their send output into a high ohmic state
(Z).
Parameterization
Table 10-95 Parameterizing the peer-to-peer interface
Function Parameter
Peer-to-peer protocol selection p50790 = 5
PZD number p50791 = 1 to 5 words
Baud rate p50793 = 1 to 13, corresponding to between 300 and 187500
baud
Connector input for send data p50794[0...4]
Bus terminator p50795 = 0: Bus terminator OFF
p50795 = 1: Bus terminator ON
Telegram monitoring time p50797
Error statistics r50799[1]: Displays receive errors on the peer-to-peer inter‐
face
Binector input for receive enable p50816
Binector input for send enable p50817

10.28.1 Examples of peer-to-peer connections
Series connection / point-to-point connection

Each drive receives its own individual setpoint from the previous drive (classic setpoint cascade).
'ULYH 'ULYH 'ULYH 'ULYHQ

$FWLYDWHEXVWHUPLQDWLRQ %XVWHUPLQDWLRQDFWLYDWHG %XVWHUPLQDWLRQDFWLYDWHG Q DQ\KLJKQXPEHU
ZKHQXVLQJGDWDIHHGEDFN %XVWHUPLQDWLRQDFWLYDWHG
6,1$0,&6'&0 6,1$0,&6'&0 6,1$0,&6'&0 6,1$0,&6'&0

5[ 7[ 5[ 7[ 5[ 7[ 5[ 7[

'DWDIHHGEDFN
1) The shields for the interface cables must be connected directly on the devices (using a clamp, for example) to device or
cabinet ground, with a low level of impedance.
3) Optional data feedback, which drive 1 can use to monitor the functionality of the entire circuit.
Figure 10-89 "Series connection / point-to-point connection" peer-to-peer connection type

Parallel connection
Up to 31 slave drives receive the same setpoints from drive 1 (master drive).
'ULYH 'ULYH 'ULYH 'ULYHQ Q

%XVWHUPLQDWRUGHDFWLYDWHG %XVWHUPLQDWRUGHDFWLYDWHG %XVWHUPLQDWLRQDFWLYDWHG
6,1$0,&6'&0 6,1$0,&6'&0 6,1$0,&6'&0 6,1$0,&6'&0

5[ 7[ 5[ 7[ 5[ 7[ 5[ 7[

Figure 10-90 "Bus connection" peer-to-peer connection type
Bus connection
Up to 31 slave drives receive the same setpoints from a common master drive.
• The drive sending data is selected using p50817 (Enable send) = 1.
• For all of the drives, p50817 (Enable send) must be set = 0.

10.29 Expanding the SINAMICS DCM to include a second CUD
%XVWHUPLQDWRUDFWLYDWHG %XVWHUPLQDWRUGHDFWLYDWHG %XVWHUPLQDWRUGHDFWLYDWHG %XVWHUPLQDWRUDFWLYDWHG
6,1$0,&6'&0 6,1$0,&6'&0 6,1$0,&6'&0 6,1$0,&6'&0

S S S S

5[ 6HQG 5[ 5[ 5[
GDWD

7[ 7[ 7[ 7[

Figure 10-91 "Bus connection" peer-to-peer connection type
General information
SINAMICS DCM can be optionally equipped with a second CUD, which is inserted in the right-
hand slot. This option is only available in conjunction with option G00 (Advanced CUD in left-
hand slot). See also Chapter "Ordering information for options and accessories".
For the installation of the second CUD, see Chapter "Installing a second CUD (Page 64)" and
"Replacing the CUD (Page 662)".
NOTICE
Installation or removal only in a no-voltage state.
Installing or removing a module is only permitted when the SINAMICS DCM is in a no-voltage
state.
Properties
The right-hand CUD is used for system-specific extension of SINAMICS DCM functions.
It enables the following function extensions:
• Doubling the number of hardware inputs and outputs for applications requiring more analog
inputs, analog outputs, digital inputs, or digital outputs
• Additional computing capacity for free function blocks and, above all, for application-
specific function diagrams generated using DCC

Connection between the left-hand and right-hand CUD:

This involves using the parallel-connection interface.
16 BICO connections can be established in each direction. Function diagrams FP9350,
FP9352, and FP9355 show the settings and BICO interconnection options for the parallel-
connection interface.
The hardware connection for the two CUDs is established inside the unit; there is no need for
an external connection using connector X165 or X166. It is also possible to use the parallel
interface for controlling a power unit-side configuration, where several SINAMICS DCM units
are connected in parallel.
Parameterization
The right-hand CUD is parameterized using the AOP30 or the STARTER commissioning tool. The
Basic Operator Panel BOP20 cannot be used for this purpose.
• Parameterizing the right-hand CUD using the AOP30:
The AOP30 must be connected to connector X178 (RS485 interface) or X179 (RS232
interface) on the right-hand CUD.
• Parameterization of the right-hand CUD using STARTER:
STARTER views the right-hand CUD as a separate PROFIBUS node. Either the unique bus
address must be set using the AOP30, or STARTER must first be connected as the sole bus
node in order to set the unique bus address.
The second CUD must be parameterized as an "independent node" for the parallel-
connection interface, meaning that it participates in BICO exchange between multiple CUDs.
Table 10-96 Parameterization without power unit-side parallel connection of several SINAMICS DCMs
Left-hand CUD Right-hand CUD

p51800 = 1 Independent node p51800 = 1 Independent node
p51801 Number of words to be sent p51801 Number of words to be sent
p51802 = 2 Minimum number of stations p51802 = 2 Minimum number of stations
p51803 = 0 "n+m mode" not active p51803 = 0 "n+m mode" not active
p51804[..] Establish required BICO connections p51804[..] Establish required BICO connections
p51805 = 1 Bus terminator p51805 = 1 Bus terminator
p51806 = Unique station address p51806 = Unique station address
Table 10-97 Parameterization with power unit-side parallel connection of several SINAMICS DCMs

p51800 Required as with parallel connection of pow‐ p51800 = 1 Independent node
er units
p51801 Number of words to be sent p51801 Number of words to be sent
p51802 Required as with parallel connection of pow‐ p51802 Required as with parallel connection of pow‐
er units er units
p51803 Required as with parallel connection of pow‐ p51803 = 0 "n+m mode" not active
er units
p51804[..] Establish required BICO connections p51804[..] Establish required BICO connections

10.30 Terminal Module Cabinet TMC (option G63)

p51805 Required as with parallel connection of pow‐ p51805 = 0 No bus terminator
er units
p51806 = Unique station address p51806 = Unique station address
Normally, on the CUD on the right-hand slot the closed-loop drive control (setpoint
processing, ramp-function generator, closed-loop speed control, armature current control,
closed-loop EMF control, closed-loop field-current control) is not required.
For that reason it makes sense to deactivate the closed-loop drive control (with
p50899[0...6] = 0, see also function diagram 1721) in order to gain more CPU time for
free function blocks and, especially, for application-specific function diagrams created with
DCC.
10.30 Terminal Module Cabinet TMC (option G63)

The Terminal Module Cabinet (TMC) enables the simple connection of the CUD standard signals
(X177) via spring-loaded terminals in an easily accessible area of the control cabinet.
See Chapter “Ordering information for options and accessories (Page 32)” for ordering data.
The dimensions needed in the control cabinet are approx. 230 mm x 45 mm.
Figure 10-92 Terminal Module Cabinet
The CUD is equipped with a "Cabinet Board".

During installation, connectors X1 and X2 on the Cabinet Board must be connected to
connectors X1 and X2 on the TMC with the supplied cables (3 m). The cables must be laid in
a cable duct.
For terminal assignment, see Chapter “Connector assignment (terminals, Faston mounting
tabs, ribbon cables) (Page 137)”.

10.32 Diagnostics
10.31 Runtime (operating hours counter)
Total system runtime

The total system runtime is displayed in r2114 (Control Unit).
• Index 0 = system runtime in ms.
After reaching 86400000 ms (24 h), the value is reset.
• Index 1 = system runtime in days.
The counter value is saved when the power is switched off. After the drive unit is powered up,
the counter continues to run with the most recently saved value.
Note
Errors and alarms are stamped with this system runtime.
If a connected AOP30 is parameterized as the time-of-day master (see Chapter "Assigning
parameters to make AOP30 time-of-day master (Page 369)"), faults and alarms are provided with
a real-time stamp.
Relative system runtime

The relative system runtime since the last POWER ON is displayed in p0969 (Control Unit) in ms.
The counter runs over after 49 days.
10.32 Diagnostics
10.32.1 Diagnostic memory

To provide support for troubleshooting and resolving problems, the SINAMICS DCM records
various data in a diagnostics file. Siemens specialists can use the contents of this file to glean
more in-depth information about the cause of inexplicable faults or other problems such as
blown fuses or defective thyristors.
When contacting Siemens with queries related to problems of this type, it is, therefore,
advisable that you both read out this file and e-mail a copy of it to the Siemens experts.
With parallel or series connection, the diagnostics files of all devices must always be read out
and sent to the Siemens experts.

10.32 Diagnostics
Proceed as follows to read out the diagnostics file:

1. Insert the memory card into the drive.
2. Select either of the following two methods to copy the diagnostics file to the memory card:
– Set p50832 = 1: This copies the diagnostics file into the \USER\SINAMICS\DATA\LOG
folder.
– Set p50832 = 2: This copies the diagnostics file into the \USER\SINAMICS\DATA folder.
The copying process takes approximately 2 minutes. Copying is complete when p50832
takes on the value 0 again.
The diagnostics file is called DiagStor.spd and is approximately 600 KB in size.
Note
Before starting a firmware update, copy the diagnostics files to the memory card.
For more details on the diagnostics memory, please refer to function diagram FP8052.
10.32.2 Trend recorder function

SINAMICS DCM enables data to be recorded through 4 channels over an extended period of time
and with a large memory depth. A file on the memory card takes on the role of a long-term
storage facility. The signals to be recorded are updated periodically and written cyclically to the
file.
The file contains a line-by-line account of the operating hour and values for the 4 channels,
in the form of an ASCII string, and can be evaluated and visualized using standard PC tools
(such as Notepad or Excel).
Recording must be started manually (by setting p51705 = 0/1/2). With a recording period of
1 second, the file grows by approximately 100 kB per hour.
When starting via p51705 = 1, recording is automatically stopped after the number of entries
set in p51706 – and p51705 is set to 0.
When starting via p51705 = 2, the oldest entries are overwritten after the number of entries
set in p51706. Recording must be stopped manually (with p51705 = 0).
The file is called Track.csv and can be found in the \USER\SINAMICS\DATA\LOG directory on
the memory card.
For more details on the trend recorder function, please refer to function diagram FP8050.

10.32 Diagnostics
10.32.3 Thyristor diagnostics

The SINAMICS Control Module can perform a self-test of the external power unit. As a
consequence, defective thyristors and other faults can be detected in the power unit.
Note
The thyristor diagnostics cannot be used when external power units are connected in series.
Note
When connecting SINAMICS DCMs in parallel (6-pulse or 12-pulse), the thyristor diagnostics
must only be selected on the master. The thyristor diagnostics are then performed first on the
master and then automatically in succession on all followers. If a faulty thyristor is detected on
an external power unit, the appropriate fault message is issued on the assigned Control Module
and not on the master on which the thyristor diagnostics was started.
Note
If a thyristor is fused, in 6-pulse parallel connection it is not possible to identify in which of the
parallel power units the defective thyristor is located. The corresponding fault message occurs
on the master.
Selecting thyristor diagnostics

Thyristor diagnostics are performed during the switch-on procedure. Parameter p50830 can be
used to select for which switch-on procedures thyristor diagnostics is performed.
p50830 = 0 never
= 1 when the electronics is switched on for the first time
= 2 at each ON
= 3 at the next ON (p50830 is then reset to 0)
Thyristor diagnostics sequence

At each switch-on procedure, starting from operating state o7 the drive goes into state o0.
During thyristor diagnostics, it remains in operating state o3 (see parameter r50000). Thyristor
diagnostics takes approx. 30 s.

10.32 Diagnostics
Thyristor diagnostics comprises two parts:

1. Checking the thyristor for its blocking capability
All thyristors are individually fired and it is not permissible for current to flow. If it does, this
indicates that a thyristor is fused or it triggers with forward breakover or a ground fault has
occurred, i.e. terminal 1C or 1D is connected to ground.
NOTICE
Ground fault monitor recommended
In IT line systems (i.e. in systems with a non-grounded neutral point of the supply
transformer), the thyristor diagnostics cannot detect a single-pole ground fault.
For these types of line supplies, it is recommended that a ground fault monitor is used.
WARNING
Electric shock or electric arc during operation with ground fault
The type and location of the fault cannot be established just from a ground fault message.
In the event of continued operation, serious aftereffects all the way to electric arcs are
possible. This can result in death, serious injury or material damage.
• If a ground fault occurs during operation, the system must be switched off immediately.
Then identify and eliminate the source of the ground fault.
• The plant operating company is responsible for the consequences for further operation
after a ground fault has been detected. Carry out a risk analysis.
2. Checking that the thyristors can be triggered

All of the thyristors are triggered in pairs and in this case, a current must flow (as a minimum,
5% of r50072[1]). Otherwise, a thyristor cannot be triggered. This can also be caused by a
fault in the firing pulse generation.
NOTICE
It is possible that the motor shaft rotates
The low current that flows during this test can cause the motor shaft to briefly rotate for
motors that are very easy to move and are not loaded, as in this operating state, the full
field is already present.
Faults that are detected result in fault message F60061. The fault value provides information
as to which thyristor was detected to be defective and what the possible cause of the fault
could be.

10.32 Diagnostics
10.32.4 Description of the LEDs on the CUD
5'<
'3
237
02' &RQWURO8QLW &8'
Figure 10-93 Layout of the LEDs
The individual states during ramp-up are indicated by means of the LEDs on the CUD.
• The duration of the individual states varies.
• If an error occurs, the ramp-up procedure is aborted and the cause of the error is indicated
via the LEDs.
Remedy: Insert the appropriate memory card with the correct firmware and
parameterization.
• At the end of a successful ramp-up, all the LEDs are switched off briefly.
• After the ramp-up, the LEDs are controlled via the loaded firmware.
The description of the LEDs after ramp-up applies.
Note
The LEDs are only visible when the front cover of the SINAMICS DCM is opened.
CUD - Response of LEDs during a firmware update
Table 10-98 Firmware update
LED Meaning
RDY DP1 OPT MOD
Red Off Off Off Firmware update in progress.
Red 2 Hz Red Off Off Firmware on the memory card is incomplete or defective.
The firmware update failed. The CRC of the programmed firmware is incor‐
rect.
Red 0.5 Hz Red 0.5 Hz Off Off The firmware has been successfully completed. The electronic power sup‐
ply must be switched off and back on again.
Red 2 Hz Red 2 Hz Off Off The firmware on the memory card does not belong to SINAMICS DCM.
The firmware version and hardware version of the CUD are not compatible.
For information on the hardware/firmware compatibility, see Chapter “Up‐
grading the device firmware (Page 656)”.
Orange x x Off DRIVE-CLiQ component is being updated.
0.5 Hz
Orange 2 x x Off DRIVE-CLiQ component has been updated.
Hz

10.32 Diagnostics
CUD - Response of LEDs during ramp-up (following POWER ON)
Table 10-99 Ramp-up
LED Status Remark

RDY DP1 OPT MOD
Red Red Off Off BIOS loaded -
Red 2 Hz Red Off Off BIOS error -
Red 2 Hz Red 2 Hz Off Off File error Memory card not present or
flash file system faulty
Red Orange Off Off Firmware loading DP1 flashing without specific flashing
flashing frequency
Red Off Off Off Firmware loaded -
Off Red Off Off No CRC error Firmware checked
Red 0.5 Hz Red 0.5 Hz Off Off CRC error Firmware checked, CRC error
Orange Off Off Off Drive initialization -
Response of the LEDs after ramp-up
Table 10-100 CUD - Description of the LEDs after ramp-up

RDY (READY) - Off Electronics power supply is missing or outside per‐ Check power supply
missible tolerance range.
Green Continuous The component is ready for operation. No errors -
light are present.
0.5 Hz flash‐ Commissioning/reset -
ing light
2 Hz flash‐ Writing to memory card or internal flash memory -
ing light Notice!
The electronic power supply for the SINAMICS DCM
must not be switched off during this write opera‐
tion.
Switching off the electronic power supply can lead
to the loss of the parameter assignments. Also refer
to Chapter "Operation", Section "Memory card
functions".
Red 2 Hz flash‐ General errors Check parameterization/
ing light configuration
Orange 0.5 Hz flash‐ Updating the firmware of the connected DRIVE- –
ing light CLiQ components
2 Hz flash‐ DRIVE-CLiQ component firmware update com‐ Carry out POWER ON for the
ing light plete. Wait for POWER ON for the respective com‐ respective components
ponents.
Green/ 1 Hz flash‐ Component detection via LED is activated -
orange or ing light (p0124[0]).
red/ Note:
orange Both options depend on the LED state when com‐
ponent detection is activated via p0124[0] = 1.

10.32 Diagnostics

DP1 - Off Cyclic communication has not (yet) taken place. -
PROFIdrive cy‐ Note:
clic operation The PROFIdrive is ready to communicate when the
CUD is ready for operation (see LED RDY).
Green Continuous Cyclic communication is taking place. -
light
0.5 Hz flash‐ Bus fault (dataEx, no operate) -
ing light Full cyclic communication is not yet taking place.
Possible cause:
The controller is not transferring any setpoints.
Red Continuous USS: No activity on bus
light
0.5 Hz flash‐ USS: Activity on bus; no PZD received
ing light Bus fault (no dataEx)(config fault) -
2 Hz flash‐ Bus fault (no more dataEx) -
ing light Bus fault (search baud rate)
No link established -
OPT - Off Electronic power supply is missing or outside per‐ Check power supply and/or
(OPTION) missible tolerance range, component
Component not ready for operation,
Option Board not installed,
no associated drive object has been created,
Green Continuous Option Board is ready for operation. -
light
0.5 Hz flash‐ Depends on the Option Board used -
ing light
Red 2 Hz flash‐ At least one fault is present in this component. Remedy and acknowledge
ing light Option board not ready (e.g. after switching on) fault
RDY and DP1 Red 2 Hz flash‐ Bus fault – communication has been interrupted Correct fault
ing light
RDY and OPT Orange 0.5 Hz flash‐ The firmware of the connected CBE20 Communi‐ -
ing light cation Board Ethernet is being updated
MOD - Off Reserved -
10.32.5 Diagnostics via STARTER
The diagnostic functions support commissioning and service personnel during commissioning,
troubleshooting, diagnostics and service activities.
Requirement
• Online operation of the STARTER commissioning tool.

10.32 Diagnostics
Diagnostic functions
The following diagnostic functions are available in the STARTER commissioning tool:
• Specification of signals with the ramp-function generator
• Signal recording with the trace function
• Analysis of the control response with the measuring function
10.32.5.1 Function generator

The function generator is part of the STARTER commissioning tool.
The function generator can be used, for example, to perform the following tasks:
• Measuring and optimizing control loops.
• Comparing the dynamic response of coupled drives.
• Specifying a simple traversing profile without a traversing program.
The function generator can be used to generate various waveforms.
In the "Connector output" operating mode (r4818), the output signal can be injected into the
control loop via the BICO interconnection.
Properties
• The following freely parameterizable waveforms can be set:
– Square-wave
– Staircase
– Triangular
– Sinusoidal
– PRBS (pseudo random binary signal, white noise)
• An offset is possible for each signal. The power-up to the offset can be parameterized. The
signal generation starts after the power-up to the offset.
• Limitation of the output signal to the minimum and maximum value can be set.
Further waveforms
Additional waveforms can be generated.
Example:
The "triangular" waveform can be parameterized with "Upper limit" to produce a triangle with
no peak.
7RS
OLPLW
7ULDQJXODU
VLJQDOIRUP
Figure 10-94 "Triangular" without peak waveform

10.32 Diagnostics
Parameterizing and operating the function generator

You operate and parameterize the function generator via STARTER.
Figure 10-95 Function generator
Note
Please refer to the online help for more information about parameterization and operation.
Note
The "Function generator as commissioning tool" button must not be selected!
If this button is still selected, then the message "Error occurred while parameterizing" is output
on STARTER when "Loading the parameterization to the drive" as well as alarm A02007 on the
SINAMICS DCM (Function generator: Drive not SERVO/VECTOR).
Starting/stopping the function generator
WARNING
Hazardous axis movement
With the corresponding ramp-function generator parameter settings (e.g. offset), the motor
can "drift" and travel to its end stop.
The motion of the drive is not monitored with the function generator activated.

10.32 Diagnostics
Starting the function generator:

1. Load the function generator.
– Click the symbol.
or
– In the project navigator, double-click "Drives" > "Drive_xy" > "Commissioning" > "Function
generator".
2. Select "Function generator as setpoint source".
3. Select the BICO input.
4. Set the waveform, for example, "Square-wave".
5. Click the "Assume control priority!" button.
6. For "Sign of life monitoring", click the "Accept" button
(the control priority button then changes to yellow).
7. Click the "Drive on" symbol.
8. Start the function generator by clicking the triangle next to the red zero
("Start FctGen" button).
9. Read the "Caution" note and confirm with "Yes".
The drive starts and runs through the set trace function.
Trace recordings are now possible.
Stopping the function generator:

1. Click the "Stop FctGen" button.
or
2. Click the "Drive off" icon to stop the drive.
Parameterization
The "Function generator" parameterization screen is selected with the symbol in the toolbar
of the STARTER commissioning tool.
10.32.5.2 Trace function
Single trace
You can use the trace function to record measured values over a defined period, depending on
trigger conditions. Alternatively, the measured values can also be recorded using immediate
recording.
In the STARTER commissioning tool you can parameterize the trace function by using the
"Trace" parameterizing screen form.
Calling the "Trace" parameterizing screen form

In the STARTER commissioning tool, click the symbol (device trace-function generator).
The "Trace" parameterizing screen form is then displayed.

10.32 Diagnostics
Example:
Figure 10-96 Trace function
Parameterizing and operating the trace function
Note
Detailed information on how to parameterize and operate the trace function is available in the
STARTER online help in Chapter "Trace, measuring functions and automatic controller setting".
Figure 10-97 Trace function

10.32 Diagnostics
The device cycle time display flashes 3 times at around 1 Hz when the time slice is changed
from < 4 ms to ≥ 4 ms (see description at "Properties"). The display also flashes in the inverse
direction from ≥ 4 ms to < 4 ms.
Properties
• Two independent traces
• Up to eight recording channels for each trace
When more than four channels per single trace are used, the trace's device clock cycle is
switched automatically from 0.250 ms to 4 ms. As a consequence, the performance of the
SINAMICS DCM is not influenced too strongly by the trace function.
• Single trace:
Device clock cycles of the SINAMICS DCM trace
Up to four channels: 0.250 ms
≥ five channels: 4 ms
The specified trace cycles can be increased.
• Endless trace:
The parameter data is written to the memory until this is full.
Further parameter data is then lost.
A ring buffer can be selected in order to avoid this. When the ring buffer is activated, then the
STARTER commissioning tool automatically starts again from the beginning to write to the
trace memory after the last trace parameter was saved.
Device cycle of the SINAMICS DCM trace for an endless trace:
Up to four channels: 2 ms
≥ five channels: 4 ms
• Triggering
– Without triggering (recording immediately after start)
– Triggering on signal with edge or on level
• STARTER commissioning tool
– Automatic or adjustable scaling of the display axes
– Signal measurement via cursor
• Adjustable trace cycle: Integer multiples of the basic sampling time
Multiple trace
A multiple trace consists of single, completed, consecutive traces. Using multiple tracing on a
card, it is possible to cyclically record (a specific number) traces with the same trace
configuration (number of channels, sample depth, recording cycle,..), and to save these traces
persistently on the drive memory card.
The "Endless trace", "Single trace" and "Multiple trace" functions cannot be used
simultaneously. With a correspondingly incorrect configuration, alarm "A02097" is output.

10.32 Diagnostics
However, a multiple trace with a cycle of 1 is nothing more than a single trace with saved
measurement results.
NOTICE
Shorter service life of memory cards as a result of multiple traces.
The service life of the cards can be shortened by the multiple traces because the memory media
is subject to wear as a result of the write access operations from a technical point of view.
Note
The performance of the complete system can be negatively influenced by a continuous multiple
trace.
Requirement
A multiple trace is only possible if the memory card is plugged in and not blocked. In this
case, alarm "A02098 MTrace: Cannot be saved" is output with alarm value "1".
Activating a multiple trace
Note
The multiple trace can be activated or set separately for each trace recorder.

10.32 Diagnostics
1. In STARTER, click the symbol (device trace-function generator).

Figure 10-98 Multiple trace in STARTER
2. Activate the "Save recording in the device" checkbox.

3. Enter the number of cycles in the "Number of recordings" field.
Note
Detailed information on how to parameterize and operate the trace function is available in
the STARTER online help in Chapter "Trace, measuring functions and automatic controller
setting".
4. Make the required trace settings and save the settings.

10.32 Diagnostics
Sequence of a multiple trace

1. A multiple trace is started just like a conventional single trace using the STARTER "Trace"
screen form.
2. The multiple trace component saves the measurement result after the trigger condition has
occurred and the trace data has been completely recorded.
3. The single trace that has actually been completed is now automatically restarted from the
multiple trace component. In this case, the same trace configuration (trigger condition,
recording cycle, etc. ) is used as before. The trace buffer of the previous single trace is emptied
in the process.
Trace status
The status of the multiple trace is displayed in the screen form (red frame):
Figure 10-99 Trace status in STARTER
Startup trace
A startup trace basically consists of a conventional single trace with all of its configuration
options (number of channels, sampling depth, recording cycle, etc.). With the appropriate
configuration, a startup trace is automatically active after a drive restarts.

10.32 Diagnostics
Configuring the startup trace

1. In STARTER, click the symbol (device trace-function generator).
Figure 10-100 Startup trace in STARTER
2. Activate the "Save recording in the device" checkbox.

3. Enter a number ≥ 1 in the "Number of recordings" field.
Note
Detailed information on how to parameterize and operate the trace function is available in
the STARTER online help in Chapter "Trace, measuring functions and automatic controller
setting".
4. Make the required trace settings and save the settings.

10.32 Diagnostics
5. Start the trace.

This is followed by the prompt whether the parameterization in the device should be saved.
Figure 10-101 Trace save prompt in STARTER
6. Activate the "Copy RAM to ROM after starting" option.

7. Click "Yes" to start the trace.
After the restart (POWER ON) of the SINAMICS DCM, the trace is started automatically
(without a user action). After satisfying the trigger condition, the measurement is saved on
the memory card in the USER\SINAMICS\DATA\LOG directory as ACX file. The trace is then
restarted automatically. As many files are created as set at "Number of recordings". The oldest
file is overwritten.
In order to view the measurements later with STARTER, the memory card must be removed
from the SINAMICS DCM and inserted into the PC. The files can then be opened with the
STARTER trace.
Overview of important alarms and faults (see SINAMICS DCM List Manual)
• A02097 MTrace: Multiple trace cannot be activated

• A02098 MTrace: Cannot be saved
10.32.6 Faults and alarms
10.32.6.1 General information
Description
The errors and states detected by the individual components of the drive unit are indicated by
messages.

10.32 Diagnostics
The messages are categorized into faults and alarms.
Note
The individual faults and alarms are described in the section titled "Faults and alarms" in the
SINAMICS DCM List Manual. Here you can also find a section titled "Function diagrams" → "Faults
and alarms", which contains function diagrams for the fault buffer, alarm buffer, fault trigger,
and fault configuration.
Properties of faults and alarms

• Faults
– Are identified by Fxxxxx
– Can lead to a fault reaction
– Must be acknowledged once the cause has been remedied
– Status via Control Unit and LED RDY
– Status via PROFIdrive status signal ZSW1.3 (fault active).
– Entry in the fault buffer
• Alarms
– Are identified by Axxxxx
– Have no further effect on the drive unit
– The alarms are automatically reset once the cause has been remedied. No
acknowledgment is required.
– Status via PROFIdrive status signal ZSW1.7 (alarm active).
– Entry in the alarm buffer
• General properties of faults and alarms
– Can be configured (e.g. change fault to alarm, fault reaction)
– Triggering on selected messages possible
– Initiation of messages possible via an external signal
– Contains the component number for identifying the SINAMICS component involved
– Contains diagnostic information on the message involved

10.32 Diagnostics
Acknowledging faults
The list of faults and alarms specifies how each fault is acknowledged after the cause has been
remedied.
1. Acknowledgment of faults with "POWER ON"
– Switch the drive unit on/off (POWER ON).
2. Acknowledgment of faults with "IMMEDIATE"
– Via PROFIBUS control signal
STW1.7 (reset fault memory): 0/1 edge
Set STW1.0 (ON/OFF1) = "0" and "1"
– Via external input signal
Binector input and interconnection with digital input
p2103 = "Requested signal source"
Across all of the drive objects (DO) of a Control Unit
3. Acknowledgment of faults with "PULSE INHIBIT"
– The fault can only be acknowledged with a pulse inhibit (r0899.11 = 0).
– The same options are available for acknowledging as described under acknowledgment
with IMMEDIATE.
Note
The drive cannot resume operation until all active faults have been acknowledged.
10.32.6.2 Buffer for faults and alarms
Note
A fault buffer and alarm buffer are provided for each drive. The drive and device-specific
messages are entered in these buffers.
The contents of the fault buffer are saved to the non-volatile memory when the Control Unit is
powered down, i.e. the fault buffer history is still available when the unit is powered up again.
Note
The entry in the fault/alarm buffer is made after a delay. For this reason, the fault/alarm buffer
should not be read until a change in the buffer is also recognized (r0944, r2121) after "Fault
active"/"Alarm active" is output.

10.32 Diagnostics
Fault buffer
Faults which occur are entered in the fault buffer as follows:
)DXOWFRGH )DXOWYDOXH )DXOWWLPH )DXOWWLPH )DXOW &RPSRQHQW 'LDJQRVWLF

UHFHLYHG UHFWLILHG 'ULYHREMHFW QXPEHU DWWULEXWH
WULJJHULQJ )DXOW )DXOW
U>@>,@ U>@>PV@ U>@>PV@

)DXOW U>@ U>@ U>@ U>@
U>@>)ORDW@ U>@>G@ U>@>G@
)DXOW U>@>,@ U>@>PV@ U>@>PV@
U>@ U>@ U>@ U>@
&XUUHQWIDXOW U>@>)ORDW@ U>@>G@ U>@>G@
)DXOW U>@>,@ U>@>PV@ U>@>PV@

U>@ U>@! U>@! U>@!
U>@>)ORDW@ U>@>G@ U>@>G@
U>@>,@ U>@>PV@ U>@>PV@

)DXOW U>@ U>@ U>@ U>@
U>@>)ORDW@ U>@>G@ U>@>G@
)DXOW U>@>,@ U>@>PV@ U>@>PV@
VWDFNQRZ U>@ U>@ U>@ U>@
U>@>)ORDW@ U>@>G@ U>@>G@
OHGJHGIDXOW
)DXOW U>@>,@ U>@>PV@ U>@>PV@

U>@ U>@ U>@ U>@
U>@>)ORDW@ U>@>G@ U>@>G@
U>@>,@ U>@>PV@ U>@>PV@

)DXOW U>@ U>@ U>@ U>@
U>@>)ORDW@ U>@>G@ U>@>G@
)DXOW U>@>,@ U>@>PV@ U>@>PV@
WKDFNQRZ U>@ U>@ U>@ U>@
U>@>)ORDW@ U>@>G@ U>@>G@
OHGJHGIDXOW
>ROGHVW@
U>@>,@ U>@>PV@ U>@>PV@

)DXOW U>@ U>@ U>@ U>@
U>@>)ORDW@ U>@>G@ U>@>G@
! 7KLVIDXOWLVRYHUZULWWHQZKHQಯQHZHUರIDXOWVRFFXU
Figure 10-102 Structure of the fault buffer
Properties of the fault buffer:

• A new fault incident encompasses one or more faults and is entered in "Current fault
incident".
• The entries appear in the buffer according to the time at which they occurred.
• If a new fault incident occurs, the fault buffer is reorganized. The history is recorded in
"Acknowledged fault incident" 1 to 7.
• If the cause of at least one fault in "Current fault incident" is remedied and acknowledged, the
fault buffer is reorganized. Faults that have not been remedied remain in "Current fault
incident".
• If "Current fault incident" contains 8 faults and a new fault occurs, the fault in the parameters
in index 7 is overwritten by the new fault.
• r0944 is incremented each time the fault buffer changes.
• A fault value (r0949) can be output for a fault. The fault value is used to diagnose the fault
more accurately; please refer to the fault description for details of the meaning.

10.32 Diagnostics
Clearing the fault buffer:

• The fault buffer is reset as follows: p0952 = 0
Alarm buffer, alarm history

The alarm buffer comprises the alarm code, the alarm value, and the alarm time (received,
resolved). The alarm history occupies the last indices ([8...63]) of the parameter.
$ODUPFRGH $ODUPYDOXH $ODUPWLPH $ODUPWLPH &RPSRQHQW 'LDJQRVWLF

UHFHLYHG FOHDUHG QXPEHUDODUP DWWULEXWH
DODUP
$ODUP U>@>O@ U>@>PV@ U>@>PV@

U>@ U>@>)ORDW@ U>@>G@ U>@>G@ U>@ U>@
ROGHVW
U>@>O@ U>@>PV@ U>@>PV@
$ODUP U>@ U>@ U>@
U>@>)ORDW@ U>@>G@ U>@>G@
$ODUP U>@
U>@>O@ U>@>PV@ U>@>PV@
U>@ U>@
QHZHVW U>@>)ORDW@ U>@>G@ U>@>G@
$ODUPKLVWRU\
U>@ U>@ U>@
QHZHVW U>@>)ORDW@ U>@>G@ U>@>G@
U>@>O@ U>@>PV@ U>@>PV@
$ODUP U>@ U>@ U>@
U>@>)ORDW@ U>@>G@ U>@>G@

U>@ U>@ U>@
ROGHVW U>@>)ORDW@ U>@>G@ U>@>G@
Figure 10-103 Structure of alarm buffer
Alarms that occur are entered in the alarm buffer as follows:

A maximum of 64 alarms are displayed in the alarm buffer:
• Index 0 ... 6: The first 7 alarms are displayed.
• Index 7: The most recent alarm is displayed.
A maximum of 56 alarms are displayed in the alarm history:
• Index 8: The most recent alarm is displayed.
• Index 9 ... 63: The first 55 alarms are displayed.
Properties of the alarm buffer/alarm history:
• The alarms in the alarm buffer are arranged from 7 to 0 according to the time that they
occurred. In the alarm history, this is from 8 to 63.
• If 8 alarms have been entered in the alarm buffer, and a new alarm is received, the alarms that
have been resolved are transferred to the alarm history.

10.32 Diagnostics
• r2121 is incremented each time the alarm buffer changes.

• An alarm value (r2124) can be output for an alarm. The alarm value is used to diagnose the
alarm more accurately; please refer to the alarm description for details of the meaning.
Clearing the alarm buffer, index [0...7]:
• The alarm buffer index [0...7] is reset as follows: p2111 = 0
10.32.6.3 Configuring messages

The properties of the faults and alarms in the drive system are permanently defined.
The following configuration settings can be made for some of the messages within a
permanently defined framework for the drive system:
Change message type (example)

Select message Set message type
p2118[5] = 1001 p2119[5] = 1: Fault (F)
= 2: Alarm (A)
= 3: No message (N)
Change fault response (example)
Select message Set fault response
p2100[3] = 1002 p2101[3] = 0: None
= 1: OFF1
= 2: OFF2
= 3: OFF3
Change acknowledgment (example)
Select message Set acknowledgment
p2126[4] = 1003 p2127[4] = 1: POWER ON
= 2: IMMEDIATE
= 3: PULSE INHIBIT
Note
Only those messages which are listed in the indexed parameters can be changed as desired. All
other messages retain their factory settings or are reset to the factory settings.
Examples:
• In the case of messages listed via p2128[0...19], the message type can be changed. The
factory setting is set for all other messages.
• The fault response of fault F12345 has been changed via p2100[n]. The factory settings are
to be restored.
– p2100[n] = 0
Delay of the fault response

The fault response can be delayed by a parameterized time for all faults.
p51780 delay time (0.000 s .. .. 60.000 s), factory setting = 0.000 s
See also function diagram 2651.
The two CO/BOs r2139.3 (Fault active) and r3114.10 (Fault present) can be used by a

10.32 Diagnostics
higher-level controller in order to detect the time when a fault occurs (Fault present) and the
time when a fault takes effect (Fault active).
Triggering on messages (example)
Select message Trigger signal

p2128[0] = 1001 BO: r2129.0
or
p2128[1] = 1002 BO: r2129.1
Note
The value from CO: r2129 can be used as a group trigger.
CO: r2129 = 0 No selected message has been output.
CO: r2129 > 0 Group trigger.
At least one selected message has been output.
The individual binector outputs BO: r2129 should be investigated.
Triggering messages externally

If the appropriate binector input is interconnected with an input signal, fault 1, 2, or 3 or alarm
1, 2, or 3 can be triggered via an external input signal.
Once an external fault 1 to 3 has been triggered on the Control Unit drive object, this fault
is also present on all associated drive objects. If one of these external faults is triggered on a
different drive object, it is only present on that particular drive object.
BI: p2106 → External fault 1 → F07860(A)

BI: p2112 → External alarm 1 → A07850(F)
Note
An external fault or alarm is triggered by a 1/0 signal.
An external fault and alarm do not usually mean that an internal drive message has been
generated. The cause of an external fault and warning should, therefore, be remedied outside
the drive unit.

10.32 Diagnostics
10.32.6.4 Parameters and function diagrams for faults and alarms

• 1710 Overview diagram – monitoring functions, faults, alarms
• 8060 Faults and alarms – fault buffer
• 8065 Faults and alarms – alarm buffer
• 8070 Faults and alarms – fault/alarm trigger word r2129
• 8075 Faults and alarms – fault/alarm configuration

• r0944 Counter for fault buffer changes
...
• p0952 Fault incident counter
• p2100[0...19] Fault code for fault reaction selection
...
• r2139 Status word for faults
• r3120[0...63] Component number fault
• r3121[0...63] Component number alarm
• r3122[0...63] Diagnostics attribute fault
• r3123[0...63] Diagnostics attribute alarm
10.32.6.5 Forwarding faults and alarms
Forwarding faults and alarms of the CU

When faults or alarms are triggered on the drive object of the CU, it is always assumed that
central functions of the drive unit are involved. For this reason, these faults and alarms are not
only signaled on the drive object of the CU, but are also forwarded to all other drive objects. The
fault reaction affects the drive object of the CU and all other drive objects. This behavior also
applies to the faults set in a DCC chart on the CU with the aid of DCB STM.
A fault that was set on the drive object of the CU must be acknowledged on all drive
objects to which this fault was forwarded. In this way, the fault is then automatically
acknowledged on the drive object of the CU. Alternatively, all faults of all drive objects can
also be acknowledged on the CU.
If a set alarm is reset on the drive object of the CU, this alarm also disappears automatically
on the other drive objects to which this alarm was forwarded.

10.32 Diagnostics
Forwarding faults and alarms as a result of BICO interconnections

If two or more drive objects are connected via BICO interconnections, then faults and alarms
from CU, TM31, TM15, TM17, and TM15DIDO drive objects are forwarded to DC_CTRL-type drive
objects. Faults are not forwarded within these two groups of drive object types.
This behavior also applies to the faults set in a DCC chart on the previously named drive
object types with the aid of DCB STM.
10.32.7 Simulation mode
Description
Electrical systems are to be subjected to extensive testing (correctness of wiring, etc.) prior to
mounting and before each commissioning. In the case of converter systems, in which in DCM
Control Module and a thyristor power unit (possibly re-used from an old system) are installed,
this check is to be performed very carefully due to the complexity of the wiring.
The DCM Control Module offers simulation mode for support.
Simulation mode enables firing pulses to be transferred to specific individual thyristors only
without the line voltage being present for the power unit.
Sequence of simulation mode

1. Selection of an individual thyristor with p51840.
This results in the activation of simulation mode. However, this only happens in operating
states ≥ o7.0. This means that during simulation mode the line contactor is opened and the
power unit is not under voltage load.
In all other operating states, p51840 is ineffective.
If simulation mode is active, every 20 ms it outputs two firing pulses with intervals of 3.33 ms
to the selected thyristor. The length setting of the pulse packet with p50079 (short pulse/long
pulse) is considered here.
While simulation mode is active, the DCM switches to operating state o8.1. As such, an ON
command is ineffective during simulation mode.
2. Measurement of the firing current on the gate connection of the selected thyristor using
current probe and oscilloscope.
3. End simulation mode with p51840 = 0.
By successively testing all thyristors, the following checks are possible:
• Correctness of wiring on firing pulse cables
• Correctness of set firing pulse chopping (see p51826)
• Correctness of firing current of the thyristors

10.33 CPU time load with SINAMICS DCM
Remarks on simulation mode

• Remark 1:
Simulation mode is in principle also possible for a DCM DC Converter. However, there is no
need for this there, as the corresponding tests have already been performed at the
manufacturer’s factory. Furthermore, the firing pulse cables are not accessible without
impermissible intervention (opening cable ties).
• Remark 2:
The thyristor diagnostics described in Chapter "Thyristor diagnostics (Page 607)" are not
suitable for checking the electrical system following mounting. In the case of thyristor
diagnostics, the line voltage must be present at the power unit. The wiring of the firing pulse
cables is assumed to be correct.
Thyristor diagnostics are intended to support troubleshooting in the case of unexplained
fault messages or blown fuses which suggest the presence of defective thyristors (F60004,
F60010, F60057, F60300, etc.).

The CPU time load of the SINAMICS DCM is indicated in r9976[1] of the drive object CU_DCM.
The following rules always apply:
1. The cyclic DC closed loop control of the SINAMICS DCM generates a base load of approx. 70 %
(r9976[1]).
2. The use of peripherals (AOP30, Starter, TM15, TM31, TM150, SMC10, SMC30, CBE20,…),
certain settings in the closed-loop control and/or use of the free function blocks along with
the DCC technology option increases this base load. The additional CPU time load as a result
of the main components is summarized in the following table.
3. It is not permissible that the CPU time load (r9976[1]) exceeds 100 %.
WARNING
Exceeding the CPU time load
It is no longer ensured that the drive correctly functions for a CPU time load of >100 % in
p9976[1].
• Ensure that the CPU time load remains below 100 %.
Note
When the time load of the CUD is too high (r9976[1] >100%), fault F60099 (in extreme cases
F01205) is output (time slice overflow). In such a case, the drive needs to be switched off and
then back on again (POWER OFF / POWER ON).

The CPU time load must be taken into consideration when configuring and commissioning
the SINAMICS DCM.
Table 10-101 Additional CPU time load as a result of optional components
Component Additional CPU time load

AOP30 via PPI +4 %
1 TM31 +4 %
2 TM31 +5 %
3 TM31 +6 %
1 TM15 +1 %
2 TM15 +1.5 %
3 TM15 +2 %
1 TM150 +1 %
2 TM150 +1.5 %
3 TM150 +2 %
1 SMC10, SMC30 +2 %
1 CBE20 +1 %
Internal encoder (p50083 = 2) +2 %
Parallel interface +4 %
Peer-to-peer +4 %
Calculating the thyristor blocking voltage +4.5 %
Is supported by the CCP +3.5 %
Memory card inserted +1 %
Technology controller +1.5 %
Free function blocks Depending on the number of free function blocks
being used and their runtime groups, see Chapter
"Free function blocks (Page 633)"
DCC Depending on the number of DCC blocks being
used and their runtime groups, see Chapter "Drive
Control Chart (DCC) (Page 635)"
Note
The additional CPU time load listed above for TM15, TM31 and TM150 apply for a sampling time
of 4 ms (p4099 = 4000). Setting faster sampling rates in the TM modules increases the CPU time
load in the SINAMICS DCM to values considerably higher than those stated previously.
Note
The stated computing rules are to be understood as support during configuring and
commissioning. The theoretical CPU time load computed from these rules can deviate from the
CPU time load actually measured on the r9976[1] by several percentage points.

10.33.1 Maximum configuration

The following configuration can be operated as the maximum on one CUD.
Table 10-102 Maximum configuration with SINAMICS DCM
Number Component Note

3 TM15, TM31, TM150 Connection of any combination of TM15, TM31 and
TM150 modules on DRIVE-CLiQ. Connecting other TM
modules (TM17, TM41, ...) as well as more than 3 TM
modules is not permissible.
Sampling in 4 ms cycle (p4099=4000). Faster sampling
increases the CPU time load, and precludes operation of
this maximum configuration
1 SMC10, SMC30 The connection of other (SMC20,..) and of more than 1
external encoder module is not permissible.
1 CBE20 The connection of other OMI modules (CBE10) is not
permissible.
1 Pulse encoder evaluation p0400 > 0
1 AOP30
1 STARTER Online
1 Parallel interface Active
1 Peer-to-peer Active
Note
The capacity of the SINAMICS DCM can be expanded by equipping the SINAMICS DCM with a 2nd
CUD (right-hand mounting slot). See Chapter "Expanding the SINAMICS DCM to include a second
CUD (Page 602)".
10.33.2 Computation examples

Example 1:
Project A is a single drive in a control cabinet. An AOP30 is located in the control cabinet
door. The motor has a pulse encoder, which is connected through the pulse encoder input
X177.41‑48
Base load 70 %
AOP30 +4 %
Internal encoder +2 %
Calculated CPU time load = 76 %
Approx. 24 % remain free for use by the free function blocks and/or DCC blocks.
Example 2:
Project B is a single drive connected to an S7 via PROFINET. 3 TM31 modules are used for
terminal expansion. The sampling rates of the TM modules (p4099) are set to 4000 ms. In

10.34 Free function blocks
addition, a configured DCC application in the drive is running, which comprises 50 blocks and
runs in the 6 ms time slice.
Base load 70 %
CBE20 +1 %
3 × TM31 with p4099[1,2,3] = 500 +6 %
DCC application: 50 blocks @ 1 ms +5 %
Calculated CPU time load = 82 %
The CUD is 82 % utilized.
Note
The available CPU time can be expanded by equipping the SINAMICS DCM with a 2nd CUD (right-
hand mounting slot). See Chapter "Expanding the SINAMICS DCM to include a second CUD
(Page 602)".

A logic operation, which connects several states (e.g. access control, plant status) to a control
signal (e.g. ON command), is required for controlling the drive system in a wide variety of
applications.
Along with logic operations, a number of arithmetical operations and storing elements are
becoming increasingly important in drive systems. This functionality is available as a "Free
function blocks" function module (FBLOCKS) on the drive object type of the SINAMICS DCM.
General remarks
• Exact information on the scope of the blocks, about parameter assignment and about
commissioning the free function blocks is available in the "SINAMICS" Free function blocks"
manual. This chapter describes the special features of the free function blocks with SINAMICS
DCM.
• This additional functionality increases the CPU time load. That means the maximum possible
configuration with a Control Unit may be restricted.
• The free function blocks are restricted in their scope to 52 blocks per drive object (DO).
Furthermore, the unassigned function blocks as compared to DCC cause a significantly
higher CPU time load.
If an application with free function blocks cannot be implemented, then the DCC technology
option is available, see Chapter "Drive Control Chart (DCC) (Page 635)".

• In the SINAMICS DCM, simultaneous use of the free function blocks and the DCC technology
option are feasible.
• With the SINAMICS DCM, parameters that specify scaled variables have the unit "Percent".
With free function blocks, parameters that specify scaled variables have no dimension. When
setting parameter values, the unit of the parameter must always be taken into account. The
unit is specified in the List Manual and is displayed in STARTER and on the AOP30.
Remark:
The relationship between percent variables and dimensionless variables is 100%
corresponds to 1.00.
The conversion is performed according to the formula: Y=X/100%.
X..percent variable
Y..dimensionless variable
Example: The fixed value r52401 is used as the input value of the limit monitor
(p20266 = 52401). p50401 and r52401 both have the unit "%". If the value "50 %" is
specified at p50401, the value "50 %" appears at r52401. The value "50%" (= 0.5) is therefore
effective as the input signal X of the limit monitor. If a mean interval value of 50% is to be set,
then p20267 = 0.5 must be set because parameter p20267 is dimensionless and the
relationship 50% = 0.5 applies.
CPU time load through free function blocks with the SINAMICS DCM
Processing free function blocks requires considerable computation time. If little CPU time
remains, you have to check whether all the activated function modules are required and whether
all the function blocks used need to be computed within the same sampling time.
The CPU time load can be reduced by either deactivating function modules or assigning used
function blocks to a runtime group with a longer sampling time.
Table 10-103 CPU time load through free function blocks with the SINAMICS DCM
Time slice Number of free function blocks CPU time load

16 ms 52 +30 %
8 ms 23 +30 %
5 ms 12 +30 %
4 ms 6 +30 %
2 ms 3 +30 %

10.35 Drive Control Chart (DCC)
Notes regarding the CPU time

• The actual CPU time load of the CUD can be read out in r9976. Please refer to the Chapter "CPU
time load with SINAMICS DCM (Page 630)" for more information about the CPU load on the
SINAMICS DCM.
• To make your own calculations, the illustrated CPU time loads can be taken to be "linear". This
means that:
– half as many blocks in the same time slice generate half as much CPU time load, etc.
– the same number of blocks in time slices half as fast generate half as much CPU time load,
etc.
• Each individual free function block can be assigned to a runtime group via parameter (e.g.
p20032). Ten runtime groups are available. Every runtime group can be assigned a time slice
using p20000.
– The time slices that can be selected with p20000 = 1 to 1096 are calculated
asynchronously to the closed-loop control functions.
– The time slice that can be selected with p20000 = 9003 is that time slice, in which the
setpoint channel (function diagrams 3105 to 3155) is calculated. One of the free function
blocks assigned to this time slice is immediately calculated before the functions of the
setpoint channel.

For complex applications that cannot be implemented with the free function blocks, the DCC
technology option is available. With DCC, a function diagram can be graphically created, which
comprises elementary function blocks that are interconnected with one another, and which can
then be loaded into the SINAMICS DCM.
The following steps are required to implement an executable DCC control with the SINAMICS
DCM:
1. Installation of STARTER and a DCC license on the PC
2. Loading the DCC technology option on to the memory (ROM) in the drive unit.
3. Configuring a DCC chart on the PC (DCC editor)
4. Compile the DCC chart on the PC and load it to the drive
Information
• Detailed information on the function blocks is contained in the "SINAMICS SIMOTION
Function Manual DCC Block Description" as well as in the "SINAMICS SIMOTION Programming
Manual DCC Editor". This chapter describes the special features of the DCC technology option
with SINAMICS DCM.
• Simultaneous use of the free function blocks and the DCC technology option are feasible.

• This additional functionality through DCC increases the CPU time load. That means the
maximum possible configuration with a Control Unit may be restricted.
• Before you load a STARTER project with DCC chart into the drive, you must load the DCC
technology option into the memory of the drive unit (see the following Chapter). If you
attempt to load a DCC chart into the drive, although the DCC technology option is not
available in the drive, then the drive signals a fault.
To eliminate this fault, you have the following options:
1. Now install the DCC technology option as described in the following Chapter. Then, carry out a
POWER OFF / ON. Now load the STARTER project including the DCC chart into the drive.
2. Delete the DCC chart from the STARTER project and load the project into the drive without DCC
chart.
3. Carry out a "Restore factory settings".
4. Carry out a POWER OFF / ON.
10.35.1 Loading the DCC technology option into the drive unit memory
Loading the DCC technology option into the drive unit is usually performed with STARTER and
with the SINAMICS DCM takes about 10 min. During this process, the entire DCB library with a
scope of approx. 2 MB data is transferred to the drive.

To avoid problems associated with an inserted/uninserted memory card before or during

online loading, the SINAMICS DCM supports an alternative option for transferring the DCB
library to the drive.
• Step 1
In STARTER, open a project that includes a SINAMICS DCM with at least one DCC chart. In the
shortcut menu (right mouse button), select "Load into file system" (only possible in the
offline mode).
Figure 10-104 Loading into the file system
• Step 2
A dialog, "Load into file system", opens. Choose "Select target" and select an empty folder on
a local hard drive.
• Step 3
After a folder has been selected, STARTER copies the DCB library into this local folder. 2 folders
named "OEM" and "USER" are created.

• Step 4
Copy the OEM folder to an empty memory card.
Note
The memory card supplied from Siemens as option S01 or S02 includes, when supplied, a
dump of the internal device firmware. These files are only required to update firmware.
These files can be deleted for all other applications of the memory card. Copy the files into a
local folder of your PG/PC and delete the files on the memory card, before you use the card
for the functions described in this chapter.
• Step 5
Insert the CompactFlash Card into the switched-off drive and switch on (POWER ON). The
DCB library is copied into the non-volatile memory (ROM) in the drive during power-up. The
process is complete as soon as the power-up has ended (operating state 7.0 reached).
• Step 6
Switch device off/on (POWER OFF / POWER ON). After the new power-up, the DCC is ready.
• Repeat steps 5 and 6 on additional SINAMICS DCM drives.
Note
If DCC is installed in the drive, the power-up time increases by approx. 10 s.
Note
This procedure does not transfer the STARTER parameter assignments into the unit. In order to
transfer the parameter assignments from STARTER into the drive, the "Load into the target
system" function must be run in STARTER.
10.35.2 CPU time load through DCC

Calculating the DCC blocks requires CPU time. If the CPU time becomes meager, you have to
check whether all the activated blocks are required and whether all the function blocks used
need to be computed within the same sampling time.
The CPU time load can be reduced by either deactivating blocks or assigning used blocks to a
runtime group with a longer sampling time.
A list of all of the DCC blocks available for SINAMICS DCM and the required computation
times are listed in Appendix B.
Table 10-104 CPU time load DCC blocks left-hand CUD.
Time slice Number of blocks 1) CPU time load

1 ms 50 +30%
2 ms 100 +30%
4 ms 200 +30%
6 ms 300 +30%

Time slice Number of blocks 1) CPU time load

8 ms 400 +30%
16 ms 800 +30%
1)
This information applies to a left-hand CUD without additional options. These options increase the
basic load of the CUD and reduce the available CPU time for the DCC blocks. Please refer to the "CPU time
load with the SINAMICS DCM" chapter for more information about the CPU load.
In this information, an average complexity of the blocks being used is assumed. If only highly
complex or very simple blocks are computed, the stated limit shifts accordingly.
Notes
• The actual CPU time load of the CUD can be read out in r9976. Please refer to the "CPU time
load with SINAMICS DCM (Page 630)" chapter for more information about the CPU load on
the SINAMICS DCM.
• To make your own calculations, the previously illustrated CPU time loads can be taken to be
"linear". This means that:
– half as many blocks in the same time slice generate half as much CPU time load, etc.
– the same number of blocks in time slices half as fast generate half as much CPU time load,
etc.
Examples
1. In the 1 ms time slice, 50 blocks generate about 30 % additional CPU time load. For that
reason, 50 blocks in the 2 ms time slice generate about 30 % × 0.5 = 15 % additional CPU time
load.
2. In the 7 ms time slice, (300 + 400) / 2 = 350 blocks generate about 30 % additional CPU time
load. That means 250 blocks generate 250 / 350 × 30 % = 21.5 % additional CPU time load.
10.35.3 Memory load through DCC

Along with the CPU time load, the memory load of the processor must also be considered when
designing a closed-loop control with the DCC technology option. A higher number of
configured DCC blocks and @parameters also more highly loads the internal memory (ROM) of
the CUD.
For using DCC, on the SINAMICS DCM, as compared with the maximum possible
configurations documented in the "Maximum configuration" chapter, depending on the
size of the diagram, one must omit optional components. The number of blocks and the
@parameters are decisive.

For one CUD without additional options, the following rules apply.
Table 10-105 Maximum number of DCC blocks and @parameters
Drive object Number of DCC blocks and @parameters

CU_DC 800
DC_CTRL 600
Note
The specified maximum numbers for blocks and @parameters always apply for the entire drive
unit and should be regarded as guide values. The CUD is completely utilized with 800 DCC blocks
and @parameters on the DO CU_DC or 600 DCC blocks and @parameters on the DO DC_CTRL.
Conserving @parameters has little effect on the quantity structure of the blocks; the specified
maximum numbers for the blocks should therefore not be exceeded.
On the DO DC_CTRL, due to the large number of drive parameters, fewer DCC blocks can be
computed than on the DO CU_DC.
In addition, the memory is loaded by optional components as follows:
Table 10-106 Additional memory load through optional components
Component Additional memory load

(expressed in DCC blocks)
AOP30 - 200 blocks
TM31 - 150 blocks
TM15 - 150 blocks
TM150 - 150 blocks
SMC10, SMC30 - 25 blocks
CBE20 - 25 blocks
The final limits are determined by the total memory available on the CUD. If the previously-
mentioned recommended maximum limits are exceeded, this can result in errors during
upload or download (e.g. fault F1105: CU memory insufficient) and the drive can no longer
be switched on; POWER OFF/ON must be performed on the drive unit.
Sample calculation:
The SINAMICS DM is equipped with one AOP30 and two TM31 modules. The DCC diagram is
to be computed on the DO DC_CTRL.
→ 600 – 200 – 2×150 = 100 DCC blocks can be computed on the DO DC_CTRL.
Notes:
• If there is insufficient memory on the CUD for the configuration of the desired DCC diagram,
the scope of the blocks needs to be reduced or the SINAMICS DCM needs to be equipped with
a 2nd CUD inserted in the right-hand slot.
• The computation rules stated previously also apply to the CUD on the right-hand slot.
• In most cases, the CPU time load of the CUD becomes the limiting factor when designing the
DCC application and not the memory load.

10.35.4 Backing up the DCC diagrams

A DCC project comprises two parts.
1. Information about the type, time slices and interconnection of the DCB blocks
2. Information about the layout and graphics in the DCC charts
When downloading the DCC chart to the drive (download to the target system), only the
information about the type, time slices and interconnection of the DCB blocks (Point 1) are
downloaded to the drive.
The DCC charts can also be saved in the target device by selecting the option “Store
additional data on the target device”. This is recommended if the DCC charts will also be
opened by another PG.
A further prompt appears after selecting the "Download to Target System" window. The DCC
charts are also saved when both checkboxes are activated.
The following prompt appears when selecting "Load to PG" later:
If the checkbox is activated, the DCC charts in the project are overwritten by those in the
target device.
The information about layout and graphics in the DCC charts (Point 2) is still available in the
STARTER project.

10.36 Write and know-how protection

In order to protect your own projects against changes, unauthorized viewing or copying, the
"Write protection" and "Know-how protection" (KHP) functions are available.
Protection Validity Objective Effect

Write protec‐ Online Protection of the parameterization against p-parameters can be read,
tion inadvertent changes by the user. but cannot be written.
Know-how pro‐ Online Protection of intellectual property, espe‐ p-parameters can neither
tection cially the know-how of the machine man‐ be read nor written.
ufacturers, against unauthorized use or re‐
production of their products.
10.36.1 Write protection

Write protection prevents settings from being inadvertently changed. No password is required
for write protection.
Setting up and activating write protection

1. Connect the Control Unit to the programming device.
2. Call STARTER.
3. Download your project.
4. Establish a connection to the target device.

5. Select the required drive unit in the project navigator of your STARTER project.
6. Call the shortcut menu "Write protection drive unit > Activate".
Figure 10-105 Activating write protection
Write protection is now activated. In the expert list you can recognize that write protection
is active by the fact that the entry fields of all adjustable parameters are shown with gray
shading.
In order to permanently transfer your setting, after changing write protection, you must carry
out the "RAM to ROM" data save operation.
Note
Know-how protection with active write protection
If write protection is active, the know-how protection setting cannot be changed.
Note
Access via fieldbus
Per default, in spite of write protection, parameters can be changed via fieldbusses with
acyclic access. If write protection should also be active for access operations via fieldbusses,
then in the expert list, you must set p7762 to 1.

Deactivating write protection

2. Call STARTER.
3. Download your project.
6. Call the shortcut menu "Write protection drive unit > Deactivate".
The hatching in the expert list disappears after deactivation. The parameters can be set
again.
Parameters without write protection

Certain parameters are excluded from the write protection in order not to restrict the
functionality and operability of the drives. The list of these parameters can be found in the
SINAMICS DCM List Manual in Chapter "Parameters for write protection and know-how
protection", Section "Parameters with WRITE_NO_LOCK".
The "Restore factory settings" function can also be used when write protection is activated.
10.36.2 Know-how protection
The "Know-how protection" function prevents, for example, confidential company know-how
for configuration and parameter assignment from being read by unauthorized persons.
The know-how protection requires a password. The password must comprise at least 1 and a
maximum of 30 characters.
Note
Password security
You are responsible for the security of your password. Whenever possible, use a password with
sufficient length (min. eight characters); use upper- and lower-case letters and special
characters.
The know-how protection is a pure online function. Therefore, establish a direct connection
to the Control Unit before setting the password.
Characteristics when know-how protection is activated

• Except for a small number of system parameters and the parameters specified in an exception
list, all other parameters are locked. In the expert list, the value of these parameters cannot
be read or changed.
• In the expert list of STARTER, the text "Know-how protected" is displayed for the locked
parameters instead of the parameter values.

• Know-how protected parameters of the expert list can be hidden in the "Online value of the
Control Unit" drop-down list via the entry "Without know-how protection".
• The values of display parameters remain visible.
• The contents of screen forms are not displayed when know-how protection is active.
• Know-how protection can be combined with copy protection.
Functions locked using know-how protection

The following listed functions are inhibited when know-how protection is active:
• Download
• Trace function
• Function generator
• Deleting the alarm history
• Creating acceptance documentation
Functions that can only be partly executed with know-how protection

The following listed functions can only be partly executed when know-how protection is active:
• Displaying the topology (actual topology only)
• Upload (restricted scope; see Chapter "OEM exception list (Page 647)")
Functions that can be executed for know-how protection

The following listed functions can still be executed despite of the fact that know-how protection
is activated:
• Restoring factory settings
• Acknowledging alarms
• Displaying alarms and warnings
• Displaying the alarm history
• Reading out the diagnostic buffer
• Switching over to the control panel (fetch the master control, all the buttons and setting
parameters)
• Displaying created acceptance documentation
Parameters that can be changed when know-how protection is active

In spite of active know-how protection, certain parameters can be changed and read. The list of
these parameters can be found in the SINAMICS DCM List Manual in Chapter "Parameters for
write protection and know-how protection", Section "Parameters with KHP_WRITE_NO_LOCK".

Parameters that can be read when know-how protection is active

In spite of know-how protection being active, additional parameters can be read, but are locked
against changes. The list of these parameters can be found in the SINAMICS DCM List Manual in
Chapter "Parameters for write protection and know-how protection", in Section "Parameters
with KHP_ACTIVE_READ".
Note
Password check for know-how protection
Please note that if the language settings are changed in Microsoft Windows, after activating
know-how protection, errors can occur when subsequently checking the password. If you use
language-specific special characters, you must ensure that the same language setting is active
on the computer for subsequent entry of the password.
Note
Data security of the memory card
After setting up and activating the know-how protection, for encrypted data backup on the
memory card, previously backed up, non-encrypted data of the SINAMICS firmware will be
deleted. This is the standard deletion procedure, in which only the entries on the memory card
are deleted. The data itself is still available and can be reconstructed.
To ensure know-how protection, we recommend the use of a new empty memory card. If you
cannot obtain a new memory card in the short term, you should delete all safety-related data on
the current memory card.
To completely delete your previous data on the memory card, you must reliably delete this data
using a suitable PC tool before activating know-how protection. The data is located on the
memory card in the "\\USER\SINAMICS\DATA" directory.
Note
Diagnostics under know-how protection
If service or diagnostics is to be performed when know-how protection is active, then Siemens
can only provide support in collaboration with the OEM partner.
10.36.2.1 Copy protection
Features of the activated copy protection

Copy protection prevents project settings from being copied and transferred to other Control
Units.
Additional features include:
• Copy protection can only be activated in conjunction with the know-how protection (see
Chapter "Activating know-how protection (Page 648)").
• When copy protection is activated, the memory card and Control Unit are connected with one
another and only function together.

• The copy protection prevents the use of each memory card with copied data of one Control
Unit in another Control Unit.
• With the exception of the DCC library, the copy-protected data on the memory card cannot
be read or copied. If a copied memory card is used, a copy protection error is displayed and
a pulse inhibit set.
10.36.2.2 Configuring know-how protection
Requirements
Before activating know-how protection, the following conditions must be met:
• The drive unit has been fully commissioned.
(Configuration, download into the drive unit, complete commissioning. You have then
carried out an upload in order to upload the parameters calculated by the drive into the
STARTER project.)
• The OEM exception list has been created (see below).
• To guarantee know-how protection, you must ensure that the project does not remain at the
end user as a file.
Creating the OEM exception list

Before activating the know-how protection, enter the parameters in this exception list that are
to remain readable and writable despite the know-how protection. The exception list can only
be created via the expert list. The exception list has no influence on the input screen forms in
STARTER.
Factory setting for the exception list:
• p7763 = 1 (exception list contains precisely one parameter)
• p7764[0] = 7766 (parameter number for entering the password)
Procedure
1. Use parameter p7763 to define the required number of parameters for the exception list.
You can enter a maximum of 500 parameters in the exception list.
2. Execute the "Load to PG" function.
Parameter p7764 is adapted in the expert list according to the setting in p7763. Indices are
inserted or deleted depending on the setting.
3. In parameter p7764[0...n], assign the individual indices of p7763 to the required parameter
numbers.
4. Transfer the changes to the Control Unit so that they can become effective.
Note
Parameters of the exception list are not checked
The Control Unit does not check which parameters you include or delete in the exception list.

Absolute know-how protection

By removing parameter p7766 from the exception list of p7764[0] = 0, you prevent any access
at all to the data of the Control Unit and your project settings. It is then impossible to read or
change the protected data. The know-how protection and the copy protection can no longer be
canceled or deactivated.
Activating know-how protection

2. Call STARTER.
3. Open your project.
6. In the shortcut menu, select "Drive unit know-how protection > Activate".
The "Activate Know-how Protection for Drive Object" dialog box opens.
Figure 10-106 Activating
The "Know-how protection without copy protection" option is active by default.

7. If you want to activate the copy protection in addition to know-how protection, click the
"Know-how protection with copy protection" option.
8. Click "Specify".
The "Know-how Protection for Drive Object - Specify Password" dialog box opens.
Figure 10-107 Setting the password

9. In the "New password" field, enter the password (1 to 30 characters). Pay attention to upper-
and lower-case.
10.Enter it again in the "Confirm password" field and click "OK" to confirm the entry.
The dialog box is closed and the password is shown in encrypted form in the "Activate Know-
how Protection for Drive Object" dialog box.
The "Copy RAM to ROM" option is active by default and ensures that the know-how protection
is permanently stored in the Control Unit. If you only want to activate the know-how
protection temporarily, you can deactivate this option.
11.Then click "OK".
Know-how protection is now activated. The text "Know-how protected" is in all protected
parameters of the expert list instead of the content.
Deactivating know-how protection

2. Call STARTER.
6. In the shortcut menu, select "Drive unit know-how protection > Deactivate"
The "Deactivate Know-how Protection for Drive Unit" dialog box opens.
Figure 10-108 Deactivating

7. Select whether you want to deactivate the know-how protection "Temporarily" or

"Permanently" by clicking the corresponding checkbox.
– "Temporarily" deactivating: Know-how protection is active again after switching off and
switching on.
– "Permanently" deactivating: Know-how protection remains deactivated even after
switching off and switching on again.
If you select "Permanently", you can also carry out a data backup on the Control Unit with
"Copy RAM to ROM". The checkbox with the same name is active in this case and is
automatically activated. If you deactivate this checkbox, you must perform a manual "RAM
to ROM" data backup later if the know-how protection remains deactivated after switching
off and on.
8. Enter your password, and click "OK".
Know-how protection is now deactivated. The values of all parameters are displayed again in
the expert list.
Changing the password

A password can only be changed when know-how protection is activated.
To change the password for the know-how protection, proceed as follows:
2. Call STARTER.
5. Call the shortcut menu "Drive unit know-how protection > Change password".
The "Change Password" dialog box opens.
Figure 10-109 Changing the password
6. Enter your old password in the uppermost text box.

7. Enter your new password in the following text box and repeat it in the lowest text box.
The "Copy RAM to ROM" option is active by default and ensures that the new password for the
know-how protection is permanently stored in the Control Unit. If you only want to change
the password temporarily, you can deactivate this option.
8. Click "OK" to close the dialog box.
Once the password has been changed successfully, you will receive a confirmation.

10.36.2.3 Loading know-how protected data to the file system
Data with know-how protection can be directly loaded or saved to the file system from the drive
unit. The activated know-how protection ensures that the data cannot be forwarded to
unauthorized third parties.
The following applications are conceivable at the end user:
• Adaptations of encrypted SINAMICS data are required.
• The memory card is defective.
• The Control Unit of the drive is defective.
In these cases, the OEM can create a new encrypted subproject (for a drive object) via
STARTER. The serial number of a new memory card or a new Control Unit is saved in this
encrypted data record in advance.
Application example: Control Unit is defective
Scenario:
The Control Unit of an end user is defective. The machine manufacturer (OEM) has the end
user's STARTER project files of the machine.
Sequence:
1. The end user sends the OEM the serial numbers of the new Control Unit (r7758) and the new
memory card (r7843), and specifies the machine in which the Control Unit is installed.
2. The OEM loads the STARTER project data of the end user.
3. The OEM performs the STARTER function "Load to file system" (see Chapter “Save data to the
file system (Page 651)”).
– The OEM specifies whether the data is to be stored zipped or unzipped.
– The OEM makes the required know-how protection settings.
– The OEM enters the serial numbers of the memory card and the new Control Unit.
4. The OEM sends the stored data to the end user (e.g. by e-mail).
5. The end user copies the "User" directory to the new memory card and inserts it into the new
Control Unit.
6. The end user switches on the drive.
When powering up, the Control Unit checks the new serial numbers and deletes the values
p7759 and p7769 if they match.
After it has powered-up without any errors, the Control Unit is ready for operation. The know-
how protection is active.
If the serial numbers do not match, then fault F13100 is output.
If required, the end user must re-enter the changed parameters from the OEM exception lists.
Calling the "Load to File System" dialog box

1. Call STARTER.
2. Open the required project.

4. Call the "Load to file system" function.
The "Load to File System" dialog box opens.
Figure 10-110 Load to file system (default setting)
Specifying the general memory data

The "General" tab is displayed automatically when the dialog is called. The "Save normally"
option is activated by default.
1. If you want to save the data in compressed form, click the "Save compressed (.zip archive)"
option button.
The "Store additional data on the target device" option is deactivated in the default setting.
2. If you want to store additional data, such as program sources, on the target device, activate
this option.
Optionally you can also activate "Including DCC chart data". Graphical chart data can then
also be stored.
3. Then enter the path for the storage directory in the appropriate input field, or click "Browse"
and select the directory in your file system.

Configuring know-how protection

Make the settings for the know-how protection on the "Drive unit know-how protection" tab.
1. Click the "Drive unit know-how protection" tab.
Figure 10-111 Load to file system know-how protection
By default, the "Without know-how protection" option is active. If you really want to store the
data without protection (not recommended), you can exit the dialog box with "OK" or
"Cancel" at this point.
2. If you want to save with protection, activate the "Know-how protection without copy
protection" or "Know-how protection with copy protection" option.
Figure 10-112 Activating load to file system know-how protection

The input fields are then active. Without copy protection, only the input fields for password
input are active. With copy protection, the two input fields for the serial number are also
active. Generally, the entries in the input fields are shown in encrypted form.
3. Enter the required password in the "New password" field and enter it again in the "Confirm
password" field.
4. Enter the serial number of the new memory card for which the data is intended.
If you have selected the "Know-how protection with copy protection" option, the input of the
Control Unit serial number is also obligatory.
5. In this case, also enter the serial number of the Control Unit in the appropriate input field.
6. Click "OK" to confirm the settings you made.
Result
The data of the subproject is stored in the required encryption in your file system. With the aid
of this encrypted data, an end user can install a new memory card or Control Unit for the drive
unit.
10.36.3 Overview of important parameters
• r7758[0...19] KHP Control Unit serial number

• p7759[0...19] KHP Control Unit reference serial number
• r7760 Write protection / know-how protection status
• p7761 Write protection
• p7762 Write protection multi-master fieldbus system access behavior
• p7763 KHP OEM exception list number of indices for p7764
• p7764[0...n] KHP OEM exception list
• p7765 KHP memory card copy protection
• p7766[0...29] KHP password input
• p7767[0...29] KHP password new
• p7768[0...29] KHP password confirmation
• p7769[0...20] KHP memory card reference serial number
• r7843[0...20] Memory card serial number

Maintenance 11
WARNING
Not observing fundamental safety instructions and residual risks
The non-observance of the fundamental safety instructions and residual risks stated in Chapter
1 can result in accidents with severe injuries or death.
• Adhere to the fundamental safety instructions.
The SINAMICS DCM Control Module must be provided with extensive protection measures
against contamination in order to prevent voltage flashovers and, therefore, destruction.
Dust and foreign bodies must be thoroughly removed at given intervals depending on the
level of soiling and certainly at least once every 12 months. The unit must be blown out with
dry compressed air at a maximum of 1 bar, or cleaned using a vacuum cleaner.
The screw connections (also the protective conductor connections) must be retightened each
time that the SINAMICS DCM Control Modules are maintained.
11.1 Upgrading the device firmware

This chapter describes how you can upgrade a drive – including STARTER project – from one
firmware version to a higher firmware version (e.g. V1.1 to V1.2).
Basic information
The following steps are necessary:
• Upgrading the device firmware
– Step 1: Backup the configuration
– Step 2: Firmware update of the drive (incl. I/O)
– Step 3: Update the STARTER project
– Step 4: Load into the target system, RAM to ROM
• Upgrade the DCC technology option (optional)
– Step 5: Update the DCC technology option (DCBLIB) and the DCC charts
– Step 6: Load into the target system, RAM to ROM

Maintenance
Note
A memory card is required for the firmware update (see Chapter “Ordering information for
options and accessories (Page 32)”).
When updating the firmware, always proceed as follows:

1. Firmware update of the drive
– Insert the memory, then switch the electronic power supply OFF and ON again. The
device firmware is now installed.
– Switch the electronic power supply OFF and ON again. The device firmware just installed
now powers up.
If neither a CBE20 nor DRIVE-CLiQ components are available, the drive is ready for
operation.
However, if a CBE20 or DRIVE-CLiQ components or both are available, the firmware of
these components is updated during the power-up of the device firmware. At the end of
the power-up of the device firmware, the DRIVE-CLiQ components indicate that a restart
is required through flashing red LEDs. Alarm A1006 also appears. Switch the electronic
power supply OFF and ON again a third time.
– If only a CBE20 is connected, there is no indication after the second OFF and ON that the
CBE20 also requires a restart so that the CBE20 firmware installed in the previous step is
also started. However, a third OFF and ON of the electronic power supply is also required
in this case.
2. Update the STARTER project
3. Load the converted STARTER project to the drive (load to the target device)
Do not proceed as follows:
1. Firmware update of the drive
2. Create a NEW STARTER project
3. Load into the PG
In this case, under certain circumstances, STARTER cannot assign the project to the correct
drive version. If the STARTER project is not available, generate a new project with the old
device version (load into the PG before the firmware update) and then proceed as normal.
11.1.1 Upgrading the device firmware
Note
Hardware/firmware compatibility
The hardware version of the Control Unit (CUD) must be taken into account when updating the
device firmware. See the table below.
The hardware version can be read from the label on the right-hand side of the CUD.

Maintenance
CUD (print on label) Executable firmware versions

C98043-A7100-L1-... 1.1, 1.2, 1.3
C98043-A7100-L2-...
C98043-A7100-L100-...
C98043-A7100-L200-...
C98043-A7100-L3-... All versions
C98043-A7100-L4-...
C98043-A7100-L103-...
C98043-A7100-L204-...
A5E... All versions
Step 1: Backup the configuration

The drive parameter assignment is not lost while updating the firmware. Nevertheless, before
starting the firmware update, back up the drive configuration:
• Backup the parameter assignment on a memory card (see Chapter "Functions of the memory
card") and/or
• Backup the parameter assignment in a STARTER project (see Chapter “Commissioning with
the STARTER commissioning tool (Page 259)”)
Step 2: Firmware update of the drive

Notes:
Only those memory cards that Siemens has prepared for these systems are accepted.
If the memory card is formatted, then this must always be realized with the FAT16 setting.
Download the current firmware version: See preface
Procedure:
1. Unzip the *.zip file to an empty memory card
2. Insert the card in the drive, which has been switched-off, and switch the device on again. A
firmware update is being performed. The update has been completed if the RDY-LED and the
DP1-LED flash at 0.5 Hz (the update takes about 12 min).

Maintenance
3. Carry out a POWER OFF. Remove the memory card from the drive.
NOTICE
Removing the memory card before POWER ON
If the memory card is not removed from the drive before the POWER ON, the
parameterization in the drive is copied to the memory card when running up, or a
parameterization already on the card copied to the drive.
For a detailed description of this function, see Chapter "Memory card functions (Page 329)",
Section "Copying parameter data sets from non-volatile memory to the memory card".
4. Carry out a POWER ON. The new firmware is now active.

If a memory card is already in the drive, the following mechanism described in Chapter
"Memory card functions (Page 329)", Section "Copying parameter data sets from non-volatile
memory to the memory card" takes effect.
– The connected TM modules and/or SMC10 or SMC30 carry out a firmware update when
running up for the first time.
After the firmware update of these components, it is necessary to carry out a POWER OFF /
POWER ON for these components. The memory card no longer needs to be inserted for
this step.
– An optionally connected AOP30 indicates that new AOP firmware is available. Confirm the
prompt after the update with "OK".
Note
As a result of the device firmware update, DCC charts in the device are not automatically
upgraded to the new DCC version. This is also not absolutely necessary. See also Step 5 (next
chapter).
Note
The electronic power supply must not be interrupted during the firmware update, otherwise the
update will need to be restarted.
Note
To safely remove the memory card, see Chapter "Memory card functions (Page 329)".
Step 3: Update the STARTER project

Install the SSP that matches the new firmware version (e.g. SSP SINAMICS DCM V1.5).
SSPs for different versions of the same drive can be simultaneously installed in STARTER.
Open the existing STARTER project (that refers to an old device version). Right-click the
device in the project navigator and select "Target device" → "Device version…". Select the

Maintenance
new device version and confirm with "Change version". The project is converted to the new
device version.
Note
STARTER does not support a "downgrade" of the firmware version (e.g. V1.2 to V1.1).
Step 4: Load into the target system, RAM to ROM

Load the project into the drive (load into the target system) and permanently save the parameter
assignment (carry out RAM to ROM).
11.1.2 Upgrading the DCC technology option
Step 5: Update the DCC technology option (DCBLIB) and the DCC charts
It is not absolutely necessary to upgrade the DCC library. Only upgrade the DCC library if you wish
to use functions that the old DCC library does not support.
It is only possible to upgrade the DCC library via the associated STARTER project. While
upgrading, it is not permissible that there is a DCC chart in the drive.
After you have upgraded the unit firmware according to the previous chapter, update the
DCC technology option as follows:
1. Establish a connection to the drive using STARTER.
2. Delete the parameter assignment and DCC charts in the drive, by setting p0976 = 200. After
deleting, the parameterization including the DCC charts only exist in STARTER.
3. After the system was reset via p0967 = 200, re-establish a connection to the drive via
STARTER.

Maintenance
4. Import the new DCC library (see Chapter "Drive Control Chart (DCC) (Page 635)")
Figure 11-1 Selecting technology packages

Maintenance
5. Carry out a POWER OFF / POWER ON to activate the new DCC library.
6. Convert the existing DCC charts
– Open the DCC editor by double clicking on the DCC chart.
– In the DCC editor, in the menu, select "Options" → "Block types…"
– Answer the question "Do you wish to update the block types in the DCC editor" with "OK".
Figure 11-2 Importing the DCC library (1)
– Shift the DCC library, which appears in the left-hand window, to the right with ">>".
Figure 11-3 Importing the DCC library (2)
– Select "Apply".
– The chart is compiled into the new version

Maintenance
11.2 Replacing the CUD
– Perform these steps for all DCC charts which are in the drive.
Step 6: Load into the target system, RAM to ROM

Load the project into the drive (load into the target system) to upgrade the charts in the drive to
the new version and permanently save the parameter assignment (carry out RAM to ROM).
Note
The information regarding electrostatic sensitive devices must be carefully observed. See
Chapter "ESD-sensitive components (Page 27)".
NOTICE
Use the supplied mounting aid
The module is equipped on both sides with highly sensitive components that can be damaged
if installed incorrectly.
• It is therefore essential that you use the supplied mounting aid (protective cover) when
installing and removing the CUD.
Required tools
Torx screwdrivers TX10 (CUD) and TX20/TX30 (front cover).

Maintenance
Removing the CUD

Figure 11-4 Removing the CUD
1. If available, remove the memory card ①.

2. Release the shield clamp ②.
3. Remove the Connector Board ③. The connection wires remain in the terminals.
4. If a CBE20 module is being used, then remove the PROFINET cable.
5. Release all the plug connections on the CUD.
6. Remove the support element ④ (only for the standard CUD).
To do this, remove the 4 fastening screws ⑤ of the support plate for the CUD.
Tilt the support plate for the CUD through 90 ° to the left ⑥.
When unscrewing the support element, you can hold the nuts on the lower side of the
support plate.
7. Release the 4 CUD fastening screws ⑦.

Maintenance
8. Move the mounting aid provided between the CUD and the mounting bolts.
NOTICE
Damage to the CUD if incorrectly removed
There are sensitive components on the rear of the CUD that may be torn off or damaged by
coming into contact with the mounting bolts when withdrawing the CUD without the
mounting aid.
• After removing the screws and before pulling out the CUD, the module must be raised
slightly and the supplied mounting aid (protective cover) inserted between the CUD and
the assembly bolts in order to prevent any damage to the CUD to be replaced.
9. Carefully withdraw the CUD to the right ⑧.
Installing the CUD

Figure 11-5 Installing the CUD
1. Insert the mounting aid ⑨ so that the mounting bolts located below are covered.
2. Position the new CUD at an angle of between 10° and 15° at the connector and align it so that
it is parallel with the side panel ⑩.
3. Fix the CUD by applying pressure to the connector strip ⑪.
4. Withdraw the mounting aid ⑫.
5. Tighten the CUD fixing screws (1 Nm).
6. Mount the support element on the CUD support plate, tighten the nuts by hand.
7. Tighten the CUD support plate screws (1.5 Nm).
8. Install all the plug connections withdrawn when removing the old CUD.

Maintenance
11.3 Replacing the back-up battery in the AOP30 operator panel
9. Mount the Connector Board.

10.Fix the operator panel holding bracket.
Replacement/installation of a CUD in the right slot

A CUD is installed in the right slot in the same way as in the left slot.
For simple handling, it is recommended that you swing out the electronics plate slightly.
Make sure that the mounting bolts are reliably and securely covered by the mounting aid.
Table 11-1 Technical specifications of the backup battery
Type CR2032 3 V lithium battery

Manufacturer Maxell, Sony, Panasonic
Nominal capacity 220 mAh
Self-discharge at 20 °C 1 %/year
Service life (in backup mode) > 1 year at 70 °C; >1.5 years at 20 °C
Service life (during operation) > 2 years
Replacement
1. Disconnect the SINAMICS DCM from the power supply
2. Open the cabinet.
3. Disconnect the 24 V DC power supply and communications line on the operator panel.
4. Open the cover of the battery compartment.
5. Remove the old battery.
6. Insert the new battery.
7. Close the cover of the battery compartment.
8. Reconnect the 24 V DC power supply and communications line.
9. Close the cabinet.
Note
The battery must be replaced within one minute to ensure that no AOP settings are lost.

Maintenance
Figure 11-6 Replacing the backup battery for the cabinet operator panel
Note
The battery must be disposed of in accordance with the manufacturer guidelines and applicable
country-specific laws and directives.

Applications 12
12.1 Using SINAMICS DCM in shipbuilding
When using SINAMICS DCM in shipbuilding, the following points must be observed:
• Radio interference suppression filters must be used in the armature circuit and in the field
circuit (see Chapter "Connecting (Page 67)")
• For EMC-compliant installation, see Chapter “Connecting (Page 67)”.
• Use coated modules (option M08), see Chapter "Ordering information for options and
accessories (Page 32)".
12.2 Use of the SINAMICS DCM in galvanizing and dip-painting plants
WARNING
Danger to life when using the STO switch-off signal path of the SINAMICS DCM or the
functional safety application examples STO (Safe Torque Off) or SS1‑t (Safe Stop 1 time
monitored) as "emergency switching-off" function.
Using the STO switch-off signal path or using the application examples in Chapter "Functional
safety (Page 671)" as emergency switching-off function is not certified and when incorrectly
used can result in death or severe injury.
• Carefully note that the STO switch-off signal path and/or the application examples are not
certified for implementing the "Emergency switching off" function with the listed safety‑
and/or performance levels.
2Q devices are used when using the SINAMICS DCM in galvanizing, dip-painting or similar
plants.
2Q devices have a thyristor bridge in B6 circuit. In this power unit topology, the output
voltage of the SINAMICS DCM is partly negative for firing angles between 60° and 120°. In
order to ensure that no negative voltages are present at the load, i.e. at the galvanizing
and paint tanks, an external freewheeling diode is usually installed on the DC side for these
applications. This is not part of the SINAMICS DCM, but rather is installed in the control
cabinet.
8 & 6PRRWKLQJUHDFWRU

)UHHZKHHOLQJ
9 6,1$0,&6'&0
/RDG
4GHYLFH
GLRGH
: '
Figure 12-1 SINAMICS DCM, 2Q device with external freewheeling diode

Applications
12.2 Use of the SINAMICS DCM in galvanizing and dip-painting plants
Make sure that in this case, the current actual value sensing in the converter only measures
part of the load current, i.e. the current through the converter, not the freewheeling current.
This means that the SINAMICS DCM cannot control the load current.
8D W ZLWKRXWIUHHZKHHOLQJGLRGH &'
8D W ZLWKIUHHZKHHOLQJGLRGH &'
, W ZLWKIUHHZKHHOLQJGLRGH
&XUUHQWLQWRWKH
GHYLFH
)UHHZKHHOLQJ
FXUUHQW
/RDGFXUUHQW W
Figure 12-2 Voltage and current curves
In order to be able to control the load current, it is recommended that an external actual
current sensing circuit be used for these applications. Whereby, the entire load current
(including the freewheeling current) is measured via an external shunt. The shunt voltage
must be increased via an external shunt converter and then led to the SINAMICS DCM via an
analog input. See function diagram 6850, column 2.
6KXQW
FRQYHUWHU
8 ; &

)UHHZKHHOLQJ
6KXQW
9 6,1$0,&6'&0
/RDG
4GHYLFH
GLRGH
: '
Figure 12-3 SINAMICS DCM with external current actual value sensing
Parameter
p51852 Selection of external current actual value sensing

p51853 Scaling of external current actual value sensing

Applications
12.3 Using SINAMICS DCM as thyristor controller in heating applications
12.3 Using SINAMICS DCM as thyristor controller in heating

applications
Under certain preconditions, the SINAMICS DCM can be used as three-phase AC power controller
for heating applications.
This means that in some cases SIVOLT A three-phase AC power controllers can be replaced by
SINAMICS DCM converters.
More information
You can download more application examples from the Internet: Manuals and application notes
(https://support.industry.siemens.com/cs/ww/en/ps/13298)

Applications
12.3 Using SINAMICS DCM as thyristor controller in heating applications

Functional safety 13
For SINAMICS DCM, by means of an integrated STO switch-off signal path in conjunction with
only one main contactor and/or circuit breaker, safety requirement levels up to SIL 3 and PL e can
be achieved over the complete performance and power range.
In addition, control via a safety relay or F-PLC is necessary.
This provides a consistently uniform solution for safety requirements up to SIL 3 and PL e,
which also permits considerable savings in space, investment and service costs.
Note
Responsibility of the user for system design and the function
The products described here have been developed to implement safety-related functions as part
of a complete plant or machine.
A complete, safety-related system is generally equipped with sensors, evaluation units, and
signaling units, and uses reliable shutdown concepts.
It is the responsibility of the manufacturer to ensure that the system or machine is functioning
properly as a whole.
Siemens AG, its subsidiaries, and associated companies (hereinafter referred to as "Siemens")
are not in a position to guarantee every characteristic of a complete plant or machine not
designed by Siemens.
Nor can Siemens assume liability for recommendations that appear or are implied in the
following description. No new guarantee, warranty, or liability claims beyond the scope of the
Siemens delivery terms of supply are to be derived or inferred from the following description.

Functional safety
13.1 Emergency Off and Emergency Stop
WARNING
Danger to life when inadmissibly changing the firing pulse supply
The STO subfunction of SINAMICS DCM is based on shutting down the thyristor firing pulses.
All guaranteed properties of this function, e.g. provided in the operating instructions and TÜV
certificate, can only be guaranteed when the firing pulse supply of the thyristors remains
unchanged when compared to the state when it was initially delivered.
In particular, the following requirements and restrictions should be carefully observed so that
the guaranteed properties of the STO subfunction (functional safety) and the TÜV certificate
remain valid:
• The power unit must be connected as shown here in example 1: see Chapter "Division
options (Page 96)".
• It is not permissible that the firing pulse transformer module is modified in any way (e.g.
removed or split). It is not permissible to connect firing pulse transformers in parallel.
• It is not permissible that the control of the firing pulse transformer module by the Power
Interface (X21A, X22A) is in any way modified.
An external infeed of the 24 V supply voltage for the firing pulse transformer module is not
permissible.
Connections X21A and X22A between the Power Interface and the firing pulse transformer
module must be carefully routed to protect them against external voltages (spurious
interference).
• External firing pulse amplifiers are not permissible.
If this is not observed, then it is possible that the required safety- or performance level is no
longer reached. This can result in severe injury or death.
13.1 Emergency Off and Emergency Stop

"Emergency Off" and "Emergency Stop" are commands that minimize different risks in the
machine or plant.
The following table shows the basic differences between these two functions.
The STO function of the SINAMICS DCM is suitable for achieving an Emergency Stop but not
an Emergency Off.
Table 13-1 Difference between Emergency Off and Emergency Stop
Risk: Risk of electric shock: Risk of unexpected motion:
Measure to minimize Safe switch off Safely stop and safely prevent re‐
risk: Switching off the electric power supply starting
for the installation, either completely Stopping or preventing the dangerous
or partially. movement

Functional safety
13.2 Safety functions according to IEC 61800-5-2
Command: Emergency Off Emergency Stop

Solution: Switch off the power supply: Select STO:
An Emergency Stop function brings

about a torque-free state but not nec‐
essarily a de-energized state.
WARNING
Danger to life when using the STO switch-off signal path of the SINAMICS DCM or the
functional safety application examples STO (Safe Torque Off) or SS1‑t (Safe Stop 1 time
monitored) as emergency switching-off function.
With the STO switch-off signal path of the SINAMICS DCM in conjunction with a main contactor
or circuit breaker and the described functional safety applications example, the Emergency
Stop function can be implemented up to SIL 3 or PL e.
Using the STO switch-off signal path or using the application examples as emergency switching-
off function is not certified and when incorrectly used can result in death or severe injury.
• Carefully note that the STO switch-off signal path and/or the application examples are not
certified for implementing the "Emergency switching off" function with the listed safety‑
and/or performance levels.

With SINAMICS DCM, safety functions STO and SS1‑t according to IEC 61800‑5‑2 can be
implemented.
The basic properties of these functions are described in the following chapters.

Functional safety
13.2.1 Safe Torque Off (STO)
Y
672
W
Figure 13-1 Safe Torque Off (STO)
Safe Torque Off is a safety subfunction that immediately ensures that torque-generating
energy is not fed to the motor. This function corresponds to stop category 0 according to
IEC 60204‑1.
A switch-on inhibit, which prevents automatic restart after deactivating STO, must be
implemented by the upstream external monitoring and control system (e.g. 3SK1), according
to the requirements of IEC 60204-1, Chapter 9.2.5.
Typical applications
Applications include all machines and systems with moving axes (e.g. conveyor technology,
fans). STO allows personnel to safely work with a protective door open; for example.
13.2.2 Safe Stop 1 (SS1-t, time controlled)
Y
672
W
Figure 13-2 Safe Stop 1 (SS1-t, time controlled)
Safe Stop 1 (time controlled) causes the motor to be braked (this function is integrated in
the drive) - and after a specified time interval, the Safe Torque Off function is initiated. This
function corresponds to Stop Category 1 according to IEC 60204-1.
Typical applications
SS1-t can be used where it is not possible to bring a drive with a load to a standstill in a
sufficiently short time merely by switching off the energy supply (coasting down).

Functional safety
13.3 Safety functions of the SINAMICS DCM
13.3.1 Fundamentals and technical specifications
Technical fundamentals and data

From function release 04, SINAMICS DCM is equipped with an STO switch-off signal path.
No additional license is required for this function.
The certificate of TÜV Süd [German Technical Inspectorate] is available in
the Industry Online Support under entry ID 109762418 (Certificate (https://
support.industry.siemens.com/cs/de/de/view/109762418/en)).
Note
For older devices up to and including product version 03, it is not possible to retrofit functional
safety or safety function STO, and it has therefore not been released.
These devices are not included in the specified safety certificate.
For devices such as these, it is not permissible that safety function STO is used, for example, after
replacing or updating modules.
In conjunction with external safety relays (e.g. 3SK1 or 3SK2) and a redundant switch-off
signal path using power contactors or circuit breakers for the armature circuit as well as the
associated diagnostic paths, a "Safe Torque Off" (STO) or "Safe Stop 1 time controlled" (SS1‑t)
safety function can be achieved up to SIL 3 / PL e according to IEC 62061 or ISO 13849‑1.
Safety functions STO and SS1‑t encompasses three safety subfunctions:
1. Detect
Performed externally, e.g. by emergency stop button or other sensors
2. Evaluate
Performed externally, e.g. using a 3SK1 or 3SK2 safety relay
– Evaluation and diagnostics of the input / sensor circuits
– Logical interconnection of input signals as well as diagnostics and parameterization
– Controlling the switch-off signal paths
– Diagnostics of the switch-off signal paths via their feedback circuits
3. React
Performed by two separate channels with different technologies:
– Switch-off signal path channel 1 through the STO switch-off signal path of the DCM
– Switch-off signal path channel 2 through the line contactor or the circuit breaker of the
armature circuit

Functional safety
13.3.2 Performance characteristics of SINAMICS DCM for safety-related evaluation
Table 13-2 Safety-related key data of the SINAMICS DCM
Functional safety
MTTFD according to ISO 13849-1 500 years
Diagnostics coverage (DC) according to ISO 13849-1/IEC 61508 99%
Maximum installation altitude above sea level 4000 m 1)
T1 value for proof test interval or service duration according to 20 years
ISO 13849-1/IEC 61508
Response time when activating STO Maximal 250 ms 2)
1)
This value refers purely to the STO switch-off signal path of the SINAMICS DCM, see also the next
chapter.
2)
The external redundant switch-off signal path via the line contactor/circuit breaker must also be
designed for a response time of maximum 250 ms.
13.3.3 Performance characteristics of functional safety application examples
Table 13-3 Safety-related key data of the functional safety application (see notes)
Safety integrity level (SIL) according to • maximum SIL 3 (power contactor in the armature circuit)
IEC 61508 • maximum SIL 2 (circuit breaker in the armature circuit)
Depending on the application and diagnostic test interval
Performance level (PL) according to • maximum PL e (power contactor in the armature circuit)
ISO 13849‑1 • maximum PL d (circuit breaker in the armature circuit)
Category according to ISO 13849‑1 • maximum Category 4 (power contactor in the armature
circuit)
• maximum Category 3 (circuit breaker in the armature cir‐
cuit)
Maximum operating altitude above MSL 2000 m
Note
The SIL, PL and Category classifications listed in the table refer purely to the application
examples.
Depending on the diagnostics capability of the safety relays used, it may be possible to achieve
even better values.

Functional safety
Note
The application examples, the proposed safety relays, contactor relays and power switching
devices (power contactor, circuit breaker) are designed for an installation altitude of up to
2000 m.
The following points must be observed for installation altitudes above 2000 m:
• 3SK safety relays
For higher installation altitudes up to 4000 m, 3SK2 safety relays can be used; for possible
restrictions, see the following FAQ:
FAQ 3SK1 and 3SK2 up to 4000 m installation altitude (https://
support.industry.siemens.com/cs/de/en/view/109792701).
• 3RT2 power contactors
3RH2 contactor relays
At an installation altitude above 2000 m, a derating must be carried out in accordance with
the "Equipment Manual - SIRIUS contactors / 3RT contactor combinations".
• 3WA1 circuit breaker
At an installation altitude above 2000 m, a derating must be carried out in accordance with
the "Equipment Manual - air circuit breaker 3WA".
Note
For the proposed safety relays, contactor relays and power switching devices (power contactor,
circuit breaker), the permissible temperature range and any temperature derating that may be
required in accordance with the documentation for the individual components must be
observed.
The general environmental conditions and technical data for the SINAMICS DCM are listed in
the following chapter: Technical data (Page 43).
13.3.4 Standards
EN ISO 13849-1:2016 Safety of Machinery; Safety-Related Parts of Control Systems - Part 1: General principles for
design
EN ISO 13849-2:2013 Safety of Machinery; Safety-Related Parts of Control Systems - Part 2: Validation
IEC 61800-5-2:2017 Adjustable-speed electrical power drive systems – Part 5-2: Safety requirements – Functional
safety
IEC 62061:2015 Safety of machinery – Functional safety of safety-related electrical, electronic and program‐
mable electronic control systems
IEC 61508-2:2010 Functional safety of electrical/electronic/programmable electronic safety-related systems –
Part 2: Requirements placed on safety-related electrical/electronic/programmable electronic
systems
IEC 61511-1:2017 Functional safety – Safety instrumented systems for the process industry sector – Part 1: Gen‐
eral, terminology, requirements relating to systems, software and hardware

Functional safety
13.5 Application examples
13.4 Functional safety: Activation for SINAMICS DCM

In the delivery state, the STO circuit of the SINAMICS DCM is deactivated using a jumper between
terminals X200‑1 and X200‑2. As a consequence, STO is permanently deselected, and the
converter can be operated, independent of the signal states at the STO terminals. Terminals
XS1‑105 and XS1‑106 are also jumpered when delivered (E-Stop deactivated).
The following change is required in order to use the STO function:
The jumper between terminals X200‑1 and X200‑2 must be removed. As a consequence, the
STO circuit can be activated and a safety relay can be connected.
The application examples use the E‑Stop function; for this reason the jumper between
terminals XS1‑105 and XS1‑106 must also be removed in order to establish the circuits
shown. The terminals must be wired in accordance with the respective application example.
Note
Warranty and liability for application examples
The application examples are not binding and do not claim to be complete regarding
configuration, equipment or any eventuality which may arise.
Application examples are not customer-specific solutions and are only intended to provide
assistance with typical tasks.
As plant constructor/user, you are solely responsible for ensuring that the products described are
operated correctly. Application examples do not relieve you of your responsibility for safe
handling when using, installing, operating and maintaining the equipment.
Especially for a plant or system, a risk analysis and risk assessment (see Chapter "Risk analysis and
risk assessment (Page 693)") as well as a validation or check (see Chapter "Validating/checking
the safety functions (Page 693)") of the safety functions must be performed if these were
configured based on the application examples shown.
The following chapters describe application examples for implementing STO and SS1‑t safety
functions for applications with a safety relay and a power switching device (power contactor
or circuit breaker) to safely shut down the line supply to the armature circuit (second
channel):
• Chapter "STO with power contactor in the armature circuit, controlled by mechanical
switches/relay outputs (Page 685)"
• Chapter "STO with circuit breaker in the armature circuit, controlled by mechanical switches/
relay outputs (Page 686)"
• Chapter "STO with power contactor in the armature circuit, controlled by semiconductor
outputs (Page 688)"
• Chapter "SS1-t with power contactor in the armature circuit, controlled by mechanical
switches/relay outputs (Page 691)"
• Chapter "SS1-t with power contactor in the armature circuit, controlled by semiconductor
outputs (Page 692)"

Functional safety
13.5.1 Description of application examples

In the application examples shown here, the SINAMICS DCM is controlled via an additional
3SK1121‑2CB41 safety relay and the feedback signal evaluated (F1, green block).
For SS1‑t applications, an additional 3SK1121-2CB42 safety relay is used, whose delay time
allows the drive to brake along the quick stop ramp (OFF3) before shutting down with STO
(F2, green block).
Sensor circuit
The sensor circuit for selecting the safety function must be performed in two channels.
Switches according to ISO 13850, positive opening according to IEC 60947‑5‑1, or suitable
safety relays or safety controls must be used as actuating elements.
WARNING
Failure of the safety functions as a result of an unsuitable actuating element
An unsuitable actuating element may cause the safety function to fail, which can result in
serious injury or death.
• Select the correct actuating element to comply with the applicable standard
(DIN EN ISO 13849‑1 Cat. 3 PL d or DIN EN 61508 SIL2) for the complete system.
Shutdown channels
The first shutdown channel of the safety function is realized via input STO (X200‑2) of the
SINAMICS DCM (red blocks) and is controlled by terminals 13/14 of safety relay F1.
This shutdown channel also shuts down the SINAMICS DCM via input E‑Stop (XS1‑105).
(E‑Stop: see Chapter "Safety shutdown (E-STOP) (Page 538)")
Via terminals 37/38 of safety relay F1, the second shutdown channel (blue blocks) of the
safety function interrupt the control of the contactor relay KA1 via terminals XR1‑109,
XR1‑110 of the SINAMICS DCM.
When contactor relay KA1 drops out, the following happens
• Power contactor QA1 for the line supply to the armature circuit is opened by interrupting the
power supply of contactor coils (A1 and A2) or
• Circuit breaker QA1 for the line supply to the armature circuit is opened and interlocked using
the undervoltage release U<.
The control for line contactor QF1 of the field circuit is additionally interrupted via terminals
47/48 of safety relay F1 and via contactor relay KF1.
Shutting down the second shutdown channel is delayed by 50 ms when compared to the
first shutdown channel as a result of F1 in order to shut down the power unit in an orderly
fashion and to facilitate that the power contactor and/or the circuit breaker for the line
supply to the armature circuit is switched in a no-load condition.
Switching in a no-load condition reduces the stress on the contact blocks and therefore
increases the service life and availability of the system.

Functional safety
For an SS1‑t application, the safety relay for STO shutdown (F1) is controlled by an additional
safety relay F2.
For an Emergency Stop command, safety relay F2 first activates the fast stop function OFF3
(terminal X177.15, DI/DO 4) of the SINAMICS DCM via terminals 13/14.
After the set delay time has elapsed, F2 initiates STO at safety relay F1.
To realize this, F2 is connected to inputs T1/IN1 and T2/IN2 of F1 via contacts 37/38 and
47/48.
Feedback signal circuit

The feedback signal circuit for safety relay F1 is closed via:
• terminals RM1 (X201-2) / RM2 (X201-1) of the SINAMICS DCM
• The positively driven contacts of contactor relays KA1/KF1
• The mirror contacts of power contactor QA1 and/or the auxiliary contacts of circuit breaker
QA1 for the armature circuit
• The mirror contacts of line contactor QF1 for the field circuit
WARNING
Failure of the self diagnostics as a result of additional components in the feedback circuit
The self diagnostics of the safety function can fail by installing additional components, such as
indicator lights, contactors, sirens in the feedback signal circuit of the safety relays. As a result,
it is possible that the required safety‑ or performance level is no longer achieved. This can result
in severe injury or death.
• Ensure that the feedback signal circuits of the safety relay and/or the F‑PLC only contain
components that are parts of the safety function.
• To query status information of the safety circuit only use contacts or outputs that are
independent of the safety circuit and feedback signal circuit.
The state of the safety circuit can be determined for example via the state of the E‑Stop
signal (r53100) or additional contacts of the safety relay.

Functional safety
13.5.2 General information on the application examples

• Safety relays should preferably be used with positively driven relay contacts, as safety relays
with semiconductor outputs 1) output test pulses at regular intervals also for the self-test.
For the SINAMICS DCM, these test pulses can result in undesirable shutdown of the drive or
cause fuses to rupture.
Safety relays that are able to filter out test pulses from the control signals for the SINAMICS
DCM are suggested in the application examples.
Additional information on this topic is provided in the following documents:
– Operating instructions of the safety relays
– FAQ "Test pulses for safety-oriented SIMATIC ET 200S modules": FAQ 44452714 (https://
– FAQ "Contact extension of a fail-safe control system with 3SK1 and 3RQ1": FAQ 76676971
(https://support.industry.siemens.com/cs/de/en/view/76676971)
WARNING
Danger to life as a result of an unexpected restart
When using safety relays with an unsuitable filter time for test pulses, the following can
occur
• Unexpected restart (bright pulse) or
• Unexpected restart after an unexpected stop (dark pulse)
An unexpected restart such as this can result in death or severe injury.
• Ensure that the safety relays used are suitable and approved for filtering out test pulses.
• Ensure that the filter times of the safety relays are sufficiently long in order to reliably
filter out test pulses (bright‑ and dark pulses).
• Input E‑Stop (XS1‑105) must always be controlled via the safety circuit. It is not permissible
that it is jumpered (e.g. to XS1‑106).
• As shown, the control of the power contactors and circuit breakers should be electrically
isolated from the protective extra low voltage of the control circuits.
• The power contactor and/or the circuit breaker for the line supply to the armature circuit may
be opened at the earliest 50 ms after the STO signal (X200‑2, ‑3) and the E‑Stop signal
(XS1‑105). This is secured in the application examples using safety relay F1.
• Observe the operating instructions of the safety components, for example safety relays and
contactor relays.
• Observe the switching power of line contactor relay XR1‑109 / XR1‑110 (see Chapter
"Assignment of electronics terminals at the Power Interface (Page 146)" of the SINAMICS
DCM as well as safety relays and contactor relays.

Functional safety
1)
Additional examples with pp-switching semiconductor outputs:
F-PLC, light arrays, laser scanners, ...
Note
Protective measures against overload and short-circuit (e.g. fuses) are not included in the
diagrams of the application examples in order to improve the transparency.
Note
Carefully note the information regarding the maximum number of switching cycles of the
switchgear (power contactors, circuit breakers, safety relays, contactor relays) as well as
maintenance intervals.
The safety or performance level is also obtained from the number of switching cycles and the
B10d values of switchgear.
Switchgear must be replaced in plenty of time in order to maintain the safety‑ or performance
levels.
Table 13-4 Legend for the application example diagrams
Components QA1 Power contactor or circuit breaker for line supply to armature circuit
QF1 Line contactor, field circuit
F1 Safety relay 3SK1121-2CB41 1), delay time 0.05 … 3 s
https://mall.industry.siemens.com/mall/de/de/Catalog/Product/3SK1121-2CB41
F2 Safety relay 3SK1121-2CB42 1), delay time 0.5 … 30 s
For longer delay times of 5 … 300 s, safety relay 3SK1121-2CB44 1) can be used.
KA1 3RH2131-2FB40 contactor relays to control the line contactors and/or the circuit breaker
KF1 The contactor relays can be eliminated if the switching power of the line contactor
control relay XR1 and the safety relays is sufficient to control the power contactors
and/or the circuit breakers.
https://mall.industry.siemens.com/mall/de/de/Catalog/Product/3RH2131-2FB40

Functional safety
SINAMICS DCM STO Selecting the STO function

terminals (X200‑2, ‑3)
RM1 (X201-2) Feedback signal contact "STO active" for a safety relay
RM2 (X201-1) The contact is closed if STO is selected.
E-Stop Input to activate the E-Stop function
(XS1‑106) Shutdown of the SINAMICS DCM via the first channel of the safety relay or the F‑PLC - in
addition to activating the STO function.
Relay for line Relay switching output for the line contactor
contactor Safety relay F1 interrupts the control of power contactor or circuit breaker QA1 through
(XR1‑109, ‑110) the SINAMICS DCM (second channel of the safety function).
DI/DO 4 Programmable DI/DO 4, used to select the quick stop function (OFF3) for SS1‑t
(X177.15) (corresponding parameter assignment of the SINAMICS DCM required).
P24 24 V supply for DI/DO 4
(X177.9)
M24 Ground for the 24 V potential as well as reference ground for the following inputs:
(X177.23) - STO (X200-1, X200-2)
- E-Stop (XS1-106)
- DI/DO 4 (X177.15)
Line supply L1, L2, L3 Line connection for armature and field circuits
L, N Control voltage, max. AC 250 V
Symbols U< Undervoltage release circuit breaker
Positively-driven contacts = combination of NO and NC contacts is designed so that they
can never be simultaneously closed.
Mirror contact = auxiliary NC contact that cannot be closed simultaneously with a main
NO contact.
DIP switch, the switch position is shown in black.
1)
The suggested safety relays are equipped with spring terminals.
Safety relays with screw terminals are available under Article No. 3SK1121-1CB41, 3SK1121-1CB42, 3SK1121-1CB44.

Functional safety
13.5.3 Application examples STO
13.5.3.1 Timing of the shutdown with STO

Shutdown with STO takes place as follows:
1. Via inputs IN1 and IN2, safety relay F1 receives the command to shut down the drive with
STO.
2. F1 instantaneously interrupts the first channel of the safety function (terminals 13/14).
As a consequence, the shutdown function E‑Stop of the SINAMICS DCM is triggered, which
initiates the orderly shutdown of the power unit.
At the same time, function STO of the SINAMICS DCM is controlled, the response time is max.
250 ms (filter time).
3. After the set delay time of 50 ms has elapsed, safety relay F1 also interrupts the second
channel of the safety function, and therefore the control of contactor relays KA1 (F1,
terminals 37/38) and KF1 (F1, terminals 47/48).
Via QA1 and QF1, this shuts down the line supply for the armature and field circuits.

Functional safety
13.5.3.2 STO with power contactor in the armature circuit, controlled by mechanical
switches/relay outputs
- -- - - - / - /

"SNBUVSFDJSDVJUCSFBLFS 2" 2' -JOFDPOUBDUPS꫼FME

$PNNVUBUJOHSFBDUPST 2'
4*/".*$4%$. $6% %*%0 9

0''RVJDLTUPQ
9
7
'JSJOHQVMTFTVQQMZ
.
9 ," ,'
1PXFS
*OUFSGBDF 3FMBZGPSMJOF
"MMPDBUJPO DPOUBDUPS
#PBSE
&4UPQ
" "
7
2" 2'
" "
1 450 450 3. 3. 94 94 93 93
9 9 9 9 9
%$7
&.&3(&/$:
4501 ," 2"

&.&3(&/$:
,' 2'
4501O
%$7 %$7
" */, 5 */ 5 */ */'
'
4BGFUZSFMBZ

4&-71&-7 4,$#
QPXFSTVQQMZ T T
]"VU.PO
NBY7
4UBSUCVUUPO
]$'
]YY
]45
4&53&4&5
" */4 1"3
" "
," ,'
" "

① First channel (red): Firing pulse shutdown

② Second channel (blue): Armature circuit circuit breaker
③ Safety relay STO (green), delay time setting: 50 ms
④ Symbolic representation of a sensor circuit (green)
⑤ Contact blocks for field excitation (gray): Line contactor, field circuit
(prevalent solution: The field circuit is controlled together with the armature circuit)
Figure 13-3 STO application with power contactor in the armature circuit, controlled by switches / relay outputs

Functional safety
13.5.3.3 STO with circuit breaker in the armature circuit, controlled by mechanical switches/
relay outputs
- -- - - - / - /



4*/".*$4%$. $6% %*%0 9
0''RVJDLTUPQ
9
7 ," ,'
'JSJOHQVMTFTVQQMZ
.
9
1PXFS
*OUFSGBDF 3FMBZGPSMJOF "
"MMPDBUJPO 9 9
DPOUBDUPS 2'
#PBSE 6 '
&4UPQ
7
9 9 "
1 450 450 3. 3. 94 94 93 93

9 9 9 9 9
%$7
2"
&.&3(&/$: 4 4
4501 ," 9 9 9 9

&.&3(&/$:
,' 2'
4501O
%$7 %$7
" */, 5 */ 5 */ */'
'
4BGFUZSFMBZ

4&-71&-7 4,$#
QPXFSTVQQMZ T T
]"VU.PO
NBY7
4UBSUCVUUPO
]$'
]YY
]45
4&53&4&5
" */4 1"3
" "
," ,'
" "


② Second channel (blue): 3WA circuit breaker armature circuit
④ Symbolic representation of the sensor circuit (green)
Figure 13-4 STO application with circuit breaker in the armature circuit, controlled by switches / relay outputs

Functional safety
Note
To improve the level of transparency, the wiring of the signals used to close the circuit breaker,
for example, the switch-on solenoid, ready-to-close signal and possibly a motorized operating
mechanism to tension the spring energy store are not shown.

Functional safety
13.5.3.4 STO with power contactor in the armature circuit, controlled by semiconductor
outputs
- -- - - - / - /


4*/".*$4%$. $6% %*%0 9

0''RVJDLTUPQ
9
7
'JSJOHQVMTFTVQQMZ
.
9 ," ,'
1PXFS
#PBSE
&4UPQ
" "
7
2" 2'
" "
1 450 450 3. 3. 94 94 93 93
9 9 9 9 9
%$7
'1-$ '*0
'QSPHSBN'MPHJD GPSDFEDIFDLJOH
QSPDFEVSF ," 2"

'%0 QQTXJUDIJOH
- . %0Y %0Z ,' 2'

%$7
%$7 %$7
" */, 5 */ 5 */ */'
'
4BGFUZSFMBZ

4&-71&-7 4,$#
QPXFSTVQQMZ T T
]"VU.PO
NBY7
]$'
]YY
]45
4&53&4&5
" */4 1"3
" "
," ,'
" "


④ Safety relay or F-PLC with semiconductor outputs (yellow)
In the application example shown, the following functions are deactivated at safety relay F1:
• Cross-circuit detection of the connections to F1
• Reset of the safety circuit (start button) and/or protection against restart
If required, these must be implemented in the higher-level safety system.

Functional safety
Figure 13-5 Application STO with power contactor in the armature circuit, controlled by semiconductor outputs
13.5.4 Application examples SS1-t
For application SS1‑t, the quick stop‑ or the OFF3 ramp of the SINAMICS DCM is used.
The drive must be appropriately parameterized.
Parameter assignment of the SINAMICS DCM for SS1-t

The following parameterization is required in drive object DC_CTRL for application SS1‑t:
• p0849[0] = r53010.8 Quick stop (OFF3) signal source 2 connected with DI/DO 4
(X177.15)
Remark: p0848[0] / OFF3 signal source 1 is normally used for the
fieldbus.
• p50789[0] = 0 Configuring DI/DO 4 as input
• p50765 = 0 DI/DO 4: No simulation mode
• p50296 Ramp-function generator quick stop (OFF3) ramp-down time
where relevant, Ramp-function generator quick stop (OFF3) initial rounding/final
p50297, p50298 rounding
Note
When commissioning the system, the OFF‑3 ramp of the SINAMICS DCM and the setting of the
delay time on safety relay F2, must be manually coordinated with one another and the system
or the process and appropriately set according to the safety requirements.
13.5.4.1 Timing of the shutdown with SS1-t

Shut down with SS1‑t takes place as follows:
1. Via inputs IN1 and IN2, safety relay F2 receives the command to shut down the drive with
SS1‑t.
2. Via contacts of terminals 13/14, F2 instantaneously initiates a quick stop (OFF3) of the
SINAMICS DCM (DI/DO 4, X177.15).
3. After the set delay time elapses, F2 selects STO via terminals 37/38 and 47/48 at safety relay
F1 (IN1, IN2).
4. F1 instantaneously interrupts the first channel of the safety function (terminals 13/14). As a
consequence, shutdown function E‑Stop of the SINAMICS DCM is triggered, which
introduces the controlled shutdown of the power unit. At the same time function STO of the
SINAMICS DCM is controlled, the response time is max. 250 ms (filter time).
5. After the set delay time of 50 ms has elapsed, safety relay F1 also interrupts the second
channel of the safety function, and therefore the control of contactor relays KA1 (F1,
terminals 37/38) and KF1 (F1, terminals 47/48).
Via QA1 and QF1, this shuts down the line supply for the armature and field converters.

Functional safety
Note
The coupling of F1 and F2 safety relays shown is an example.
Additional coupling options are listed in the operating instructions of the safety relays.

Functional safety
13.5.4.2 SS1-t with power contactor in the armature circuit, controlled by mechanical
switches/relay outputs
- -- - - - / - /


4*/".*$4%$.
$6% %*%0 9
0''RVJDLTUPQ
9
7
'JSJOHQVMTFTVQQMZ
.
9 ," ,'
1PXFS
#PBSE
&4UPQ
" "
7
2" 2'
" "
1 450 450 3. 3. 94 94 93 93
9 9 9 9 9
%$7

," 2"

&.&3(&/$:
4501

,'

2'

&.&3(&/$:
4501O
%$7
%$7
" */, 5 */ 5 */ */' " */, 5 */ 5 */ */'
' '
4BGFUZSFMBZ

4BGFUZSFMBZ

4&-71&-7 4,$# 4,$#
QPXFSTVQQMZ T T T T
]"VU.PO ]"VU.PO
NBY7
4UBSUCVUUPO
]$' ]$'
]YY ]YY
]45 ]45
4&53&4&5 4&53&4&5
" */4 1"3 " */4 1"3

" "
," ,'
" "


④ Safety relay SS1-t (green)
⑤ Symbolic representation of a sensor circuit (green)
⑥ Contact blocks for field excitation (gray): Line contactor, field circuit
⑦ Quick stop/OFF3 command for SS1-t (gray)
Figure 13-6 Application SS1-t with power contactor in the armature circuit, controlled by switches/relay outputs

Functional safety
13.5.4.3 SS1-t with power contactor in the armature circuit, controlled by semiconductor
outputs
- -- - - - / - /


4*/".*$4%$.
$6% %*%0 9
0''RVJDLTUPQ
9
7
'JSJOHQVMTFTVQQMZ
.
9 ," ,'
1PXFS
#PBSE
&4UPQ
" "
7
2" 2'
" "
1 450 450 3. 3. 94 94 93 93
9 9 9 9 9
%$7
'1-$ '*0
'QSPHSBN'MPHJD GPSDFEDIFDLJOH
QSPDFEVSF ," 2"

'%0 QQTXJUDIJOH
,' 2'
- . %0Y %0Z

%$7
%$7
%$7
" */, 5 */ 5 */ */' " */, 5 */ 5 */ */'
' '
4BGFUZSFMBZ

4BGFUZSFMBZ

4&-71&-7 4,$# 4,$#
QPXFSTVQQMZ T T T T
]"VU.PO ]"VU.PO
NBY7
]$' ]$'
]YY ]YY
]45 ]45
4&53&4&5 4&53&4&5
" */4 1"3 " */4 1"3

" "
," ,'
" "


④ Safety relay SS1-t (green)
⑤ Safety relay or F-PLC with semiconductor outputs (yellow)
In the application example shown, the following functions are deactivated at safety relay F2:
• Cross-circuit detection of the connections to F2
• Reset of the safety circuit (start button) and/or protection against restart
If required, these must be implemented in the higher-level safety system.
⑥ Contact blocks for field excitation (gray): Line contactor, field circuit
⑦ Quick stop/OFF3 command for SS1-t (gray)

Functional safety
13.8 Diagnostics test / forced checking procedure
Figure 13-7 Application SS1-t with power contactor in the armature circuit, controlled by semiconductor outputs
13.6 Risk analysis and risk assessment

Plants and machines as a result of their design and their functionality represent risks.
This is the reason that the Machinery Directive requires that a risk assessment be performed for
each machine and, if necessary, the level of risk reduced until the residual risk is less than the
tolerable risk.
Additional notes on this topic and for applying the relevant standards and guidelines
are provided in the Appendix "Standards and regulations relating to functional safety
(Page 719)".
13.7 Validating/checking the safety functions

Carefully check/test the safety functions after commissioning the system for the first time, after
carrying out any repairs and after each change to the machine/system, in particular the feedback
circuits.
These tests must be performed by qualified personnel who, on account of their technical
qualifications and knowledge of the safety functions, are in a position to perform the
acceptance test in the correct manner.
13.8 Diagnostics test / forced checking procedure

In order to ensure that the function of the switch-off signal paths complies with the
requirements laid down in the applicable standards, regulations and guidelines, these must be
tested at regular intervals ("diagnostics test interval" in accordance with IEC 61800‑5‑2:2016).
As a consequence, faults are detected in a sufficiently short time.
WARNING
Dangers when not regularly testing the switch-off signal paths.
Not regularly testing the switch-off signal paths can result in severe injury or death.
• Carefully ensure that the switch-off signal paths are tested (forced checking procedure:
Selecting and deselecting function STO) at regular intervals.
The forced checking procedure intervals depend on the safety function and the desired/
required SIL / PL, Cat.
The external safety relay (e.g. 3SK11…) can use the feedback signals from the SINAMICS
DCM and the feedback contacts to detect errors in the switch-off signal paths and then use
the STO function to prevent a restart on both channels. This detects the fault, and the system
is brought into a safe state until the system can be repaired.

Functional safety
13.9 Circuit breakers and power contactors
Relationship between the forced checking procedure interval and SIL or PL and Cat.
The hardware, the hardware structure and, where applicable, the software (when using
parameterizable or programmable external safety components), must correspond to the
required SIL / PL and Cat.
Also see the application examples in the previous sections of this document.
For SINAMICS DCM, the following maximum diagnostic test intervals apply according to
IEC 61800‑5‑2:2016:
• SIL 2/PL d, Cat. 3: Forced checking procedure at least once per year
• SIL 3 / PL e, Cat. 3: As a minimum, a forced checking procedure every 3 months
• SIL 3 / PL e, Cat. 4: Forced checking procedure at least once per day
Note
The following points must be observed for the proposed power contactors and circuit breakers:
• Permissible installation altitude and any derating that may be required
• Permissible temperature range and any derating that may be required
Also observe the corresponding documentation for the respective components; see also
Chapter "Performance characteristics of functional safety application examples (Page 676)".
6RA8013_XXXXX_0AA0 Value Designation Manufac‐ Article number

turer
Rated DC current [A] (DC) 15 - - -
Rated supply voltage 400 - - -
armature [V] 480
Contactor armature circuit - Main contactor designed for AC1, Siemens 3RT2023-2AL20
40 A
Contactor field circuit - Field contactor designed for AC1 Siemens 3RT2015-2AP01

turer
armature [V] 480
40 A

Functional safety

turer
armature [V] 480
575
50 A

turer
armature [V] 480
100 A

turer
armature [V] 480
575
120 A

turer
armature [V] 480
575
Contactor armature circuit - Main contactor AC1, 275 A Siemens 3RT1456-6AP36

turer
armature [V] 480

Functional safety


turer
armature [V] 575
Contactor field circuit - Field contactor designed for AC1 Siemens 3RT2023-2AL20
Field contactor designed for AC1 Siemens 3RT2023-2AL24

turer
armature [V]

turer
armature [V] 480
575

turer
760
armature [V]

Functional safety

turer
850
armature [V] 480
575

turer
armature [V]
3WA circuit breaker arma‐ - 3WA1 circuit breaker 1000 A 1000 V Siemens 3WA1220-8AE03-4EV0-Z Z=B10
ture circuit

turer
1100
armature [V] 690
ture circuit Siemens or 3WA1110-4AE03-4EV0

turer
armature [V] 480
ture circuit Siemens or 3WA1110-4AE03-4EV0

turer

Functional safety

armature [V] 830
ture circuit 3WA1 circuit breaker 1250 A 1000 V Siemens or 3WA1112-4AE03-4EV0
Siemens 3WA1220-8AE03-4EV0-Z Z=B12

turer
armature [V] 575
ture circuit Siemens oder 3WA1116-4AE03-4EV0

turer
armature [V] 575
690
830
3WA circuit breaker arma‐ - 3WA1 circuit breaker 2000 A 690 V Siemens 3WA1220-4AE03-4EV0
ture circuit 3WA1 circuit breaker 2000 A 1000 V Siemens 3WA1220-8AE03-4EV0

turer
armature [V] 690
950
ture circuit 3WA1 circuit breaker 2000 A 1000 V Siemens 3WA1220-8AE03-4EV0

turer
2800

Functional safety

armature [V] 690
ture circuit
6RA8098_XXXXX_0AA0 Value Designation Manufac‐

turer
armature [V]
ture circuit

Functional safety

Appendix A A
A.1 Certifications and standards
Certifications
Development, production, sales:

ISO 9001:2008 Quality management
ISO 14001:2004 Environmental management
Devices:
EAC
Germanischer Lloyd Shipbuilding 1) 11787-10HH
Lloyd's Register Shipbuilding 1)
No. 06/20053
American Bureau of Shipping Shipbuilding 1)
21-2113924-PDA
Det Norske Veritas Shipbuilding 1)
No. E-10357 (DC converter)
No. E-10358 (Control Module)
Communication:
PROFIBUS device (DP-V0, DP-V1, PROFIdrive 3.1.2)
PROFINET IO devices (V 2.2.4, PROFIdrive 4.1)
1)
In order to maintain the limit values decisive for certification for marine applications, the
requirements as listed in Section Using SINAMICS DCM in shipbuilding (Page 667) must be
observed.
Korean Certification (KC)

Appendix A
A.2 List of abbreviations
The EMC limit values to be complied with for Korea correspond to the limit values of the EMC
product standard for variable-speed electric drives IEC 61800‑3, category C2 or limit value
class A1 according to CISPR 11.
With suitable additional measures, the limit values according to category C2 or according to
limit value class A1 are maintained.
To do this, an additional radio interference suppression filter (EMC filter) must be used and
the converters must be installed in the control cabinet in compliance with EMC rules.
The appropriate radio interference suppression filters (for the field and armature circuits) for
the SINAMICS DCM are listed in Catalog D23.1.
Additional notes are provided there as well as technical data and constraints regarding the
use of radio interference suppression filters:
• The use in grounded line supplies
• The mandatory use of a commutating reactor
Detailed information about the basics of EMC and EMC-compliant design of drives can be
found in the Chapter "Connecting (Page 67)".
Basic standards
IEC 60146-1-1 Semiconductor converters; General requirements and line-commutated

converters; specification of basic requirements
IEC 61800-3 Adjustable speed electrical power drive systems - Part 3: EMC product
standard including specific test methods
IEC 61800-5-1 Adjustable speed electrical power drive systems – Part 5-1: Safety require‐
ments – Electrical, thermal, and energy
Note
The following list of abbreviations includes all abbreviations and their meanings used in the
entire SINAMICS user documentation.
Abbreviation Meaning, German Meaning, English

A
A... Warnung Alarm
AC Wechselstrom Alternating Current
ADC Analog-Digital-Konverter Analog Digital Converter
AI Analogeingang Analog input
AIM Active Interface Module Active Interface Module
ALM Active Line Module Active Line Module
AO Analogausgang Analog output

Appendix A

AOP Advanced Operator Panel Advanced Operator Panel
APC Advanced Positioning Control Advanced Positioning Control
ASC Ankerkurzschluss Armature short-circuit
ASCII Amerikanische Code-Norm für den Informationsaus‐ American Standard Code for Information Inter‐
tausch change
ASM Asynchronmotor Induction motor
B
OC Betriebsbedingung Operating condition
BERO Firmenname für einen Näherungsschalter Trade name for a type of proximity switch
BI Binektoreingang Binector input
BIA Berufsgenossenschaftliches Institut für Arbeitssicher‐ German Institute for Occupational Safety
heit
BICO Binektor-Konnektor-Technologie Binector Connector Technology
BLM Basic Line Module Basic Line Module
BOP Basic Operator Panel Basic Operator Panel
C
C Kapazität Capacitance
C... Safety-Meldung Safety message
CAN Serielles Bussystem Control Area Network
CBC Kommunikationsbaugruppe CAN Communication Board CAN
CD Compact Disc Compact Disc
CDS Befehlsdatensatz Command Data Set
CF CompactFlash CompactFlash
CI Konnektoreingang Connector Input
CNC Computerunterstützte numerische Steuerung Computer Numerical Control
CO Konnektorausgang Connector Output
CO/BO Konnektor-/Binektorausgang Connector Output / Binector Output
COB ID CAN Object-Identification CAN Object-Identification
COM Mittelkontakt eines Wechselkontaktes Common contact of a changeover relay
CP Kommunikationsprozessor Communication Processor
CPU Zentrale Recheneinheit Central Processing Unit
CRC Checksummenprüfung Cyclic Redundancy Check
CSM Control Supply Module Control Supply Module
CU Control Unit Control Unit
D
DAC Digital-Analog-Konverter Digital Analog Converter
DC Gleichstrom Direct Current
DCB Drive Control Block Drive Control Block
DCC Drive Control Chart Drive Control Chart
DCN Gleichstrom negativ Direct Current Negative
DCP Gleichstrom positiv Direct Current Positive
DDS Drive data set Drive Data Set
DI Digitaleingang Digital Input

Appendix A

DI/DO Digitaleingang/-ausgang bidirektional Bidirectional Digital Input/Output
DMC DRIVE-CLiQ Module Cabinet (Hub) DRIVE-CLiQ Module Cabinet (Hub)
DO Digitalausgang Digital Output
DO Antriebsobjekt Drive Object
DP Dezentrale Peripherie Decentralized Peripherals
DPRAM Speicher mit beidseitigem Zugriff Dual-Port Random Access Memory
DRAM Dynamischer Speicher Dynamic Random Access Memory
DRIVE-CLiQ Drive Component Link with IQ Drive Component Link with IQ
DSC Dynamic Servo Control Dynamic Servo Control
E
EASC Externer Ankerkurzschluss External Armature Short-Circuit
EDS Geberdatensatz Encoder Data Set
ESD Elektrostatisch gefährdete Baugruppen Electrostatic-Sensitive Devices
ELP Erdschlussüberwachung Earth Leakage Protection
EMF Elektromagnetisches Feld Electromagnetic Field (EMF)
EMF Elektromotorische Kraft Electromotive Force (EMF)
EMC Elektromagnetische Verträglichkeit Electromagnetic Compatibility
EN Europäische Norm European standard
EnDat Geber-Schnittstelle Encoder Data Interface
EP Impulsfreigabe Enable Pulses
EPOS Einfachpositionierer Basic positioner
ES Engineering System Engineering System
ECD Ersatzschaltbild Equivalent Circuit Diagram
ESR Erweitertes Stillsetzen und Rückziehen Extended Stop and Retract
F
F... Störung Fault
FAQ Häufig gestellte Fragen Frequently Asked Questions
FBL Freie Funktionsblöcke Free Blocks
FCC Function Control Chart Function Control Chart
FCC Flussstromregelung Flux Current Control
F-DI Fehlersicherer Digitaleingang Failsafe Digital Input
F-DO Fehlersicherer Digitalausgang Failsafe Digital Output
FEM Fremderregter Synchronmotor Separately excited synchronous motor
FEPROM Schreib- und Lesespeicher nichtflüchtig Flash EPROM
FG Funktionsgenerator Function Generator
FI Fehlerstrom-Schutzschalter Earth Leakage Circuit-Breaker (ELCB)
FP Funktionsplan Function diagram
FPGA Field Programmable Gate Array Field Programmable Gate Array
FS Product version Functional state
FW Firmware Firmware
G
GB Gigabyte Gigabyte
GC Global-Control-Telegramm (Broadcast-Telegramm) Global Control Telegram (Broadcast Telegram)

Appendix A

GSD Gerätestammdatei: beschreibt die Merkmale eines Device master file: describes the features of a
PROFIBUS-Devices PROFIBUS device
GSV Gate Supply Voltage Gate Supply Voltage
GUID Globally Unique Identifier Globally Unique Identifier
H
HF Hochfrequenz High Frequency
HFD Hochfrequenzdrossel High frequency reactor
RFG Hochlaufgeber Ramp-Function Generator
HMI Mensch-Maschine-Schnittstelle Human Machine Interface
HTL Logik mit hoher Störschwelle High-Threshold Logic
HW Hardware Hardware
I
i. V. Under development: This property is currently not In preparation: this feature is currently not avail‐
available able
I/O Eingang/Ausgang Input/Output
IASC Interner Ankerkurzschluss Internal Armature Short-Circuit
IBN Inbetriebnahme Commissioning
ID Identifizierung Identifier
IEC Internationale Norm in der Elektrotechnik International Electrotechnical Commission
IF Interface Interface
IGBT Bipolartransistor mit isolierter Steuerelektrode Insulated Gate Bipolar Transistor
IL Impulslöschung Pulse suppression
IPO Interpolator cycle Interpolator clock
IT Non-grounded three-phase line supply Insulated three-phase supply network
IVP Interner Spannungsschutz Internal Voltage Protection
J
JOG Tippen Jogging
K
KDV Kreuzweiser Datenvergleich Data cross-checking
KIP Kinetische Pufferung Kinetic buffering
Kp Proportionalverstärkung Proportional gain
KTY Spezieller Temperatursensor Special temperature sensor
L
L Induktivität Inductance
LED Leuchtdiode Light Emitting Diode
LIN Linearmotor Linear motor
LR Lageregler Position controller
LSB Niederstwertiges Bit Least Significant Bit
LSS Netzschalter Line Side Switch
LU Längeneinheit Length Unit
LWL Lichtwellenleiter Fiber-optic cable
M
M Masse Reference potential, zero potential

Appendix A

MB Megabyte Megabyte
MCC Motion Control Chart Motion Control Chart
MDS Motordatensatz Motor Data Set
MLFB Maschinenlesbare Fabrikatebezeichnung Machine-readable product designation
MMC Mensch-Maschine-Kommunikation Man-Machine Communication
MSB Höchstwertiges Bit Most Significant Bit
MSCY_C1 Zyklische Kommunikation zwischen Master (Klasse 1) Master Device Cycle Class 1
und Device
MSC Motorstromrichter Motor power converter
MT Messtaster Measuring input
N
N. C. Nicht angeschlossen Not Connected
N... Keine Meldung oder Interne Meldung No Report
NAMUR Normenarbeitsgemeinschaft für Mess- und Regeltech‐ Standardization association for instrumentation
nik in der chemischen Industrie and control in the chemical industry
NC Öffner Normally Closed (contact)
NC Numerische Steuerung Numerical Control
NEMA Normengremium in USA (United States of America) National Electrical Manufacturers Association
NM Nullmarke Zero mark
NO Schließer Normally Open (contact)
NSR Netzstromrichter Line power converter
O
OA Open Architecture Open Architecture
OEM Original Equipment Manufacturer Original Equipment Manufacturer
OLP Busstecker für Lichtleiter Optical Link Plug
OMI Option Module Interface Option Module Interface
P
p... Einstellparameter Adjustable parameter
PB PROFIBUS PROFIBUS
PcCtrl Steuerungshoheit Master control
PD PROFIdrive PROFIdrive
PDS Leistungsteildatensatz Power Unit Data Set
PE Schutzerde Protective Earth
PELV Schutzkleinspannung Protective Extra-Low Voltage
PEM Permanenterregter Synchronmotor Permanent-magnet synchronous motor
PG Programmiergerät Programming device
PI Proportional Integral Proportional Integral
PID Proportional Integral Differential Proportional Integral Differential
PLC Speicherprogrammierbare Steuerung (SPS) Programmable Logical Controller
PLL Phase Locked Loop Phase Locked Loop
PNO PROFIBUS Nutzerorganisation PROFIBUS user organization
PPI Punkt zu Punkt Schnittstelle Point-to-Point Interface
PRBS Weißes Rauschen Pseudo Random Binary Signal

Appendix A

PROFIBUS Serieller Datenbus Process Field Bus
PS Stromversorgung Power Supply
PSA Power Stack Adapter Power Stack Adapter
PTC Positiver Temperaturkoeffizient Positive Temperature Coefficient
PTP Punkt zu Punkt Point-To-Point
PWM Pulsweitenmodulation Pulse Width Modulation
PZD PROFIBUS Prozessdaten PROFIBUS process data
R
r... Beobachtungsparameter (nur lesbar) Display parameter (read only)
RAM Speicher zum Lesen und Schreiben Random Access Memory
RCCB Fehlerstrom-Schutzschalter Residual Current Circuit Breaker
RCD Fehlerstrom-Schutzschalter Residual Current Device
RJ45 Norm. Beschreibt eine 8-polige Steckverbindung mit Standard. Describes an 8-pole plug connector
Twisted-Pair Ethernet. with twisted pair Ethernet.
RKA Rückkühlanlage Cooling unit
RO Nur lesbar Read Only
RPDO Receive Process Data Object Receive Process Data Object
RS232 Serielle Schnittstelle Serial interface
RS485 Norm. Beschreibt die Physik einer digitalen seriellen Standard. Describes the physical characteristics
Schnittstelle. of a digital serial interface.
RTC Echtzeituhr Real-Time Clock
S
S1 Dauerbetrieb Continuous operation
S3 Aussetzbetrieb Intermittent duty
SBC Sichere Bremsenansteuerung Safe Brake Control
SBH Sicherer Betriebshalt Safe Operating Stop
SBR Sichere Beschleunigungsüberwachung Safe Acceleration Monitor
SCA Sichere Nocke Safe Cam
SE Sicherer Software-Endschalter Safe software limit switch
SG Sicher reduzierte Geschwindigkeit Safely reduced speed
SGA Sicherheitsgerichteter Ausgang Safety-related output
SGE Sicherheitsgerichteter Eingang Safety-related input
SH Sicherer Halt Safety standstill
SI Safety Integrated Safety Integrated
SIL Sicherheitsintegritätsgrad Safety Integrity Level
SLM Smart Line Module Smart Line Module
SLP Sicher begrenzte Position Safely-Limited Position
SLS Sicher begrenzte Geschwindigkeit Safely-Limited Speed
SLVC Geberlose Vektorregelung Sensorless Vector Control
SM Sensor Module Sensor Module
SMC Sensor Module Cabinet Sensor Module Cabinet
SME Sensor Module External Sensor Module External
SN Sicherer Software-Nocken Safe software cam

Appendix A

SOS Sicherer Betriebshalt Safe Operating Stop
SPC Sollwertkanal Setpoint Channel
SPS Speicherprogrammierbare Steuerung Programmable Logic Controller (PLC)
SS1 Sicherer Stop 1 Safe Stop 1
SS2 Sicherer Stop 2 Safe Stop 2
SSI Synchron Serielle Schnittstelle Synchronous Serial Interface
SSM Sichere Rückmeldung der Geschwindigkeitsüberwa‐ Safe Speed Monitor
chung (n < nx)
SSR Sichere Bremsrampe Safe Stop Ramp
STO Sicher abgeschaltetes Moment Safe Torque Off
STW PROFIBUS Steuerwort PROFIBUS control word
SVA Raumzeigerapproximation Space vector approximation
T
TB Terminal Board Terminal Board
TIA Totally Integrated Automation Totally Integrated Automation
TM Terminal Module Terminal Module
TN Drehstromversorgungsnetz geerdet Grounded three-phase line supply
Tn Nachstellzeit Integral time
TPDO Transmit Process Data Object Transmit Process Data Object
TT Drehstromversorgungsnetz geerdet Grounded three-phase line supply
TTL Transistor-Transistor-Logik Transistor-Transistor Logic
Tv Vorhaltezeit Derivative-action time
U
UL Underwriters Laboratories Inc. Underwriters Laboratories Inc.
UPS Unterbrechungsfreie Stromversorgung Uninterruptible Power Supply
V
VC Vektorregelung Vector Control
Vdc Zwischenkreisspannung DC-link voltage
VdcN Teilzwischenkreisspannung negativ Partial DC-link voltage negative
VdcP Teilzwischenkreisspannung positiv Partial DC-link voltage positive
VDE Verband Deutscher Elektrotechniker Association of German Electrical Engineers
VDI Verein Deutscher Ingenieure Association of German Engineers
Vpp Volt Spitze zu Spitze Volt peak to peak
VSM Voltage Sensing Module Voltage Sensing Module
W
AR Wiedereinschaltautomatik Automatic Restart
WZM Werkzeugmaschine Machine tool
X
XML Erweiterbare Auszeichnungssprache (Standardspr‐ Extensible Markup Language
ache für Web-Publishing und Dokumentenmanage‐
ment)
Z

Appendix A

ZK Zwischenkreis DC link
ZSW PROFIBUS Zustandswort PROFIBUS status word
Abbreviations, DC-specific terms
Abbreviation Meaning
2Q 2 quadrant
4Q 4 quadrant
IR Initial rounding
FR Final rounding
CU_DC Control Unit DC
DC_CTRL DC drive control
RUT Rampup time
Ia Actual armature current value
IAlimit Current limit
If Actual field current value
ILG Current at critical conduction
In Rated current
Kp P gain
La Armature circuit inductance
Mlimit Torque limit
Mact Actual torque value
n Speed
nact Actual speed value
nmin Minimum speed
NN Normal zero
nsetp Speed setpoint
Ra Armature circuit resistance
RDT Ramp-down time
Tn Integral time
TSE (Engl.: Snubber)
Tu Ambient temperature
Ua Armature voltage
Uf Field voltage
ULine Line voltage
USS Universal serial interface
SICROWBAR Overvoltage protection

Appendix A
A.4 Servicing
A.3 Environmental compatibility
Environmental aspects during development

The use of highly-integrated components has enabled the number of parts to be kept to a
minimum, with energy being used as efficiently as possible during production as a result.
Particular emphasis has been placed on ensuring that the metal and plastic parts have a low
volume and low weight, and that the number of different types is kept to a minimum.
Front parts: PC + ABS Bayblend Bayer

Plastic parts in the device: PC Lexan 915-R
Insulation materials: PC (FR) fl Makrolon or Lexan
Rating plate: Polyester film
Pollutant-free materials have been used for all significant parts. Insulation materials
containing silicone are not used. Materials containing halogens are only present to a slight
extent (cable insulation in the SINAMICS DCM Control Module).
All materials meet ROHS criteria.
Environmental compatibility was a key criterion in selecting supplier parts.
Environmental aspects during production

The packaging material can be recycled and consists mainly of cardboard.
With the exception of the enclosure, no surface coatings have been used.
The production processes do not produce any emissions.
Environmental aspects for disposal

For environmentally friendly recycling and disposal of your old device, please contact a
company certified for the disposal of old electrical and electronic devices and dispose of the
device in accordance with the regulations in your country.
The device features screw-in and snap-in connections that can be easily released in order to
separate it into different mechanical components for recycling purposes.
The printed circuit boards may be used in recycling processes involving energy recovery. The
proportion of components containing hazardous substances is low.
A.4 Servicing
Repairs
If you wish to have a part or unit repaired, please get in touch with your regional contact for
repairs.
Service calls
Qualified personnel can perform repair work on your devices and offer services that ensure
their availability. This work can be carried out with charges that are scaled according to the
amount of time and work involved, or at a flat rate as part of a contract. Services whose

Appendix A
A.4 Servicing
charges depend on the amount of time and work involved are performed within the normal
working hours for the region and with an appropriate response time.
You can get in touch with your regional contact if you wish to have any services carried out.
Note
We would be grateful if you could specify the following device data when you have any queries:
• Device article number and serial number
• Firmware version
• Hardware version of the electronics module CUD (printed on the component side)
• Hardware version and firmware version of additional modules (if used)

Appendix A
A.4 Servicing

Appendix B B
B.1 Runtimes of the DCC blocks for SINAMICS DCM
The typical runtimes of the DCC blocks (in µs) are listed in the following table.
Table B-1 DCC blocks on the SINAMICS DCM
Designation Function Typ. run‐ Group

time
ADD Adder (REAL type) 8 Arithmetic
ADD_D Adder (double integer type) 7
ADD_l Adder (integer type) 7
ADD_M Modulo adder for addition in correct axis cycle 8
AVA Absolute value generator with sign evaluation 6
AVA_D Absolute value generator (double integer) 6
DIV Divider (REAL type) 9
DIV_D Divider (double integer type) 7
DIV_I Divider (integer type) 7
MAS Maximum evaluator 7
MIS Minimum evaluator 8
MUL Multiplier 7
MUL_D Multiplier (double integer type) 7
MUL_I Multiplier (integer type) 7
PLI20 Polyline, 20 break points 9
SII Inverter 6
SUB Subtractor 6
SUB_D Subtractor (double integer type) 6
SUB_I Subtractor (integer type) 5
DEL Dead zone element 6 Closed Loop Con‐
DEZ Dead zone element 6 trol
DIF Derivative-action element 7
DT1 Smoothing element 8
INT Integrator 8
LIM Limiter (REAL type) 6
LIM_D Limiter (DOUBLE type) 6
MVS Sliding-type mean value generator 8
PC P controller 9
PIC PI controller 10
PT1 Delay element 7
RGE Ramp-function generator 12
RGJ Ramp-function generator with jerk limiting 78

Appendix B

time
BY_W Status byte to status word converter 14 Conversion
B_DW Converter 32 binary variables to status double word 10
B_W Converter 16 binary variables to status word 6
DW_B Converter status double word to 32 binary variables 6
DW_R Accepting bit string as real value 5
DW_W Status double word to status word converter 6
D_I DOUBLE INTEGER to INTEGER converter 6
D_R DOUBLE INTEGER to REAL converter 7
D_UI DOUBLE INTEGER to UNSIGNED INTEGER converter 6
D_US DOUBLE INTEGER to UNSIGNED SHORT INTEGER con‐ 6
verter
I_D INTEGER to DOUBLE INTEGER converter 6
I_R INTEGER to REAL converter 6
I_UD INTEGER to UNSIGNED DOUBLE INTEGER converter 6
I_US INTEGER to UNSIGNED SHORT INTEGER converter 6
N2_R Converting 16-bit fixed-point format (N2) to REAL 7
N4_R Converting 32-bit fixed-point format (N4) to REAL 6
R_D REAL to DOUBLE INTEGER converter 6
R_DW Bit string transfer as WORD 6
R_I REAL to INTEGER converter 6
R_N2 Converting REAL to 16-bit fixed-point format (N2) 6
R_N4 Converting REAL to 32-bit fixed-point format (N4) 6
R_UD REAL to UNSIGNED DOUBLE INTEGER converter 6
R_UI REAL to UNSIGNED INTEGER converter 6
R_US REAL to UNSIGNED SHORT INTEGER converter 5
UD_I INTEGER DOUBLE INTEGER to INTEGER converter 5
UD_R UNSIGNED DOUBLE INTEGER to REAL converter 6
UI_D UNSIGNED INTEGER to DOUBLE INTEGER converter 6
UI_R UNSIGNED INTEGER to REAL converter 6
US_D UNSIGNED-SHORT-INTEGER to DOUBLE INTEGER con‐ 6
verter
US_I UNSIGNED-SHORT-INTEGER to INTEGER converter 5
US_R UNSIGNED-SHORT-INTEGER to REAL converter 5
W_B Converter, status word to 16 binary variables 5
W_BY Status word to status byte converter 5
W_DW Status word to status double word converter 6

Appendix B

time
AND BOOL type 7 Logic
BF Flash function BOOL 12
BSW Binary change-over switch (BOOL type) 5
CNM Controllable numeric memory (REAL type) 6
CNM_D Controllable numeric memory (double integer type) 6
CNM_I Controllable numeric memory (integer type) 6
CTR Counter (BOOL type) 7
DFR Reset-dominant D-type flip-flop (BOOL type) 6
DLB Delay element (REAL type) 7
DX8 Demultiplexer, 8 outputs, (REAL type) 6
DX8_D Demultiplexer, 8 outputs, (DOUBLE INTEGER type) 14
DX8_I Demultiplexer, 8 outputs, (INTEGER type) 13
ETE Edge evaluator (BOOL type) 6
LVM Double-sided limit monitor with hysteresis (BOOL 7
type)
MFP Pulse generator (BOOL type) 6
MUX8 Multiplexer, cascadable (BREAL type) 6
MUX8_D Multiplexer, cascadable (DOUBLE INTEGER type) 12
MUX8_I Multiplexer, cascadable (INTEGER type) 13
NAND Block (BOOL type) 7
NCM Numeric comparator (REAL type) 6
NCM_D Numeric comparator (DOUBLE INTEGER type) 5
NCM_I Numeric comparator (INTEGER type) 6
NOP1 Dummy block (REAL type) 5
NOP1_B Dummy block (BOOL type) 5
NOP1_D Dummy block (DOUBLE INTEGER type) 4
NOP1_I Dummy block (INTEGER type) 6
NOP8 Dummy blocks (REAL type) 8
NOP8_B Dummy blocks (BOOL type) 8
NOP8_D Dummy blocks (DOUBLE INTEGER type) 8
NOP8_I Dummy blocks (INTEGER type) 8
NOR Block (BOOL type) 7
NOT Inverter (BOOL type) 5
NSW Numeric change-over switch (REAL type) 6
NSW_D Numeric change-over switch (DOUBLE INTEGER type) 5
NSW_I Numeric change-over switch (INTEGER type) 6
OR (BOOL type) 7
PCL Pulse shortening device (BOOL type) 6
PDE Closing delay device (BOOL type) 5
PDF Breaking delay device (BOOL type) 6
PST Pulse stretching device (BOOL type) 6
RSR RS flip-flop, R-dominant (BOOL type) 6

Appendix B

time
RSS RS flip-flop, S-dominant (BOOL type) 6
SH_DW Shift block (DWORD type) 6
TRK Tracking/memory element (REAL type) 6
TRK_D Tracking/memory element (WORD type) 6
XOR Block (BOOL type) 6
RDP Reading drive parameters (REAL type) 14 System
RDP_D Reading drive parameters (DOUBLE type) 14
RDP_I Reading drive parameters (INTEGER type) 15
RDP_UD Reading drive parameters (UNSIGNED DOUBLE INTE‐ 15
GER type)
RDP_UI Reading drive parameters (UNSIGNED INTEGER type) 16
RDP_US Reading drive parameters (UNSIGNED SHORT INTEGER 15
type)
SAH Sample and hold (REAL type) 23
SAH_B Sample and hold (BOOL type) 23
SAH_BY Sample and hold (BYTE type) 24
SAH_D Sample and hold (DOUBLE type) 24
SAH_I Sample and hold (INTEGER type) 24
SAV Value buffering (REAL type) 5
SAV_BY Value buffering (BYTE type) 6
SAV_D Value buffering (DOUBLE type) 6
SAV_I Value buffering (INTEGER type) 6
STM Fault/alarm trigger 41
WRP Writing drive parameters (REAL type) 17
WRP_D Writing drive parameters (DOUBLE type) 13
WRP_I Writing drive parameters (INTEGER type) 17
WRP_UD Writing drive parameters (UNSIGNED DOUBLE INTE‐ 18
GER type)
WRP_UI Writing drive parameters (UNSIGNED INTEGER type) 16
WRP_US Writing drive parameters (UNSIGNED SHORT INTEGER 17
type)
DCA Diameter calculator 16 Technology
INCO Axial winder moment of inertia 51
TTCU Winding characteristic 25
OCA Software cam group 8
WBG Wobble generator 50

Appendix B
B.2 BOP20 status display during power-up

During power-up, the status of the power-up is briefly displayed on the BOP20.
Table B-2 Display of the power-up on the BOP20
Displayed value Meaning

0 Operation
10 Ready for operation
20 Wait for power-up
25 Wait for automatic firmware update of DRIVE-CLiQ components
31 Commissioning software download active
33 Remove/acknowledge topology error
34 End commissioning mode
35 Perform the first commissioning
70 Initialization
80 Reset active
99 Internal software error
The states listed are automatically run through during the commissioning and are normally not
visible.
In the following exceptional cases, power-up is interrupted with display value 33. In this
state, the device can be parameterized using BOP20, AOP30 and STARTER:
• Differences have been identified between the reference and actual topology.
– Correct the topology (e.g. re-insert the TM component)
– Accept the actual topology into the reference topology by setting p9905 = 1 or p9905 = 2.
Ramp-up is continued.
• A memory card with a parameter data set, which comes from a SINAMICS DCM with a
different article number is inserted in the drive
– Accept the parameter data set by setting p9906 = 3. Ramp-up is continued.
• A memory card with a parameter data set from another CUD type is inserted in the drive (e.g.
a parameter data set from the right-hand CUD was loaded into a left-hand CUD, a parameter
data set of a standard CUD was loaded into an advanced CUD)
– Accept the parameter data set by setting p9906 = 3. Ramp-up is continued.

Appendix B

Appendix C C
C.1 Standards and regulations relating to functional safety
C.1.1 General information
C.1.1.1 Aims
Manufacturers and operating companies of equipment, machines, and products are responsible
for ensuring the required level of safety. This means that plants, machines, and other equipment
must be designed to be as safe as possible in accordance with the current state of the art. For this
purpose, companies describe in the various standards the current state of the art covering all
aspects relevant to safety. If it can be justifiably assumed that all of the relevant standards are
complied with, this ensures that state-of-the-art technology has been utilized and, in turn, a
plant builder or a manufacturer of a machine or a piece of equipment has fulfilled his appropriate
responsibility.
Safety systems are designed to minimize potential hazards for both people and the
environment by means of suitable technical equipment, without restricting industrial
production and the use of machines more than is necessary. The protection of man and
environment must be assigned equal importance in all countries based on internationally
harmonized rules and regulations. This is also intended to avoid competitive advantages or
disadvantages due to different safety requirements in different countries.
There are different concepts and requirements in the various regions and countries of the
world when it comes to ensuring the appropriate degree of safety. The legislation and the
requirements of how and when proof is to be given and whether there is an adequate level
of safety are just as different as the assignment of responsibilities.
The most important thing for manufacturers of machines and companies that set up plants
and systems is that the legislation and regulations in the country where the machine or plant
is being operated apply. For example, the control system for a machine that is to be used in
the US must fulfill local US requirements even if the machine manufacturer (OEM) is based in
the European Economic Area (EEA).
C.1.1.2 Functional safety

Safety, from the perspective of the object to be protected, cannot be split-up. The causes of
hazards and, in turn, the technical measures to avoid them can vary significantly. This is why a
differentiation is made between different types of safety (e.g. by specifying the cause of possible
hazards). "Functional safety" is involved if safety depends on the correct function.
To ensure the functional safety of a machine or plant, the safety-related parts of the
protection and control devices must function correctly. In addition, the systems must behave
in such a way that either the plant remains in a safe state or it is brought into a safe state
if a fault occurs. In this case, it is necessary to use specially qualified technology that fulfills

Appendix C
the requirements described in the associated Standards. The requirements to implement

functional safety are based on the following basic goals:
• Avoiding systematic faults
• Controlling random faults or failures
Benchmarks for establishing whether or not a sufficient level of functional safety has been
achieved include the probability of hazardous failures, the fault tolerance, and the quality
that is to be ensured by avoiding systematic faults. This is expressed in the standards
using specific classification. In IEC/EN 61508, IEC/EN 62061 "Safety Integrity Level" (SIL) and
EN ISO 13849‑1 "Category" and "Performance Level" (PL).
C.1.2 Safety of machinery in Europe
The EU Directives that apply to the implementation of products are based on Article 95 of the EU
contract, which regulates the free exchange of goods. This is based on a new global concept
("new approach", "global approach"):
• EU Directives only specify general safety goals and define basic safety requirements.
• Technical details can be defined based on standards by Standards Associations that have the
appropriate mandate from the Commission of the European Parliament and Council (CEN,
CENELEC). These Standards are harmonized under a specific Directive and are listed in the
Official Journal of the Commission of the European Parliament and the Council. Legislation
does not specify that certain standards have to be complied with. When the harmonized
Standards are observed, it can be assumed that the safety requirements and specifications of
the Directives involved have been fulfilled.
• EU Directives specify that the Member States must mutually recognize domestic regulations.
The EU Directives are equal. This means that if several Directives apply for a specific piece
of equipment or device, the requirements of all of the relevant Directives apply (e.g. for a
machine with electrical equipment, the Machinery Directive and the Low-Voltage Directive
apply).
C.1.2.1 Machinery Directive

The basic safety and health requirements specified in Annex I of the Directive must be fulfilled
for the safety of machines.
The protective goals must be implemented responsibly to ensure compliance with the
Directive.
Manufacturers of a machine must verify that their machine complies with the basic
requirements. This verification is facilitated by means of harmonized standards.
IEC 61800‑5‑2 Adjustable-speed electrical power drive systems Part 5-2 is relevant for the
Machinery Directive: Safety requirements - Functional safety
Within the context of IEC 61508, IEC 61800‑5‑2 considers adjustable speed electric power
drive systems (PDS), which are suitable for use in safety-related applications (PDS(SR)).
IEC 61800‑5‑2 places demands on PDS(SR) as subsystems of a safety-related system. This
therefore permits the implementation of the electrical/electronic/programmable electronic

Appendix C
elements of a PDS(SR) taking into account the safety-relevant performance of the safety
function(s) of a PDS.
Manufacturers and suppliers of PDS(SR) can prove to users (e.g. integrators of control
systems, developers of machines and plants etc.) the safety-relevant performance of their
equipment by implementing the specifications stipulated in standard IEC 61800‑5‑2.
C.1.2.2 Harmonized European Standards

The two Standards Organizations CEN (Comité Européen de Normalisation) and CENELEC
(Comité Européen de Normalisation Électrotechnique), mandated by the EU Commission, drew-
up harmonized European standards in order to precisely specify the requirements of the EC
directives for a specific product. These standards (EN standards) are published in the official
journal of the commission of the European Parliament and Council and must be included
without revision in domestic standards. They are designed to fulfill basic health and safety
requirements as well as the protective goals specified in Annex I of the Machinery Directive.
When the harmonized standards are observed, it is "automatically assumed" that the
Directive is fulfilled. As such, manufacturers can assume that they have observed the safety
aspects of the Directive under the assumption that these are also covered in this standard.
However, not every European Standard is harmonized in this sense. Key here is the listing in
the official journal of the commission of the European Parliament and Council.
The European Safety of Machines standard is hierarchically structured. It is divided into:
• A standards (basic standards)
• B standards (group standards)
• C standards (product standards)
Type A standards/basic standards
A standards include basic terminology and definitions relating to all types of machine.
This also includes EN ISO 12100 "Safety of machines, basic terminology, general design
guidelines".
A standards are aimed primarily at the bodies responsible for setting the B and C
standards. The measures specified here for minimizing risk, however, may also be useful
for manufacturers if no applicable C standards have been defined.
Type B standards/group standards
B standards cover all safety-related standards for various different machine types. B standards
are aimed primarily at the bodies responsible for setting C standards. They can also be useful
for manufacturers during the machine design and construction phases if no applicable C
standards have been defined.
A further subdivision has been made for B standards, and more precisely:
• Type B1 standards for higher-level safety aspects (e.g. ergonomic principles, safety
clearances from sources of danger, minimum clearances to prevent parts of the body from
being crushed).
• Type B2 standards for protective safety devices are defined for different machine types (e.g.
EMERGENCY STOP devices, two-hand operating circuits, interlocking elements, contactless
protective devices, safety-related parts of controls).
Type C standards/product standards

Appendix C
C standards are product-specific standards (e.g. for machine tools, woodworking machines,
elevators, packaging machines, printing machines etc.). Product standards cover machine-
specific requirements. Under certain circumstances, the requirements can deviate from the
basic and group standards. Type C/product standards have the highest priority for machine
manufacturers who can assume that it fulfills the basic requirements of Annex I of the
Machinery Directive (automatic presumption of compliance). If no product standard has been
defined for a particular machine, type B standards can be applied when the machine is being
constructed.
A complete list of the standards specified and the mandated draft standards are available on
the Internet at the following address:
Standards (http://www.newapproach.org/)
Recommendation: Due to the rapid pace of technical development and the associated
changes in machine concepts, the standards (and type C standards in particular) should
be checked to ensure that they are up to date. Please note that the application of a particular
standard may not be mandatory provided that all safety requirements of the applicable EU
directives are complied with.
C.1.2.3 Standards for implementing safety-related controllers

If the functional safety of a machine depends on various control functions, the controller must
be implemented in such a way that the probability of safety functions failing in a dangerous
fashion is sufficiently minimized. Standards EN ISO 13849‑1 and IEC 61508 define principles for
implementing safety-related machine controls, which, when properly applied, ensure that all
the safety requirements of the EC Machinery Directive are fulfilled. These standards ensure that
the relevant safety requirements of the Machinery Directive are fulfilled.
$Q\DUFKLWHFWXUHV 'HILQHGDUFKLWHFWXUHVUHVWULFWHGPD[LPXP3/
DOO6,/ IURP3/E IRUDQHOHFWURQLFV
(1 (1,62
6DIHW\RIPDFKLQHU\ 6DIHW\RIPDFKLQHU\
)XQFWLRQDOVDIHW\VDIHW\UHODWHGHOHFWULFDO 6DIHW\UHODWHGSDUWVRIFRQWUROV
HOHFWURQLFDQGSURJUDPPDEOHHOHFWURQLF
FRQWUROV\VWHPV
6HFWRUVWDQGDUG(1IRUWKH )RUGHYLDWLRQVIURPGHILQHG
UDQJHRIPDFKLQHVDGGUHVVHGE\ DUFKLWHFWXUHVUHIHUHQFHWR
(1 (1
8QLYHUVDODSSURDFKIRUHOHFWULFDOHOHFWURQLFDQGSURJUDPPDEOHHOHFWURQLFV\VWHPVZKLFKH[HFXWHVDIHW\
IXQFWLRQVRUJXDUDQWHHIXQFWLRQDOVDIHW\
(1
)XQFWLRQDOVDIHW\VDIHW\UHODWHGHOHFWULFDOHOHFWURQLFSURJUDPPDEOHHOHFWURQLFFRQWUROV\VWHPV 3DUWVWR
Figure C-1 Standards for implementing safety-related controllers

Appendix C
The application areas of EN ISO 13849-1, EN 62061, and EN 61508 are very similar. To
help users make an appropriate decision, the IEC and ISO associations have specified the
application areas of both standards in a joint table in the introduction to the standards.
EN ISO 13849‑1 or EN 62061 should be applied depending on the technology (mechanics,
hydraulics, pneumatics, electrics, electronics, programmable electronics), risk classification
and architecture.
Further, Standard IEC 61800‑5‑2 is applicable for variable-speed electric drives with
integrated safety functions. IEC 61800‑5‑2 defines requirements and gives recommendations
for designing and developing, integrating and validating safety-related applications regarding
their functional safety. IEC 61800‑5‑2 is applicable for adjustable speed electric power drive
systems, which are handled in other parts of IEC 61800 standards.
Systems for executing safety-related EN ISO 13849-1 EN 62061

control functions
A Non-electrical (e.g. hydraulic, pneumatic) X Not covered

B Electromechanical (e.g. relays and/or basic Restricted to the designated architec‐ All architectures and max. up to SIL 3
electronics) tures (see Remark 1) and max. up to
PL = e
C Complex electronics (e.g. programmable Restricted to the designated architec‐ All architectures and max. up to SIL 3
electronics) tures (see Remark 1) and max. up to
PL = d
D A standards combined with B standards Restricted to the designated architec‐ X
tures (see Remark 1) and max. up to See comment 3
PL = e
E C standards combined with B standards Restricted to the designated architec‐ All architectures and max. up to SIL 3
tures (see Remark 1) and max. up to
PL = d
F C standards combined with A standards X X
or See comment 2 See comment 3
C standards combined with A standards
and B standards
"X" indicates that the point is covered by this standard.
Remark 1:
Designated architectures are described in Annex B of EN ISO 13849‑1 and provide a simplified basis for the quantification.
Comment 2:
For complex electronics: Using designated architectures in compliance with EN ISO 13849-1 up to PL = d or every architecture
in compliance with EN 62061.
Comment 3:
For non-electrical systems: Use components that comply with EN ISO 13849-1 as sub-systems.
C.1.2.4 DIN EN ISO 13849-1

A qualitative analysis according to DIN EN 13849-1 is not sufficient for modern control systems
due to their technology. Among other things, DIN EN ISO 13849‑1 does not take into account
time response (e.g. test interval and/or cyclic test, lifetime). This results in the probabilistic
approach in DIN EN ISO 13849-1 (probability of failure per unit time).
DIN EN ISO 13849‑1 considers complete safety functions and all the devices required to
execute these. With DIN EN ISO 13849‑1, safety functions are considered from both a
qualitative as well as a quantitative perspective. Performance levels (PL), which are based

Appendix C
on specific categories, are used. The following safety-related characteristic quantities are
required for devices/equipment:
• Category (structural requirement)
• PL: Performance level
• MTTFd: Mean time to dangerous failure
• DC: Diagnostic coverage
• CCF:
Common cause failure
The standard describes how the performance level (PL) is calculated for safety-related
components of the controller on the basis of designated architectures. For deviations from
this, DIN EN ISO 13849-1 refers to IEC 61508.
When combining several safety-related parts to form a complete system, the standard
explains how to determine the resulting PL.
Note
DIN EN ISO 13849‑1 and machinery directive
Since May 2007, DIN EN ISO 13849-1 has been harmonized as part of the Machinery Directive.
C.1.2.5 IEC 62061

IEC 62061 is a sector-specific standard, positioned below IEC 61508. It describes the
implementation of safety-related electrical control systems of machines and takes into account
the complete lifecycle - from the conceptual phase to de-commissioning. The standard is based
on the quantitative and qualitative analyses of safety functions,
whereby it systematically applies a top-down approach to implementing complex control
systems (known as "functional decomposition"). The safety functions derived from the risk
analysis are sub-divided into sub-safety functions, which are then assigned to real devices,
sub-systems, and sub-system elements. Both the hardware and software are covered.
IEC 62061 also describes the requirements placed on implementing application programs.
A safety-related control systems comprises different sub-systems. From a safety perspective,
the sub-systems are described in terms of the SIL claim limit and PFHD characteristic
quantities.
Programmable electronic devices (e.g. PLCs or variable-speed drives) must fulfill IEC 61508.
They can then be integrated in the controller as sub-systems. The following safety-related
characteristic quantities must be specified by the manufacturers of these devices.
Safety-related characteristic quantities for subsystems:
• SIL CL: SIL claim limit
• PFHD:
Probability of dangerous failures per hour
• T1:
Lifetime

Appendix C
Simple sub-systems (e.g. sensors and actuators) in electromechanical components can, in

turn, comprise sub-system elements (devices) interconnected in different ways with the
characteristic quantities required for determining the relevant PFHD value of the sub-system.
Safety-related characteristic quantities for subsystem elements (devices):
• λ:
Failure rate
• B10 value: For elements that are subject to wear
• T1:
Lifetime
For electromechanical devices, a manufacturer specifies a failure rate λ with reference to
the number of operating cycles. The failure rate per unit time and the lifetime must be
determined using the switching frequency for the particular application.
Parameters for the sub-system, which comprises sub-system elements, that must be defined
during the design phase:
• T2:
Diagnostic test interval
• β:
Sensitivity to common cause failure
• DC:
Diagnostic coverage
The PFHD value of the safety-related controller is determined by adding the individual PFHD
values for subsystems.
The user has the following options when setting up a safety-related controller:
• Use devices and sub-systems that already comply with EN ISO 13849-1, IEC 61508 or
IEC 62061. The standard provides information specifying how qualified devices can be
integrated when safety functions are implemented.
• Develop own subsystems:
– Programmable, electronic systems and complex systems: Application of IEC 61508 or
IEC 61800-5-2.
– Simple devices and subsystems: Application of IEC 62061.
IEC 62061 does not include information about non-electric systems. The standard
provides detailed information on implementing safety-related electrical, electronic, and
programmable electronic control systems. DIN EN ISO 13849-1 must be applied for non-
electrical systems.
Note
Function examples
Details of simple sub-systems that have been implemented and integrated are now available as
"functional examples".

Appendix C
Note
IEC 62061 and Machinery Directive
IEC 62061 has been ratified as EN 62061 in Europe and harmonized as part of the Machinery
Directive.
C.1.2.6 Series of standards IEC 61508 (VDE 0803)

This series of standards describes the current state of the art.
IEC 61508 is not harmonized in line with any EU directives, which means that an automatic
presumption of conformity for fulfilling the protective requirements of a directive is not
implied. However, the manufacturer of a safety-related product can also use IEC 61508 to
fulfill basic requirements of European directives in accordance with the latest conceptual
design, for example, in the following cases:
• If no harmonized standard exists for the application in question. In this particular case, the
manufacturer may use IEC 61508. although no presumption of conformity exists here.
• Reference is made to IEC 61508 from a harmonized European standard (e.g. EN 62061,
EN ISO 13849, IEC 60204‑1). This ensures that the appropriate requirements of the directives
are fulfilled ("standard that is also applicable"). When manufacturers apply IEC 61508
properly and responsibly in accordance with this reference, they can use the presumption of
conformity of the referencing standard.
IEC 61508 covers all the aspects that must be taken into account when E/E/PES systems
(electrical, electronic, and programmable electronic system) are used in order to execute
safety functions and/or to ensure the appropriate level of functional safety. Other hazards
(e.g. electric shock) are not part of the standard, similar to DIN EN ISO 13849.
IEC 61508 has recently been declared the "International Basic Safety Publication", which
makes it a framework for other sector-specific standards (e.g. EN 62061). As a result, this
standard is now accepted worldwide, particularly in North America and in the automotive
industry. Today, many regulatory bodies already stipulate it (e.g. as a basis for NRTL listing).
Another recent development with respect to IEC 61508 is its system approach, which extends
the technical requirements to include the entire safety installation from the sensor to the
actuator, the quantification of the probability of hazardous failure due to random hardware
failures, and the creation of documentation covering all phases of the safety-related lifecycle
of the E/E/PES.
C.1.2.7 Risk analysis/assessment

Risks are intrinsic in machines due to their design and functionality. For this reason, the
Machinery Directive requires that a risk assessment be performed for each machine and, if
necessary, the level of risk reduced until the residual risk is less than the tolerable risk. To assess
these risks, the following standards must be applied:
• EN ISO 12100 "Safety of Machinery - General Design Principles - Risk Assessment and
Minimizing Risks"
• EN ISO 13849-1 "Safety-related parts of control systems"

Appendix C
EN ISO 12100 focuses on the risks to be analyzed and the design principles for minimizing
risk.
The risk assessment is a procedure that allows hazards resulting from machines to be
systematically investigated. Where necessary, the risk assessment is followed by a risk
reduction procedure. When the procedure is repeated, this is known as an iterative process.
This can help eliminate hazards (as far as this is possible) and can act as a basis for
implementing suitable protective measures.
The risk assessment involves the following points:
• Risk analysis
– Determination of the limits of the machine (EN ISO 12100)
– Identification of hazards (EN ISO 12100)
• Risk evaluation
As part of the iterative process to achieve the required level of safety, a risk evaluation is
carried out after risk estimation. A decision must be made here as to whether the residual
risk needs to be reduced. If the risk is to be further reduced, suitable protective measures
must be selected and applied. The risk assessment must then be repeated.
67$57
'HWHUPLQDWLRQRIWKHOLPLWVRIWKHPDFKLQH
,GHQWLILFDWLRQRIGDQJHU 5LVNDQDO\VLV 5LVNDVVHVVPHQW
5LVNHVWLPDWLRQ
5LVNHYDOXDWLRQ
<HV
,VWKHPDFKLQHVDIH" (1'
1R
5LVNPLQLPL]DWLRQ
5LVNPLQLPL]DWLRQDQGWKHVHOHFWLRQRIVXLWDEOHSURWHFWLYHPHDVXUHVDUHQRWSDUWRIWKHULVNDVVHVVPHQW
Figure C-2 Iterative process for achieving safety
Risks must be reduced by designing and implementing the machine accordingly (e.g. by
means of controls or protective measures suitable for the safety-related functions).

Appendix C
If the protective measures involve the use of interlocking or control functions, these must
be designed according to EN ISO 13849‑1. For electrical and electronic control systems,
EN 62061 can be applied instead of EN ISO 13849-1. Electronic controls and bus systems
must also comply with IEC 61508.
C.1.2.8 Risk minimization

Risk minimization measures for a machine can be implemented by means of safety-related
control functions in addition to structural measures. To implement these control functions,
special requirements, graded according to the magnitude of the risk, must be taken into
account. These are described in EN ISO 13849‑1 or, in the case of electrical controllers
(particularly programmable electronics), in EN 61508 or EN 62061. The requirements regarding
safety-related controller components are graded according to the magnitude of the risk and the
level to which the risk needs to be reduced.
EN ISO 13849-1 defines a risk flow chart that instead of categories results in hierarchically
graduated Performance Levels (PL).
IEC/EN 62061 uses "Safety Integrity Level" (SIL) for classification purposes. This is a
quantified measure of the safety-related performance of a controller. The required SIL is also
determined in accordance with the risk evaluation principle according to ISO 12100. Annex A
of the standard describes a method for determining the required Safety Integrity Level (SIL).
Regardless of which standard is applied, steps must be taken to ensure that all the
machine controller components required for executing the safety-related functions fulfill
these requirements.
C.1.2.9 Residual risk

In today's technologically advanced world, the concept of safety is relative. The ability to ensure
safety to the extent that risk is ruled out in all circumstances – "zero-risk guarantee" – is
practically impossible. The residual risk is the risk that remains once all the relevant protective
measures have been implemented in accordance with the latest state of the art.
Residual risks must be clearly referred to in the machine/plant documentation (user
information according to EN ISO 12100).
C.1.2.10 EC declaration of conformity

The EC Declaration of Conformity for the product can be obtained on the Internet at:
EC declaration of conformity (https://support.industry.siemens.com/cs/ww/en/view/
67385845)
C.1.3 Machine safety in the USA
A key difference between the USA and Europe in the legal requirements regarding safety at work
is that, in the USA, no legislation exists regarding machinery safety that is applicable in all of the
states and that defines the responsibility of the manufacturer/supplier. A general requirement
exists stating that employers must ensure a safe workplace.

Appendix C
For more information, refer to the following sections:

• Minimum requirements of the OSHA (Page 729)
• NRTL listing (Page 729)
• NFPA 79 (Page 730)
• ANSI B11 (Page 730)
C.1.3.1 Minimum requirements of the OSHA

The Occupational Safety and Health Act (OSHA) from 1970 regulates the requirement that
employers must offer a safe place of work. The core requirements of OSHA are specified in
Section 5 "Duties".
The requirements of the OSH Act are managed by the "Occupational Safety and Health
Administration" (also known as OSHA). OSHA employs regional inspectors who check
whether or not workplaces comply with the applicable regulations.
The OSHA regulations are described in OSHA 29 CFR 1910.xxx ("OSHA Regulations (29 CFR)
PART 1910 Occupational Safety and Health"). (CFR: Code of Federal Regulations.)
OSHA (http://www.osha.gov)
The application of standards is regulated in 29 CFR 1910.5 "Applicability of standards".
The concept is similar to that used in Europe. Product-specific standards have priority over
general standards insofar as they cover the relevant aspects. Once the standards are fulfilled,
employers can assume that they have fulfilled the core requirements of the OSH Act with
respect to the aspects covered by the standards.
In conjunction with certain applications, OSHA requires that all electrical equipment and
devices that are used to protect workers be authorized by an OSHA-certified, "Nationally
Recognized Testing Laboratory" (NRTL) for the specific application.
In addition to the OSHA regulations, the current standards defined by organizations such as
NFPA and ANSI must be carefully observed and the extensive product liability legislation that
exists in the US taken into account. Due to the product liability legislation, it is in the interests
of manufacturing and operating companies that they carefully maintain the applicable
regulations and are "forced" to fulfill the requirement to use state-of-the-art technology.
Third-party insurance companies generally demand that their customers fulfill the applicable
standards of the standards organizations. Self-insured companies are not initially subject to
this requirement but, in the event of an accident, they must provide verification that they
have applied generally-recognized safety principles.
C.1.3.2 NRTL listing

All electrical equipment and devices that are used in the US to protect workers must be certified
for the particular application by a "Nationally Recognized Testing Laboratory" (NRTL) certified by
OSHA. Nationally recognised testing laboratories (NRTLs) are authorized to certify equipment
and material by means of listing, labeling or similar. Domestic standards (e.g. NFPA 79) and
international standards (e.g. IEC/EN 61508 for E/E/PES systems) are the basis for testing.

Appendix C
C.1.3.3 NFPA 79
Standard NFPA 79 (Electrical Standard for Industrial Machinery) applies to electrical equipment
on industrial machines with rated voltages of less than 600 V. A group of machines that operate
together in a coordinated fashion is also considered to be one machine.
For programmable electronics and communication buses, NFPA 79 states as a basic
requirement that these must be listed if they are to be used to implement and execute safety-
related functions. If this requirement is fulfilled, then electronic controls and communication
buses can also be used for Emergency Stop functions, Stop Categories 0 and 1 (refer to
NFPA 79 9.2.5.4.1.4). Just the same as IEC 60204‑1, NFPA 79 no longer specifies that the
electrical energy must be disconnected by electromechanical means for emergency stop
functions.
The core requirements regarding programmable electronics and communication buses in
accordance with NFPA 79 9.4.3:
1. Control systems that contain software-based controllers must:
– In the event of a single fault,
(a) Initiate that the system is shut down and goes into a safe state
(b) Prevent the system from restarting until the fault has been rectified
(c) Prevent an unexpected start
– Offer the same level of protection as hard-wired controllers
– Be implemented in accordance with a recognized standard that defines the requirements
for such systems.
2. IEC 61508, IEC 62061, ISO 13849‑1, ISO 13849‑2, IEC 61800‑5‑2 are specified as suitable
standards in a note.
Underwriter Laboratories Inc. (UL) has defined a special category for "Programmable Safety
Controllers" for implementing this requirement (code NRGF). This category covers control
devices that contain software and are designed for use in safety-related functions.
A precise description of the category and a list of devices that fulfill this requirement can be
found on the Internet at the following address:
NRGF (http://www.ul.com) → Online Certifications Directory → UL Category code/Guide
information → search for category "NRGF"
TUV Rheinland of North America, Inc. is also an NRTL for these applications.
C.1.3.4 ANSI B11

ANSI B11 standards are joint standards developed by associations such as the Association for
Manufacturing Technology (AMT) and the Robotic Industries Association (RIA).
The hazards of a machine are evaluated based on a risk analysis/assessment. The risk analysis
is an important requirement in accordance with NFPA 79, ANSI/RIA 15.06, ANSI B11.TR‑3 and
SEMI S10 (semiconductors). The documented results of a risk analysis can be used to select a
suitable safety system based on the safety class of the application in question.

Appendix C
C.1.4 Machine safety in Japan

The situation in Japan is different from that in Europe and the US. Legislation such as that
prescribed in Europe does not exist. Similarly, product liability does not play such an important
role as it does in the US.
Instead of legal requirements to apply standards have been defined, an administrative
recommendation to apply JIS (Japanese Industrial Standard) is in place. Japan bases its
approach on the European concept and uses basic standards as national standards:
Table C-1 Japanese standards
ISO/IEC number JIS number Remark

ISO12100 JIS B 9700, JIS B 9702 Earlier designation TR B 0008 and TR B 0009
ISO13849-1 JIS B 9705-1 -
ISO13849-2 JIS B 9705-1 -
IEC 60204-1 JIS B 9960-1 Without annex F or route map of the European
foreword
IEC 61508-0 to -7 JIS C 0508 -
IEC 62061 - JIS number not yet assigned
C.1.5 Equipment regulations

In addition to the requirements laid down in guidelines and standards, company-specific
requirements must be taken into account. Large corporations in particular (e.g. vehicle
manufacturers) have stringent demands regarding automation components, which are often
listed in their own equipment specifications.
Safety-related issues (e.g. operating modes, operator actions with access to hazardous areas,
Emergency Stop concepts, etc.) should be clarified with customers early on so that they can
be integrated in the risk assessment/risk reduction process.
C.1.6 Other safety-related issues
C.1.6.1 Information sheets from the various regulatory bodies

Safety-related measures to be implemented cannot always be derived from directives, standards
or regulations. In this case, supplementary information and explanations are required.
Some regulatory bodies issue publications on an extremely wide range of subjects.
Note
These publications are in German. In some instances, they are also available in English and
French.
These information sheets issued by specialist committees can be obtained by all interested
parties (e.g. to provide support in factories, or when regulations or safety-related measures

Appendix C
for plants and machines are defined). These information sheets provide support for the fields
of machinery construction, production systems, and steel construction.
You can download the information sheets from the Internet address (http://www.bghm.de/).
C.1.6.2 Additional references

• Safety Integrated - Introduction and Terminology for Functional Safety of Machines and
Systems (02/2021 edition); article no. E86060-T1813-A101-A7
• Safety Integrated, The Safety Program for Industries of the World (5th Edition and
Supplement):
The Safety Program for World Industries (https://support.industry.siemens.com/cs/de/en/
view/28813929)

Index
Interconnecting signals, 336
What is it?, 335
3 Binector, 335
Block diagram, 87
3U1, 3W1, 3C, 3D, 139
BOP20, 339
Commissioning steps, 247
Control word, drive, 348
A Status display, 717
A_DIGITAL, 408 Brake, 557
Access levels, 324 Braking distance, 544
Accessories, 33
Acknowledge fault
On the BOP20, 347 C
Using AOP30, 365
Cable routing in the device, 82
Acknowledging errors, 623
Cable sets, 35
Acknowledging faults, 623
CBE20, 169, 306
Actual speed value A, 397
CDS, (See "Data sets")
Actual speed value B, 397
Certifications, 701
Adaptation
Korean certification, 701
Armature current controller, 551
Changing over the power unit topology, 592
Field current controller, 551
Commissioning
Address
Drive optimization, 308
Setting the PROFIBUS address, 432
Optimization runs, 252, 258
Alarms, 621
Optional additional modules, 297
Configuring, 626
STARTER, 259
Allocation Board, 168
With AOP30, 254
Analog inputs, 140
Communication
Analog outputs, 142, 373
Communication services, 374
AOP30
I&M, 482
Acknowledge fault, 365
Identification & Maintenance, 482
as the time-of-day master, 369
Port numbers used, 374
Battery replacement, 666
PROFIBUS, 428
Cable assignment, 167
via Modbus TCP, 517
Faults and alarms, 367
via PROFIdrive, 379
Installation dimensions, 63
Components
LOCAL mode, 362
CBE20 Communication Board Ethernet, 170
Menu structure, 351
Sensor Module Cabinet-Mounted SMC30, 184
Operation screen, 352
Terminal Module TM15, 200
Overview, 349
Application classes, 381
Automatic restart, 571
Connecting
Auxiliary circuits, 560
Current transformer, 111
External power unit, 90
Firing pulse transformers, 118
B Fuse monitoring, 121
BICO technology Fuse monitoring distributor, 121
Converter, 338 Pulse encoder, 145
Fixed values, 338 Voltage measurement equipment, 120
Connecting power units in parallel, 121

Index
Connecting the pulse encoder, 145 Dimension drawing, 48

Connector, 336 Device, 48
Control word 1, 389 Firing pulse transformer module, 50
Control word 1 BM, 391 Dimension drawings
Control word 2, 391 Sensor Module Cabinet SMC10, 181
Control word 2 BM, 392 Terminal Module TM150, 240
Copy protection Dimensions, 48
Activating, 648 Direct data exchange
Copying RAM to ROM, 294 Faults, 455
CPU time load, 630 GSD, 453
Creep, 545 PROFIBUS, 439
CU_STW1, 407 Disconnection, 535
CU_ZSW1, 408 Disposal, 710
CUD Dividing the unit, 55
LEDs, 609 Division options, 96
Current actual value sensing, 668 Drive Control Chart, 635
Current transformer, 111 Drive object, 328
Drive Object, 328
Drive optimization, 308
D Optimization runs, 310
DRIVE-CLiQ, 149
Data sets
Command data set (CDS), 324
Drive data set (DDS), 325
Encoder data set (EDS), 326
E
Data transfer E_DIGITAL, 408
PROFINET, 468 EDS, (See "Data sets")
DCC, 635 EIP, 496
DCP flashing, 470 Electromagnetic compatibility, (See EMC)
DDS, (See "Data sets") Electromagnetic fields, 23
Determining the axis number, 421 Electronics power supply, 139
Determining the object number, 421 Electrostatic-sensitive devices, 27
Determinism, 465 EMC, 68
Device data, 44 Basic information, 68
Device identification, 434, 454 EMC-compliant installation, 72
Device name, 467 IEC 61800-3, 69
Diagnostics Radio interference suppression filter, 75, 78
Diagnostics memory, 605 Enable, 537
Trend recorder function, 606 Encoder
using LEDs for CBE20, 172 Pulse encoder evaluation, 142, 144
using LEDs for the Sensor Module Cabinet Encoder evaluation, 546
SMC30, 193 Encoder interface, 398
Diagnostics channel Reference mark search, 400
Forwarding of messages, 455, 479 Endless trace, 616
Diagnostics via LEDs Environmental classes, 43
Sensor Module Cabinet SMC10, 180 Environmental compatibility, 710
Terminal Module TM15, 207 E-STOP, 538
Terminal Module TM150, 239 EtherNet/IP, 496
Terminal Module TM31, 226 Connection, 496
Diagnostics via STARTER, 611 Example
Digital inputs, 141 PROFIBUS telegram structure, 431
Digital outputs, 141

Index
F I
Factory setting, 259 I&M, 482
Fan I2t monitoring, 562
Operating hours counter, 561 Identification & Maintenance, 482
Fault buffer, 624 Industrial Security
Fault value, 624 IT Security, 373
FAULT_CODE, 398 Inputs, 140
Faults, 621 Analog, 140
Acknowledging, 623 Digital, 141
Configuring, 626 Overview, 371
Fault buffer, 624 Temperature sensor, 142
Faults and alarms, 367, 621 Installation
BICO interconnections, 629 Sensor Module Cabinet, 181, 194
Field characteristic, 313 Terminal Module TM150, 240
Field reversal, 592 Intended use, 3
Field supply, 123 Interconnecting signals using BICO technology, 336
Firing pulse transformers, 118 Interconnection using BICO technology, 336
Firing pulses Interface descriptions
Amplifying, 119 SMC 10 Sensor Module Cabinet, 177
Connecting in parallel, 119 Terminal Module TM150, 233
Firmware update, 655, 657 Interfaces
Fixed setpoint, 546 DRIVE-CLiQ, 149
Free telegrams, 384 Peer-to-peer, 141, 597
Friction characteristic, 314 USS, 531
Function generator, 612 IO controller, 465
Function modules IO device, 465
Technology controller, 554 IO supervisor, 465
Functional safety, 168, 719 IRT, 473
Fuse monitoring, 120 Comparison with RT, 474
Fuse monitoring distributor, 121
Fuses, 127
J
Jogging, 544
G
G2_STW, 401
G2_XIST1, 405 K
G2_ZSW, 405
Know-how protection
Gn_STW, 399
Absolute know-how protection, 648
Gn_ZSW, 402
Activating, 648
GSD
Changing the password, 650
GSD file, 433
Copy protection, 646
Data security of the memory card, 646
Deactivating, 649
H Executable functions, 645
Hearing protection, 27 For loading to the file system, 651
Holding brake, 557 Locked functions, 645
Hot restart time, 571 Overview, 644
Parameters that can be changed, 645

Index
Password check, 646

Password security, 644
Korean certification, 701 N
NACT_A, 397
NACT_B, 397
L Nameplate, 31
Lead/lag element, 549 Network Time Protocol, 376
LEDs NTP, 376
for CBE20, 172
for the Sensor Module Cabinet SMC30, 193
On the CUD, 609 O
Sensor Module Cabinet SMC10, 180
OFF2, 535
OFF3, 535
Offset correction, 116
Online mode with STARTER, 458
Load resistors, 111
Operating hours counter, 376
Unit fan, 561
Operation enable, 537
M Operation screen, (See AOP30)
Maintenance, 655 Operational brake, 557
Battery replacement, AOP30, 666 Operator panel
Manual optimization, 315 AOP30, 254, 348
Manufacturer-specific telegrams, 384 BOP20, 247, 339
MBAP, 523 Optimization
Measurement Armature current closed-loop control, 311,
Armature current, offset correction, 116 (Inductive load)
Mechanical system capable of oscillation, 314 EMF closed-loop control, 313
Media redundancy, 472 Field current closed-loop control, 311, 318
MELD_NAMUR, 398 Friction characteristic, 314
Memory card, 329, 330 manual, 252
Safely removing, 330 Manual, 315
Menu, (See AOP30) Mechanical system capable of oscillation, 314
Messages, 621 Optimization runs, 252, 258
Configuring, 626 Speed control, 312
External triggering, 627 Speed controller, 319
Modbus Application Header, 523 Optimization runs, 310
Modbus TCP, 517 Options, 33, 64
Activate via interface X1400, 519 G63, 133, 150, 604
Communication via data set 47, 526 Outputs, 140
Function codes used, 523 analog, 373
Mapping tables, 520 Analog, 142
Modbus register to the parameters of the Control Digital, 141
Unit, 520 Overview, 371
Parameterizing communication for X1400, 520 Overload protection, 562
Read and write access, 523
Reading and writing parameters, 525
Motor temperature, 565 P
MTrace, 621
Packaging label, 32
Multiple trace, 616
Parallel connection, 573
12-pulse, 582
6-pulse, 576

Index
n+m mode, 577 Setting the address, 432

Parameterization, 579 Terminating resistor, 435
Standard mode, 577 VIK-NAMUR, 434
Parallel interface, 150 PROFIBUS telegram structure, 431
Parameter PROFIdrive, 379
Factory setting, 259 Controller, Supervisor, Drive Unit, 380
Parameterization Device classes, 380
Using BOP20, 339 Reading parameters, 421
With AOP30, 353 Telegrams, 384
Parameters Write parameter, 423
Access levels, 324 PROFINET
Categories, 321 Data transfer, 468
Saving, 368 Forwarding of messages via diagnostics
Types, 321 channels, 479
Password Interface, 470
Changing, 650 PROFINET cables, 172
Peer-to-peer interface, 141, 597 PROFINET IO, 464
Ping snap, 376 Addresses, 466
Power failure IRT, 473
Restart, 571 With IRT, 466
Power unit topology, 592 With RT, 466
Process data, 388 Protective conductor connection and shield support
Process data, actual values Terminal Module TM150, 242
G1_XIST1, 403 Pulse encoder evaluation, 142, 144, 184, 546
G1_XIST2, 403
G2_XIST1, 405
G2_XIST2, 405 Q
Process data, control words
Quick stop, 535
A_DIGITAL, 408
CU_STW1, 407
G2_STW, 401
Gn_STW, 399
R
Process data, setpoints Radio interference suppression filter, 78
NSET_A, 392 Ramp-down time, 539
NSET_B, 393 Ramp-function generator, 539
Process data, status words Ramp-function integrator, 542
CU_ZSW1, 408 Ramp-function-generator tracking, 543
E_DIGITAL, 408 Ramp-up time, 539
G2_ZSW, 405 Real-time communication, 465
Gn_ZSW, 402 Recycling, 710
MELD_NAMUR, 398 Reference mark search, 400
PROFIBUS, 428 Removing modules, 57
Bus terminating resistor, 428 Replacement
Cable, 84 Operator panel battery, 665
Connection, 427 Replacing the Backup Battery of the Cabinet Operator
Connector, 84, 149, 427 Panel, 665
Device identification, 434, 454 Replacing the CUD, 663
Direct data exchange, 439 Restart, 571
Forwarding of messages via diagnostics Ribbon cables, 162
channels, 455 Ring topology, 472
Generic station description file, 433, 453 Scalance, 472
Master class 1 and 2, 429

Index
RT Reference model, 549

Comparison with IRT, 474 Start pulse, 548
RT class Speed-dependent current limiting, 567
Setting, 475 Standard CUD, 150
RT classes Standard telegrams, 384
Send cycles, 476 STARTER, 259
Update cycles, 476 Commissioning, 261
Configuring a drive unit, 269
Creating the project, 261
S Installation, 260
Online mode via PROFINET, 458
Safety instructions
Project wizard, 263
Electromagnetic fields, 23
Starting the drive project, 290
Electrostatic-sensitive devices, 27
User interface, 260
General safety instructions, 21
Startup trace, 619
Terminal Modules, 201, 214, 232
Status display at the BOP20, 717
Safety Integrated
Status word 1, 394
Functional safety, 719
Status word 1 BM, 396
Machinery Directive, 720
Status word 2, 396
Safety shutdown E-STOP, 538
Status word 2 BM, 397
Sensor Module Cabinet-Mounted SMC10, 175
STW1, 389
Sequence of objects in the telegram, 430, 468
STW1 BM, 391
Series connection
STW2, 391
12-pulse, 589, 591
STW2 BM, 392
6-pulse, 584, 587
Switch on, 533
Setpoint channel
Operation enable (enable), 537
Creep, 545
Synchronization domain, 475
Fixed setpoint, 546
Synchronization, ping snap, 376
Jogging, 544
Ramp-function generator, 539
Shipbuilding, 667, 701
Shutdown, 533
T
OFF2 (disconnection), 535 Technical data
OFF3 (quick stop), 535 Communication Board CBE20, 174
Simulation mode, 629 Device data, 44
SINAMICS Link Sensor Module Cabinet SMC10, 182
Activation, 491 Sensor Module Cabinet SMC30, 196
Bus cycle, 486 Terminal Module TM15, 212
Configuration example, 492 Terminal Module TM150, 242
Configuring, 488 Terminal Module TM31, 230
Requirements, 484 Technology controller, 554
Synchronous cycle, 486 Telegrams
Transmission time, 485 Manufacturer-specific, 384
SINAMICS time synchronization Sequence of objects, 430, 468
Setting, 378 Standard, 384
Single trace, 616 Structure, 388
Single-phase line supply, 571 Temperature sensor, 142
SMC10, 169, 301 Terminal Module Cabinet, 133, 150, 604
SMC30, 169, 301 Terminal Module TM15, 200, 298
Speed controller, 548 Terminal Module TM150, 231, 298
Adaptation, 548 Terminal Module TM31, 213, 298
Droop, 548 Thermal overload protection, 562
Thyristor diagnostics, 607

Index
Time stamp, 376 XP24V, 139

Time synchronization, 376 XR1, 146
Time-of-day master, 369 XS1, 146
Timeout monitoring, 365 XT1, 146
TM15, 169, 200 XT5, XT6, 152
TM150, 169
TMC, 133, 150, 604
Trace function, 614 Z
Trend recorder function, 606
ZSW1, 394
ZSW1 BM, 396
ZSW2, 396
U ZSW2 BM, 397
Unit fan
Operating hours counter, 561
Update
Firmware, 657
Upgrading
Firmware version, 655
Using the speed controller for other applications, 551
USS interface, 531
W
WARN_CODE, 398
Write protection
Activating, 642
Deactivating, 644
Overview, 642
X
X_I_IST, 146
X100, X101, 149
X11 ... X26, 156
X126, 149, 427
X165, 150
X166, 150
X177, 140, 141, 142
X178, 148
X179, 148
X200, X201, 168
X21A, X21PAR, 162
X22A, X22PAR, 163
X23A, X23B, 164
X45, 166
XB, 146
XF1, 166
XIMP_1 ... XIMP_26, 156
XL1, 146
XL2, 146
XM, 146

Index

More information
Siemens:
www.siemens.com
Industry Online Support (service and support):
www.siemens.com/online-support
IndustryMall:
www.siemens.com/industrymall
Siemens AG
Digital Industries
Motion Control
Postfach 3180
91050 Erlangen
Germany
Scan the QR-Code

for product
information

Sinamics DCM Control Module En-Us

Uploaded by

Copyright:

Available Formats

Sinamics DCM Control Module En-Us

Uploaded by

Document Information

Original Title

Copyright

Available Formats

Share this document

Share or Embed Document

Sharing Options

Did you find this document useful?

Is this content inappropriate?

Copyright:

Available Formats

Sinamics DCM Control Module En-Us

Uploaded by

Copyright:

Available Formats

Edition 06/2023

Siemens AG A5E34888669A Copyright © Siemens AG 2009 - 2023.

Device firmware version

SINAMICS DCM Control Module

CUD (print on label) Executable firmware versions

SINAMICS DCM Control Module

Getting information about the product

SINAMICS DCM documentation available

SINAMICS DCM DC Converters Operating Instructions

Manuals and application notes on the Internet

FAQ in the Internet

SINAMICS DCM Control Module

Use of third-party products in this documentation

Websites of third parties

Compliance with the General Data Protection Regulation

SINAMICS DCM Control Module

For this product, this means:

Further Internet links

SINAMICS DCM Control Module

SINAMICS DCM Control Module

SINAMICS DCM Control Module

6.1.3 Arranging components for converter units ......................................................................... 77

SINAMICS DCM Control Module

6.16.4.6 DRIVE-CLiQ connection .................................................................................................... 149

SINAMICS DCM Control Module

7.4 Terminal Module TM15 .................................................................................................... 200

SINAMICS DCM Control Module

7.6.9 Technical data.................................................................................................................. 242

SINAMICS DCM Control Module

9.1.2.2 Handling data sets ........................................................................................................... 327

SINAMICS DCM Control Module

10.2.2.2 Setting SINAMICS time synchronization ............................................................................ 378

SINAMICS DCM Control Module

10.5.8 Support of I&M data sets 1...4 .......................................................................................... 482

SINAMICS DCM Control Module

10.16 Technology controller ...................................................................................................... 554

SINAMICS DCM Control Module

10.32.7 Simulation mode ............................................................................................................. 629

SINAMICS DCM Control Module

SINAMICS DCM Control Module

C.1.6 Other safety-related issues ............................................................................................... 731

SINAMICS DCM Control Module

SINAMICS DCM Control Module

SINAMICS DCM Control Module

SINAMICS DCM Control Module

SINAMICS DCM Control Module

SINAMICS DCM Control Module

1.2 Fundamental safety instructions for functional safety

SINAMICS DCM Control Module

1.3 Hearing protection

1.4 Warning note relating to the off button of the AOP30

1.5 ESD-sensitive components

Seated Standing Seated/standing

SINAMICS DCM Control Module

a Conductive floor e ESD wrist strap

1.6 Security information

1.7 Industrial security

SINAMICS DCM Control Module

Industrial Security Configuration Manual (https://support.industry.siemens.com/cs/ww/en/

5$09$$= Article number of SINAMICS DCM Control Module