Skip to main content
In the present study we propose a mathematical approach to improve the analysis of NK and LAK activities measured by MTT assay adapted for murine cells. We found that to calculate NK activity, high E:T ratios should be used (up to 50:1)... more
    • by  and +1
    •   15  
      ImmunologySpleenNatural Killer cellsMice
We examined the cytotoxic potential of nine N-[2-substituted-2-(2-thienyl) ethyl] piperazinyl quinolone derivatives on human oral epithelial mouth carcinoma (KB) and human squamous carcinoma (A431) cell lines. Phototoxic properties of... more
    • by 
    •   14  
      CytotoxicityCell lineMiceUltraviolet
Three haloderivatives of noscapine 2-4 were synthesized chemoselectively and their in vitro cytotoxicity was assessed by MTT assay on U-87 human glioblastoma cell lines. At 50 lM concentration after 72 h, 9-chloronoscapine 2,... more
    • by 
    •   11  
      Organic ChemistryKineticsCell lineGlioblastoma
The occurrence of the two new cis-fused A/B rings furostanol saponins (25S)-26-O-β-Dglucopyranosyl-5β-furostan-1β,3β,22α,26-tetraol-1-O-β-D-glucopyranoside and (25S)-26-Oβ-D-glucopyranosyl-5β-furostan-1β,2β,3β,5β,22α,26-hexaol and the... more
    • by 
    •   15  
      Complementary and Alternative MedicinePlant BiologySaponinsPhytotherapy
Pseudomonas aeruginosa, a common agent of septicemia, enters into human endothelial cellsin vitro but the effects of bacterial infection have not been addressed properly. In this study, human umbilical vein endothelial cells (HUVEC) were... more
    • by 
    •   18  
      MicrobiologyImmunologyMedical MicrobiologyTranscription Regulation
Reactive oxygen species (ROS) play important roles in the process of ultraviolet-induced skin damage or photoaging. Although many enzymatic and chemical methods have been developed for evaluating ROS, evaluation methods for ROS generation... more
    • by  and +2
    •   10  
      AntioxidantsReactive Oxygen SpeciesUltravioletCell Death
Gallic acid-based indanone derivatives have been synthesised. Some of the indanones showed very good anticancer activity in MTT assay. Compounds 10, 11, 12 and 14 possessed potent anticancer activity against various human cancer cell... more
    • by 
    •   20  
      Organic ChemistryCytotoxicityPharmaceutical ChemistryAntioxidants
The surface of polyethersulfone (PES) membrane was modified by blending triblock copolymers of methoxyl poly(ethylene glycol)-polyurethane-methoxyl poly(ethylene glycol) (mPEG-PU-mPEG), which were synthesized through solution... more
    • by 
    •   16  
      Chemical EngineeringBiomedical EngineeringPolymersMagnetic Resonance Spectroscopy
Incorporation of the antimicrobial peptide LL-37 ([LL-37, 37 aa]), as well as low molecular weight antimicrobial chlorhexidine, into mesoporous silica was obtained using an EISA one-pot synthesis method. FTIR... more
    • by  and +1
    •   21  
      Inorganic ChemistryBiomaterialsMultidisciplinaryAdsorption
The organotin(IV) compounds used in chemotherapy due to its lipophilicity, affected by the number of carbon atoms and the cytotoxicity. These are affected by the obtainability of Sn coordination bond and bond stabilization between ligand... more
    • by 
    •   7  
      ApoptosisOrganotinAnticancer DrugsFlowcytometry
Honokiol and magnolol, two major phenolic constituents of Magnolia sp., have been known to exhibit antibacterial activities. However, until now, their antibacterial activity against Propionibacterium sp. has not been reported. To this... more
    • by 
    •   11  
      Cell lineLignansEuropeanAntibacterial activity
In the present study, reconstructed human epidermis (RHE) was used as an in vitro model to discriminate 1-chloro-2,4-dinitrobenzene (DNCB), nickel sulfate (NiSO 4 ), oxazolone (OXA), 2,4-dinitrofluorobenzene (DNFB) and... more
    • by 
    •   5  
      NickelBenzoic AcidIn Vitro ToxicologyLymph Node
Ten commercially available denture adhesives, nine soluble formulations (six creams, three powders) and one insoluble product (pad), were analyzed regarding the cytotoxicity profile in direct and indirect assays using L929 fibroblast... more
    • by 
    •   28  
      DentistryFluorescent Dyes and ReagentsConfocal MicroscopyCytoskeleton
The semi-automated MTT colorimetric assay has previously been applied on Leishmania promastigotes based on the ability of viable parasites to reduce the tetrazolium salt to an insoluble formazan product. As promastigotes are non-adherent,... more
    • by 
    •   9  
      MicrobiologyParasitologyMedical MicrobiologyGrowth Kinetics
Artemisinin regarded as one of the most promising anticancer drugs can bind to DNA with a binding constant of 1.04 9 10 4 M -1 . The electrochemical experiments indicated that for longer incubation time periods, the reduction peak current... more
    • by 
    •   10  
      Materials EngineeringNanoparticleCarbon NanotubeNanotechnology
The aim of the work was early identification of preventable risk factors connected with the consumers usage of products of everyday use, such as cosmetics, toys and children products, and other materials intended for contact with human... more
    • by 
    •   24  
      Molecular BiologyFluorescenceCell CultureCell line
Lead is a non-essential element that exhibits a high degree of toxicity, especially in children. Most research on lead has focused on its effects on organ systems such as the nervous system, the red blood cells, and the kidneys which are... more
    • by 
    •   19  
      DNA damageGene expressionMolecular MechanicsCell Division
Homolytic aroylation of pyrazine nucleus with various substituted aromatic carbaldehydes afforded a series of 5-aroylpyrazine-2carboxylic acid derivatives. The synthetic approach, analytical and spectroscopic data of all compounds... more
    • by 
    •   10  
      Medical MicrobiologyMycobacterium tuberculosisAntimicrobial activityAntifungal Activity
Cell encapsulation represents an alternative nonviral technique to treat multiple diseases, leading to a reduction or even absence of administration of immunosuppressants. Hydrogels have been introduced as novel materials suitable for... more
    • by 
    •   7  
      Materials EngineeringStructural IntegrityCell therapyCell Viability
Bioactive glass ceramic nanoparticles (nBGC) were synthesized by sol-gel process and characterized using FTIR, TEM and XRD. Composite scaffolds of chitosan (CS)-gelatin (CG) with nBGC were prepared by blending of chitosan and gelatin with... more
    • by 
    •   8  
      Chemical EngineeringProtein adsorptionBone RegenerationSol Gel Process
    • by  and +1
    •   22  
      Chronic PainChromatographyMass SpectrometryInvertebrates
This study aims at the formulation of curcumin with biodegradable thermoresponsive chitosan-g-poly (N-vinylcaprolactam) nanoparticles (TRC-NPs) for cancer drug delivery. The spherical curcumin-loaded nanoparticles of size 220 nm were... more
    • by 
    •   10  
      EngineeringFlow CytometryDrug deliveryCell line
Tattooing is an ancient art and is still widely practiced all over the world. Since the biocompatibility of tattoo dyes has not been well researched, we studied the toxicity of a commercial tattoo ink, commonly used in tattoo lab and... more
    • by 
    •   19  
      Electron MicroscopyArchivesScanning Electron MicroscopySkin
Thymoquinone (TQ), the active constituent of Nigella sativa or black cumin exhibited cytotoxic effects in several cancer cell lines. In this study, the cytotoxicity of TQ in human cervical squamous carcinoma cells (SiHa) was investigated.... more
    • by 
    •   17  
      Cell CycleApoptosisCercopithecus aethiopsCell line
Due to their properties and common occurrence, fungi constitute the most frequent cause of biodeterioration of building materials and a serious health hazard to occupants. The authors present the methods of mycological analysis used to... more
    • by 
    •   7  
      ArchitectureBuildingBuilding MaterialBuilding Environment
Recent study was conducted to develop a simple UV spectrophotometric method to determine an HCV inhibitor, Velpatasvir in bulk form according to official requirement and validate as per ICH guidelines. λmax of Velpatasvir was found 303... more
    • by  and +1
    •   5  
      PharmacologyPharmacyCytotoxicMethanolic Extract
Introduction Several different synthetic and allograft bone graft substitutes are used clinically to treat large bone defects. In contrast to the ''gold standard'' of autologous bone grafts, these do not contain bone-forming (MSC) or... more
    • by 
    •   13  
      Fluorescence MicroscopyCell AdhesionScanning Electron MicroscopyGene expression
Leber's hereditary optic neuropathy (LHON) is a maternally inherited blinding disease due to mitochondrial DNA (mtDNA) point mutations in complex I subunit genes, whose incomplete penetrance has been attributed to both genetic and... more
    • by 
    •   16  
      GeneticsMitochondriaMultidisciplinaryMitochondrial DNA
Background Phosphatidylcholine formulation has been used to dissolve local fat deposits. This study aimed to evaluate and compare the effects of phosphatidylcholine formulation and its vehicle sodium deoxycholate alone on different cell... more
    • by 
    •   14  
      ColorimetryCell lineEndothelial CellsCell Death
Recently, the environmental residues of polybrominated diphenyl ethers (PBDEs) have markedly increased. In particular, the levels of certain PBDE congeners in fish have raised concern regarding potential risks associated with dietary... more
    • by 
    •   10  
      ApoptosisCell lineReactive Oxygen SpeciesCell Viability
Phytochemical and bioactivity studies of the flowers of Melastoma malabathricum L. (Melastomataceae) have been carried out. The ethyl acetate extract yielded three compounds, identified as naringenin, kaempferol and... more
    • by 
    •   8  
      Electron Spin ResonanceFood ChemistryMultidisciplinaryCell line
Twenty-nine air samples of total suspended particles (TSP, particles less than 30–60 μm) and thirty samples of particles with aerodynamic diameter smaller than 2.5 μm (PM2.5) were collected at Guiyu, an electronic waste (e-waste)... more
    • by 
    •   8  
      Environmental EngineeringCell lineAir SamplingAtmospheric sciences
This study reports for the first time the biological properties of Portuguese propolis. The antioxidant potential of propolis samples from Bornes (Northeast) and Fundão (Centre) regions of Portugal was evaluated by their ability to... more
    • by 
    •   23  
      PortugueseFree RadicalsCancerTreatment
Background: Blechnum orientale Linn. (Blechnaceae) is used ethnomedicinally for the treatment of various skin diseases, stomach pain, urinary bladder complaints and sterilization of women. The aim of the study was to evaluate antioxidant,... more
    • by 
    •   30  
      Complementary and Alternative MedicineFlavonoidsAntioxidantsCell line
Background: Cancer is a leading cause of death worldwide , with approximately 17.5 million new cases and 8.7 million cancer related deaths in 2015. The problems of poor selectivity and severe side effects of the available anticancer... more
    • by 
    •   10  
      PharmacologyBiochemistryPharmacyToxicology
This study was undertaken to evaluate the effect of the G93A mutation in the human Cu/Zn-superoxide dismutase gene (hSOD1) on the phosphatidylinositol-3-kinase (PI3K)/Akt and glycogen synthase kinase-3 (GSK-3) pathway in motoneuron, and... more
    • by 
    •   19  
      ToxicologyBiologyOxidative StressApoptosis
Context: Some flavonoids have been described as neuroprotectors. Gossypitrin (Gos) is a natural occurring flavonoid and the main bioactive substance from the flowers of Talipariti elatum Sw. (Majagua azul), traditionally used in Cuba as... more
    • by 
    •   49  
      Survival AnalysisHypoxiaOxidative StressCytotoxicity
The search for new anti-cancer drugs is one of the most prominent research areas of natural products. Numerous active compounds isolated from Brazilian Cerrado plant species have been studied with promising results. Aim of the study: To... more
    • by 
    •   19  
      Complementary and Alternative MedicineTraditional MedicinePlant BiologyBrazil
    • by 
    •   8  
      ImmunologyCell DivisionHeparinVascular endothelium
Background: The incidence rate of cervical cancer is increasing and its existing drugs are becoming more and more resistant. Therefore, we extracted the fruiting body of Calocybe indica edible mushroom in 90% ethyl acetate extract (EAE)... more
    • by 
    •   5  
      ApoptosisMedicineAnticancer ResearchHeLa
The purpose of this study was to investigate the potential effects of epothilones (EPOs), a new class of microtubule stabilizing cytotoxic drugs, on glioma cells in vitro. The effects of 1, 10 and 100 nM concentrations of EPO D in four... more
    • by 
    •   22  
      MorphologyConfocal MicroscopyCytotoxicityCytoskeleton
A novel series of optically active 2-aminobenzothiazole derivatives were synthesized by reaction of optically active amine (I) with thiophosgene to obtain optically active isothiocyanates (IIa–h) which on condensation with... more
    • by 
    •   12  
      Organic ChemistryDNA damageCell lineMice
Nitric oxide is a free radical involved in the pathogenesis of cancer by increasing tumour vascularization and metastasis. Studies using nitric oxide inhibitors have shown decrease in tumour growth and a role in cancer therapy. To analyse... more
    • by 
    •   9  
      Food ChemistryMultidisciplinaryFree RadicalCancer Therapy
Brine shrimp lethality assay Trypan blue dye exclusion assay MTT assay Antioxidant a b s t r a c t
    • by 
    •   17  
      Materials ScienceBiomedical EngineeringSurvival AnalysisAntioxidants
Neuroblastoma is a common childhood tumor derived from the periph- eral nervous system. Favorable neuroblastomas usually express TrkA, the receptor for nerve growth factor (NGF), whereas unfavorable, MYCN- amplified neuroblastomas usually... more
    • by 
    •   19  
      CancerEnzyme InhibitorsDNA damageApoptosis
The present study describes the phytochemical profile and the protective effects of Ceratonia siliqua pods essential oil (CsEO), a food and medicinal plant widely distributed in Tunisia. Twenty five different components were identified in... more
    • by 
    •   23  
      MicrobiologyFoodIndustrial BiotechnologyCytotoxicity
Background: Considerable interest has been aroused in recent years by the well-known notion that biological systems are sensitive to visible light. With clinical applications of visible radiation in the far-red to near-infrared region of... more
    • by 
    •   28  
      Complementary and Alternative MedicineRadiation ProtectionOxidative StressMitochondria
1National Centre for Alternative Methods (ZEBET), Berlin, Germany; 2ECVAM, Institute for Health & Consumer Protection, European Commission Joint Research Centre, Ispra, Italy; 3Syngenta, Macclesfield, UK; 4Unilever, Sharnbrook, UK;... more
    • by 
    •   17  
      European UnionHuman Skin AgeingBiometryCorrosion
The C-2 sulfonamido pyrimidine nucleosides were prepared by opening the 2,2′- or 2,3′-bond in anhydronucleosides under nucleophilic attack of sulfonamide anions. Reaction of the sodium salt of p-toluenesulfonamide or... more
    • by  and +1
    •   27  
      Organic ChemistryMetallomicsCalciumEnzyme Inhibitors
Room temperature solid state diffusion reaction induced by mechanical alloying (MA) of elemental blends of Mg, Zn and Ca of nominal composition 60 at.% Mg-35 at.% Zn-5 at.% Ca has been studied. Formation of fully amorphous structure has... more
    • by  and +2
    •   13  
      EngineeringMaterials ScienceHeat TreatmentCytotoxicity