REINERT Tessa 2023 ED222

Capillary electrophoresis-mass spectrometry applied to
the quantitative and structural study of monoclonal

antibodies after administration
Tessa Reinert
To cite this version:

Tessa Reinert. Capillary electrophoresis-mass spectrometry applied to the quantitative and structural
study of monoclonal antibodies after administration. Analytical chemistry. Université de Strasbourg,
2023. English. �NNT : 2023STRAF049�. �tel-04601237�
HAL Id: tel-04601237

https://theses.hal.science/tel-04601237
Submitted on 4 Jun 2024
HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est

archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents
entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non,
lished or not. The documents may come from émanant des établissements d’enseignement et de
teaching and research institutions in France or recherche français ou étrangers, des laboratoires
abroad, or from public or private research centers. publics ou privés.
UNIVERSITÉ DE STRASBOURG
ÉCOLE DOCTORALE DES SCIENCES CHIMIQUES

Chimie de la Matière Complexe (CMC) – UMR 7140
THÈSE
présentée par :
Tessa REINERT
Soutenue le : 18 octobre 2023
Pour obtenir le grade de : Docteur de l’université de Strasbourg

Discipline/ Spécialité : Chimie analytique
Électrophorèse capillaire-spectrométrie de masse

appliquée à l’étude quantitative et structurale
d’anticorps monoclonaux après administration
THÈSE dirigée par :
Dr FRANCOIS Yannis Maître de Conférences, Université de Strasbourg
Pr HOUZE Pascal Professeur-Praticien-Hospitalier,Assistance Publique-
Hôpitaux de Paris
PRESIDENTE DE JURY :
Dr CIANFERANI Sarah Directrice de Recherche CNRS, Université de
Strasbourg
RAPPORTEURS :
Pr FILLET Marianne Professeur des Universités, Université de Liège
Pr MENET Marie-Claude Professeur des Universités, Université Paris Saclay
AUTRES MEMBRES DU JURY :

Dr CLAVIER Séverine Responsable de laboratoire, Sanofi Vitry-sur-Seine
Dr GAHOUAL Rabah Maître de Conférences, Université Paris Cité
Pr GUILLARME Davy Professeur des Universités, Université de Genève
À ma famille
The important thing in science is not so much to obtain new facts as to discover new ways of
thinking about them.
William Lawrence Bragg
If we knew what it was we were doing, it would not be called research, would it?
Albert Einstein
-1-
-2-
REMERCIEMENTS
Loin d’être une expérience solitaire, la thèse, c’est avant tout des collaborations et interactions scientifiques
mais aussi humaines. Avant de vous lancer dans le vif du sujet, je tiens donc à présenter et remercier les
personnes formidables ayant éclairé ce parcours de thèse.
Tout d’abord, je souhaite remercier sincèrement Pr. Marianne Fillet et Pr. Davy Guillarme, rapporteurs de
ce travail, ainsi que Dr. Sarah Cianférani, Dr. Séverine Clavier et Pr. Marie-Claude Menet d’avoir accepté
d’évaluer mes travaux de recherche. C’est un honneur de voir ces travaux considérés par votre expertise.
J’en profite pour remercier toutes les personnes et institutions impliquées dans le projet ANR qui a financé
ce doctorat.
Ces prochains remerciements s’adressent de manière non exhaustive, aux personnes m’ayant entourée ces
trois dernières années.
Je commence évidemment par remercier très chaleureusement mes trois directeurs de thèse : Dr. Yannis
Francois, Pr. Pascal Houzé et Dr. Rabah Gahoual, pour m’avoir fait confiance et accompagnée dans mes
idées tout au long de ce doctorat. J’ai eu la chance d’avoir trois encadrants de très grande qualité, et je suis
reconnaissante d’avoir évolué avec vous durant ces trois années. Pascal, tu m’as toujours aidée à maintenir
l’objectif concret de ce travail, merci beaucoup pour cela. Yannis, merci pour toutes tes idées, tes conseils
et ta patience, à chaque fois que j’en ai eu besoin. Tu m’as également appris à vidanger, à
démonter/remonter la plupart de nos appareils, et même quelques bases d’électricité, qui en fait, on ne dirait
pas, mais sont tellement nécessaires pour obtenir des électrophérogrammes ! Merci de m’avoir laissé
réparer des trucs à coup de papier alu, ça marche trop bien. Rabah, je voudrais souligner et remercier ton
investissement et tes nombreux conseils. Tu m’as toujours spontanément mise en avant et encouragée à
poursuivre mes idées, je te remercie énormément pour ta confiance. Rabah, Yannis, votre encadrement, vos
conseils et votre bienveillance m’ont fait grandir en tant que chercheuse, mais aussi d’un point de vue
personnel. Merci infiniment pour votre soutien permanent (sauf quand vous voulez gagner au mini-golf).
Un grand merci également à tous les membres de mes deux laboratoires d’accueil. Merci à Dr. Emmanuelle
Leize-Wagner, directrice du Laboratoire de Spectrométrie de Masse et des Systèmes (LSMIS), pour tout ce
que tu m’as appris sur la spectrométrie de masse et pour tes conseils pertinents tout au long de ce projet.
Merci aussi à Dr. Noëlle Poitier pour la qualité de tes conseils scientifiques et ton aide à chaque fois que je
suis venue t’en demander. Du côté de l’unité de Technologies Chimique et Biologique pour la Santé
(UTCBS), je voudrais remercier aussi tous les membres pour leur chaleureux accueil à chaque fois que je
suis venue. Merci à Dr. Nathalie Mignet pour ton soutien et la pertinence de tes remarques. Un grand merci
à Dr. Khair Alhareth pour la bonne humeur que tu apportes à chaque discussion.
Et comment ne pas remercier les collègues doctorants ! D’abord, Clarisse Gosset, que dis-je : Dr Clarisse
Gosset, ma sista’ de thèse. Des nombreuses pauses thé aux stress précongrès, des attaques de capillaires
aux démontages de CE, juste : merci d’avoir été là. Merci pour tes idées, ta bonne humeur, tes
-3-
encouragements, merci à toi et à ta maman pour nous avoir nourris au chocolat, ça a été un privilège de
réaliser ma thèse à tes côtés. Merci également à Dr Mathieu Galmiche, mon compère de bureau qui avance
à mille à l’heure. Merci pour tes conseils, les discussions scientifiques, pour les cafés et les pizzas du midi !
Merci à vous deux de m’avoir formé à la CE, du montage de capillaires aux dizaines de BGE faits et refaits.
Je vous souhaite plein de bonheur pour la suite. Émilie Hirschler, ma dernière coéquipière de thèse, ça a été
un vrai bonheur de partager tous ces moments avec toi. Toujours avec le sourire, des anecdotes et des
passions (entre autres culinaires), tu es une pile électrique. Je ne doute pas de tes réussites futures et te
souhaite tout le meilleur pour la suite de ta thèse, et pour le reste aussi ! Merci à vous trois, on a beaucoup
ri !
Merci également à Anthony et Christophe de m’avoir accueillie à la fin de vos thèses.
Puis vient le tour des stagiaires, qui chaque année ont apporté leur bonne humeur à la vie du laboratoire. Je
tiens à remercier particulièrement Alexandre Kulus, Aynur Naghizade et Lola Alez-Martin, dont les stages
de M2 auront été de grands moments de ma thèse. Vos efforts accompagnés de votre enthousiasme furent
extrêmement agréables et ont permis de concrétiser des beaux projets ! Lola, je te souhaite une excellente
réussite pour la thèse que tu débutes, dont je ne doute pas de l’accomplissement. Des remerciements aussi
à Oumayma que j’ai co-encadrée, avec beaucoup de plaisir. Je tiens aussi à remercier Clémence, Aurore,
Louis, Mévie, Nicolas et Silya avec qui j’ai eu le plaisir de passer de nombreux moments. Du côté de
l’UTCBS, un grand merci à Maryame Berkani pour le super stage effectué sur ce projet.
Évidemment, un grand merci à Stéphanie Coutin, que l’on retrouve les midis, dans la joie et la bonne
humeur. Ces repas, à parler d’absolument tous les sujets qui nous viennent à l’esprit, vont beaucoup me
manquer. Merci Steph pour ta bienveillance, tes encouragements et pour ces super moments.
Et puis je voudrais également mentionner les voisins du laboratoire : l’équipe de Biogéochimie moléculaire
avec le Dr. Pierre Adam, Dr. Philippe Schaeffer, Estelle Motsch, Alice Fradet et Yu Min Kiw. J’ai
véritablement adoré ces discussions dans le couloir. Merci pour tout le matériel que vous nous avez prêté,
jusqu’au ventilo, nécessaire ces derniers jours de rédactions.
Je remercie aussi Dr. Laurent Raibaut, toujours plein d’enthousiasme et avec le sourire, ça a été un plaisir
de te croiser au labo.
Toujours dans les remerciements des personnes de l’institut Lebel, je voudrais faire une mention à Sanaa
Dreistadt, qui a toujours su faire preuve de patience et d’une réactivité incroyable dès que j’avais besoin
d’aide administrative. Merci beaucoup.
Je voudrais aussi remercier chaleureusement Dominique Melon, pour les nombreuses fois où tu as sauvé
ma thèse en répondant à mes mails et mes questions. Merci pour ta bienveillance et ta rapidité pour m’aider
à réparer la CE.
Ces remerciements sont aussi l’opportunité de m’adresser aux nombreuses personnes avec qui j’ai pu
travailler lors de collaborations. En premier lieu, je souhaiterais remercier l’équipe de l’IBMC Philippe
-4-
Hamman, Johana Chicher et Lauriane Kuhn pour m’avoir introduite à la protéomique. Lauriane, merci pour
tout le temps que tu m’as accordé et pour tes nombreuses explications sur divers sujets. Un puits de science.
Merci également à Dr. Alexander Smirnov et Christelle Gruffaz au GMGM pour le projet très intéressant
que nous avons pu débuter ensemble. Ces réunions m’ont énormément appris sur certains aspects de la
biologie.
Je voudrais aussi mentionner tous les membres de l’équipe LSMBO dirigée par le Dr. Sarah Cianferani.
Merci pour votre bienveillance lors de mes passages. Merci au Dr. Oscar Hernandez d’avoir pris le temps
de faire progresser mes travaux par nos discussions et de m’avoir formé à la photométrie de masse. Je
voudrais également remercier Hugo, Corentin, Jérôme, Rania, Jeewan, Marie, avec qui j’ai eu le plaisir de
passer du temps lors de congrès ou bien lors de mes passages à Cronenbourg. En particulier, Corentin, avec
qui j’ai pu découvrir Minneapolis. Puis Jérôme, qui m’a accompagnée à la fête de la Tomate de la Nouvelle-
Orléans (oui oui) ainsi que ses bars jazz. Ça a été une pause post-rédaction géniale !
J’en viens ensuite à mon expérience d’enseignement à la Faculté de Chimie de Strasbourg. Tout d’abord,
merci beaucoup Yannis de m’avoir fait confiance pour encadrer des TP, ça a été une expérience
extrêmement enrichissante. Et puis bien entendu, en vrai, je voudrais remercier Thomas Weissenberger.
Merci énormément pour ta bienveillance lors des TP, pour toute l’aide apportée dès que la CI a fait des
siennes, et pour les innombrables blagues que tu sors à la seconde.
J’ai pu également compter sur de nombreux collègues ayant partagé ces enseignements avec moi. On
retrouve Clacla et Emilie, ainsi que Dr. Anaïs Rodrigues, Dr Guillermo Monreal Santiago, Dr. Supansa
Chimjarn et Dr. Ahmad Saad: Ce fut un réel plaisir de travailler avec vous !
Merci également à tous les étudiants que j’ai pu encadrer, pour votre enthousiasme et motivation ! Je retire
de cette expérience une grande satisfaction !
À présent, je vais remercier mes proches, à qui je dois beaucoup.
Déjà, je voudrais commencer par celles qui ont partagé ma vie de thésarde à Stras : Anaïs et Alizée. Mes
motivations du sport, mes références organiciennes. Je pense qu’on sera parvenu à faire le tour des crêperies
et pizzerias. Nos sorties furent à chaque fois un grand bol d’air frais, merci beaucoup à vous deux pour cela.
Anaïs, notre collocation fut une source de plénitude pour moi. J’ai adoré rentrer nous raconter nos journées,
nos petites habitudes, et les week-ends que, par alignement céleste, l’on parvenait à passer ensemble.
Ensuite, je pense à Cécile, ma compatriote analytique. Avec nos sujets de thèse tellement
complémentaires, ça a été vraiment une excitation et une joie immense de te retrouver aux congrès ! Surtout,
merci pour toutes ces soirées sur Paris, et ces fous rires que je retrouve avec toi ! Lors de mes passages à
Paris, je retrouve aussi Irène, ma complice de l’ECPM. Merci pour ton soutien et pour tous ces moments.
Puis, je remercie Élise, on se connaît depuis le lycée et c’est toujours trop top quand on se retrouve !
De l’ECPM, il y a évidemment Eva, Lukas, Ann-So, Albi et Honorine. Vous êtes vraiment des perles !
Je n’oublie pas Margaux et Ysalis ! VH, le ski, le séma, (jeunesse jeunesse) la couture, nos weekends… je
vous remercie pour tous ces moments.
-5-
Et puis évidemment, j’en arrive à ma petite secte : Chab, Eliott, Alex, Lili, Neness, Mounch, Maryon
Pompom, Andréa, Célia, Yohan, Quentin, Constance, Zoé, Morgane, Armand, Julie. Une belle brochette.
Vous êtes juste incroyables, mes élastiques incassables, mes coupains formidables. Merci à tous pour
chaque moment. Neness, ça fait près de 20 ans que je suis en fou rire dès que je suis avec toi, merci
d’augmenter ainsi mon espérance de vie.
Cette thèse est dédiée à tous les membres de ma famille, pour votre soutien depuis le début.
Tout d’abord un grand merci à mes grands-parents Mireille, Gilbert et Anny pour chacune de vos attentions.
Dédicace assurément aussi à Nadine, Philippe, Andreï, Max’, Yoann, Fiona, Paul et Léon, les best du Jura!
Merci à mes petits frérots, Math’ et Robi, le sang. Merci pour vos blagues (parfois nulles), vos délires
(souvent farfelus), et votre soutien à mes projets (toujours présent). Un grand merci à Kimie et Maelle
aussi ! Et puis évidemment, merci à mes parents, Lydia et Yannick, pour tout ce que vous faites pour moi.
Merci d’apporter constamment de la joie, dans notre famille de grands enfants qui raffolent de jeux. Merci
‘Pa pour tes encouragements et toutes tes attentions. Merci Môman pour ton indéfectible soutien, et d’avoir
relu ma thèse avec grande attention.
Merci à ma deuxième famille, Blandine, Jean, Denis, Noëlle, Méli, Hugo, Marine et Alex (oui tu as le droit
à un deuxième remerciement), qui m’a si bien accueillie. Merci pour tous ces moments partagés, vous êtes
géniaux.
Enfin, j’en arrive à toi, Armand. Merci pour ton amour, ton énergie, et tes attentions quotidiennes. Merci
pour tes investissements et encouragements dans cette thèse (tmtc), que ce soit dans les plats préparés (oui
ça compte :)!), dans les longues discussions sur mes projets, dans tes conseils mathématiques, ou tes
nombreuses relectures. Merci pour ton cœur, tes rires, les miens. J’ai hâte de ce nouveau chemin avec toi.
-6-
SOMMAIRE GENERAL
Remerciements......................................................................................................................................................................... - 3 -
Sommaire général.............................................................................................................................................................. - 7 -
Liste des abréviations ....................................................................................................................................................- 11 -
Liste des Figures et des Tables ......................................................................................................................... - 13 -
Notations ....................................................................................................................................................................................... - 17 -
Introduction GÉNÉrale ......................................................................................................................................... - 19 -
Partie I : Introduction et revue bibliographique ........................................................ - 24 -
Chapitre 1. Anticorps monoclonaux thérapeutiques............................................................................ - 25 -

1.1. Structure des mAbs ............................................................................................... - 25 -
1.2. Infliximab, un mAb thérapeutique......................................................................... - 32 -
Chapitre 2. Couplage CE-MS/MS pour l’analyse d’anticorps monoclonaux ................................ - 37 -

2.1. Électrophorèse capillaire...................................................................................... - 37 -
2.2. Spectrométrie de masse......................................................................................... - 41 -
2.3. Couplage CE-MS pour la caractérisation des mAbs ............................................ - 50 -
2.4. Conclusion ............................................................................................................ - 62 -
Chapitre 3. Méthodes pour le suivi quantitatif de mAbs ..................................................................... - 63 -

3.1. Quantification de mAbs par ELISA....................................................................... - 64 -
3.2. Quantification de mAbs par spectrométrie de masse ........................................... - 67 -
Conclusion...................................................................................................................................................... - 76 -
-7-
Partie II : Mise en place de la méthode analytique ....................................................... - 77 -
Chapitre 4. Sélection des peptides à suivre.............................................................................................. - 81 -

4.1. Quantification absolue : Sélection de l’étalon interne et des peptides signatures- 81 -
4.2. Caractérisation structurale : Sélection des sites de PTM .................................... - 83 -
Chapitre 5. Développement de la méthode de purification ................................................................ - 87 -

5.1. Introduction........................................................................................................... - 88 -
5.2. Materials and methods .......................................................................................... - 90 -
5.3. Results and discussion .......................................................................................... - 94 -
5.4. Conclusion .......................................................................................................... - 103 -
5.5. Supporting Information....................................................................................... - 105 -
Chapitre 6. Analyse CESI-MS/MS des peptides ................................................................................. - 107 -

6.1. Optimisation de la séparation électrophorétique ............................................... - 107 -
6.2. Analyse par spectrométrie de masse ................................................................... - 110 -
Chapitre 7. Mise en place d’une stratégie de normalisation pour la caractérisation des PTM- 115 -
7.1. Quantification relative brute des PTM après analyse CE-MS/MS ..................... - 115 -
7.2. Mise en place d’une stratégie de normalisation ................................................. - 119 -
Conclusion.................................................................................................................................................... - 124 -
Partie III : Application de la stratégie CE-MS/MS pour la quantification et

caractérisation structurale de l’infliximab après administration .....- 125 -
Chapitre 8. Quantification et caractérisation structurale simultanée d’infliximab in vivo - 129 -

8.1. Introduction......................................................................................................... - 130 -
8.2. Materials and methods ........................................................................................ - 132 -
8.3. Results and discussion ........................................................................................ - 137 -
8.4. Conclusion .......................................................................................................... - 148 -
8.5. Supporting Information....................................................................................... - 149 -
-8-
Chapitre 9. Prédiction des PTM post-administration du produit original de l’infliximab et de ses
biosimilaires ................................................................................................................................................. - 153 -
9.1. Introduction......................................................................................................... - 155 -
9.3. Results and discussion ........................................................................................ - 160 -
9.4. Conclusion .......................................................................................................... - 166 -
9.5. Supporting information ....................................................................................... - 168 -
9.6. Discussions additionnelles .................................................................................. - 169 -
Conclusion.................................................................................................................................................... - 178 -
Partie IV : Identification et quantification d’anticorps immunogènes

par CE-MS/MS ............................................................................................................................................................................. - 179 -
Chapitre 10. Stratégie CE-MS/MS pour la détermination de constante de dissociation entre deux
anticorps ....................................................................................................................................................... - 183 -
10.1. Introduction......................................................................................................... - 186 -
10.3. Results and discussions ....................................................................................... - 190 -
10.4. Conclusions ......................................................................................................... - 198 -
Chapitre 11. Quantification simultanée de l’infliximab et de ses anticorps immunogènes dans le

sérum par CE-MS/MS .............................................................................................................................. - 201 -
11.1 Introduction......................................................................................................... - 202 -
11.2 Materials and methods ........................................................................................ - 204 -
11.3 Results and discussions ....................................................................................... - 206 -
11.4. Conclusions ......................................................................................................... - 213 -
11.6. Discussions additionnelles .................................................................................. - 215 -
Conclusion générale et perspectives ......................................................................................... - 219 -

Références Bibliographiques ...................................................................................................................... - 224 -
Liste des communications scientifiques .................................................................................... - 240 -
Enseignements dÉLIVRÉs........................................................................................................................................ - 242 -
Autres responsabilitÉs .......................................................................................................................................... - 242 -
Annexes................................................................................................................................................................................................ 243
-9-
- 10 -
LISTE DES ABRÉVIATIONS
- 11 -
A GS1/2 : Gas Supply
ADA : Anti-Drug Antibody H
ADC : Antibody Drug Conjugate HC : Heavy Chain
ADCC : Antibody Dependent Cell-mediated HMSA : Homogeneous Mobility Shift Assay
Cytotoxicity HPLC : High Performance Liquid
ADM : Adalimumab Chromatography
AMM : Autorisation de Mise sur le Marché HRP : Horseradish Peroxidase
AQUA : Absolute QUAntification I
ATI : Antibody To Infliximab IAA : Iodoacetamide
B IDMS : Isotopic Dilution Mass Spectrometry
BGE : Background Electrolyte IFX : Infliximab
C Ig : Immunoglobuline
CDC : Complement Dependent Cytotoxicity IgG : Immunoglobuline G
CDR : Complementary Determining Regions isoD : Aspartic acid isomerization
CE : Capillary Electrophoresis ITP : Isotachophorèse
CE-ESI-MS : Capillary Electrophoresis hyphenated K
to Electrospray ionisation and Mass kDa : kiloDalton
spectrometry
L
CH : Constant Heavy region
LBA : Ligand Binding Assay
CID : Collision Induced Dissociation
LC : Light Chain
CQA : Critical Quality Attribute
LOD : Limit of Detection
CV : Coefficient de Variation
LOQ : Limit of Quantification
CZE : Capillary Zone Electrophoresis
M
D
M: Molaire
Da : Dalton
mAb : Monoclonal Antibody
DDA : Data Dependent acquisition
MALDI : Matrice Assisted Laser Desorption
DIA : Data Independent acquisition
Ionisation
DLS : Diffusion Light Scattering
MALS : Multi-angle Light Scattering
DTT : Dithiothreitol
MAM : Multiple Attribute Monotoring
deaN : Asparagine Deamidation
MP : Mass Photometry
E MRM : Multiple Reaction Monitoring
ECD : Electron Capture Dissociation MS : Mass Spectrometry
EIE : Extracted ion electropherogram MS/MS : Tandem Mass Spectrometry
ELISA : Enzyme-Linked-ImmunoSorbent MT : Migration Time
Assay m/z : rapport masse sur charge
EMA : European Medicines Agency
N
EOF : Electro-osmotic flow
NATI : Neutralyzing Antibody to Infliximab
ESI : Electrospray ionization
NF-κB : Nuclear Factor-Kappa B
ETD : Electron Transfer Dissociation
NK : Natural Killer Cell
F
Non-NATI : Non Neutralyzing Antibody to
FA : Formic Acid Infliximab
Fab : Fragment antigen binding O
Fc : Fragment crystallizable oxiM: Methionine oxidation
FcR : Fc Receptor P
FcRn : Fc Receptor neonatal
PBS : Phosphate Buffer Solution
FDA : US Food and Drug Administration
PFF : Peptide fragment fingerprinting
FWHM : Full Width at Half Maximum
PMF : Peptide mass fingerprinting
G PTM : Post Translational Modification
GlcNac : N-acétylglucosamine
- 12 -
PSAQ : Protein Standard Absolute sTNF-α : Soluble Tumor Necrosis Factor alpha
Quantification T
Q TAQSI : Targeted Absolute Quantitative
Q: Quadripôle proteomics SILAC internal standards
QbD : Quality by Design t-ITP : transient Isotachophoresis
QC : Quality Controls TMB : 3',5,5'-tétraméthylbenzidine
R tmTNF-α : Transmembrane Tumor Necrosis
RG : RapiGestSF® Factor alpha
RGA : Reporter Gene Assay TNF-α : Tumor Necrosis Factor alpha
RIA : Radioimmunoassay TOF : Time of Flight
RT : Room Temperature V
RSD : Residual Standard Deviation VH : Variable Heavy chain
S Vinj : Volume d’injection
SEC : Steric Exclusion Chromatography VL : Variable Light chain
SIL : Stable Isotope Labeled mAb
SPR : Surface Plasmon Resonance
SRM : Single Reaction Monitoring
LISTE DES FIGURES ET DES TABLES

Chapitre 1
- 13 -
Figure 1.1. Représentation schématique des différents types d’anticorps monoclonaux.
Figure 1.2. Mécanisme de déamidation d’asparagine (N) en acide aspartique (D) ou acide iso-aspartique (isoD).
Figure 1.3. Mécanismes d’action de l’infliximab dans le système humain.
Table 1.1. Liste des principales modifications post-traductionnelles des acides aminés d’un anticorps.
Table 1.2. Formes d’infliximab titulaire d’une autorisation de mise sur le marché en France.
Chapitre 2
Figure 2.1. Représentation schématique d’une séparation d’analytes en électrophorèse capillaire de zone (CZE).
Figure 2.2. Représentation schématique d’une séparation d’analytes en isotachophorèse (ITP).
Figure 2.3. Premières interfaces développées pour le couplage CE-ESI-MS.
Figure 2.4. Représentation schématique de l’interface CESI.
Figure 2.5. Représentation schématique du TTOF 5600.
Figure 2.6. Principe de fonctionnement d’un quadripôle.
Figure 2.7. Mécanisme de dissociation des peptides par CID.
Figure 2.8. Représentation schématique d’un analyseur à temps de vol avec réflectron.
Figure 2.9. Schematic representation of the structure of a monoclonal antibody.
Figure 2.10. Representation of the principal analytical approach used for the characterization of mAbs.
Figure 2.11. Electrophérogramme obtenu après analyse d’un digest peptidique d’infliximab par CE-ESI-MS/MS .
Figure 2.12. Différentes approches analytiques pour la caractérisation des glycosylations des mAbs.
Figure 2.13. Analyse CE-ESI-MS des glycopeptides non-sialylés de l'antigène spécifique de la prostate
(PSA) après digestion tryptique.
Chapitre 3
Figure 3.1. Format Bridging ELISA utilisé pour la quantification de mAb dans du sérum.
Figure 3.2. Principe de la quantification absolue d’un mAb issu d’une matrice sérique par MS, par ajout
d’étalons internes.
Figure 3.3. Principaux critères d’une validation de méthode, selon les réglementations FDA et EMA.
Chapitre 4
Figure 4.1. Méthodologie schématisée de l’approche de quantification et caractérisation structurale de
l’infliximab mise en place.
Figure 4.2. Représentation schématique de l’infliximab et localisation des hotspots sélectionnés pour le
suivi structural de l’infliximab post-administration.
Table 4.1. Peptides choisis pour le suivi quantitatif de l’infliximab dans le sérum humain.
Chapitre 5
Figure 5.1. Représentations des différents paramètres de rendements considérés pour évaluer les
protocoles de purification d’échantillons avant analyse CE-MS/MS.
Figure 5.2. Approches étudiées pour l’extraction spécifique et la digestion de l’infliximab issu d’une
matrice biologique pour mener à sa quantification et caractérisation structurale via la CE-
MS/MS.
Figure 5.3. EIE du peptide SINSATHYAESVK.
Figure 5.4. Effets de la taille du filtre sur le rendement de l'étape de filtration.
Figure 5.5. Rendement de la filtration lorsque l'infliximab est introduit dans le filtre dans H 2O ou dans un
tampon citrate.
Figure 5.6. Performance de la filtration de l'infliximab dilué dans un tampon citrate avec ou sans ajout de
surfactant.
Figure 5.S1: Rendement calculé pour l'étape d'extraction de l'infliximab.
Figure 5.S2. Durée de l'étape d'isotachophorèse de chaque échantillon dans la séparation par CE.
Figure 5.S3. Rendement de l’étape d’extraction par affinité selon les conditions de filtration.
Figure 5.S4. Spectres MALS et UV de l’infliximab dans de l’eau ou un tampon citrate.
Table 5.1. Comparaison des trois stratégies étudiées sur le rendement total d’infliximab, la répétabilité,
les limites de détection et de quantification, et la visibilité des PTM.
- 14 -
Table 5.2. Résolution des entre les peptides modifiés et non modifiés observés selon le protocole de
préparation des échantillons.
Table 5.S1. Caractéristiques des peptides suivis pour le suivi CE-MS/MS d’infliximab et du SIL-IFX.
Chapitre 6
Figure 6.1. Evolution des paramètres de séparations électrophorétiques d’un digest peptidique
d’infliximab issu de matrice sérique différentes acquisitions.
Figure 6.2. Stratégie d’acquisition MS implémentée pour la quantification d’infliximab par bottom-up.
Table 6.1. Plan d’expérience utilisé pour l’optimisation des conditions électrophorétiques.
Table 6.2. Paramètres de l’acquisition MS et MS/MS des peptides séparés en CE.
Chapitre 7
Figure 7.1. Spectres MS (EIE) et MS/MS des glycopeptides de l’infliximab après analyse CE-MS/MS du
digest peptidique.
Figure 7.2. EIE des peptides avec ou sans sites hotspot PTM de l’infliximab après analyse CE-MS/MS du
digest peptidique.
Figure 7.3. Proportions relatives des 9 PTM observées par CE-MS/MS pour l’infliximab ou le SIL-IFX issus
de sérums, selon deux protocoles de digestions peptidiques.
Figure 7.4. Stratégie de normalisation implémentée pour la détermination des proportions de PTM
apparues seulement lors de l’administration de l’infliximab aux patients, 𝑓𝑏𝑙𝑜𝑜𝑑 IFX
.
Figure 7.5. Stratégie de normalisation appliquée à des sérums modèles dopés avec de l’infliximab et du SIL.
Figure 7.6. Proportions normalisées 𝑓𝑏𝑙𝑜𝑜𝑑IFX
des 9 PTM pour l’infliximab ou le SIL-IFX issus de sérums
dopés modèles, selon deux protocoles de digestions peptidique.
Table 7.1. Proportions relatives brutes après analyse CE-MS/MS ( 𝐿IFX SIL
ref et 𝐿ref )moyennes des PTM de
l’infliximab et de SIL-infliximab dopés dans des sérums sains.
Chapitre 8
Figure 8.1. Représentation schématique du protocole mit en place pour la quantification absolue et la
caractérisation simultanée de PTM de l’infliximab issu de sérum, par CE-MS/MS.
Figure 8.2. Justesse et précision de la quantification d’infliximab par CE-MS/MS et comparaison à
l’analyse ELISA.
Figure 8.3. Profils de glycosylation obtenu par analyse CE-MS/MS d’infliximab issu de matrice sérique ou
de formulation pure.
Figure 8.4. Proportions relatives de PTM obtenues par analyse CE-MS/MS d’infliximab issu de matrice
sérique ou de formulation pure.
Figure 8.5. Quantification d’infliximab dans les sérums de 24 patients traités avec cette biothérapie, par
CE-MS/MS et tests ELISA.
Figure 8.6. Représentation schématique de la procédure appliquée pour quantifier précisément les PTM
de l’infliximab seulement apparues après administration du traitement aux patients.
Figure 8.7. Mesures de la variation de la proportion des glycans de l’infliximab lorsqu’il a circulé dans
l’organisme de chaque patient.
Figure 8.8. Mesures de la variation de la proportion des PTM de l’infliximab lorsqu’il a circulé dans
l’organisme de chaque patient.
Figure 8.9. Etude des évolutions de la concentration absolue d’infliximab et de la proportion de 𝑓𝑏𝑙𝑜𝑜𝑑
IFX
de
N avec le temps de résidence de l’infliximab dans le corps des patients.
57
Figure 8.S1. Séquence d’acides aminés de l’infliximab.

Figure 8.S2. Etude de la linéarité de la méthode de quantification absolue d’infliximab.
Figure 8.S3. Etude de la stabilité du digest peptidique de l’infliximab et du SIL-IFX.
Figure 8.S4. Séparations CE de peptides avec ou sans les PTM deaN137 ou isoD283.
Figure 8.S5. Proportions relatives de PTM obtenues par analyse CE-MS/MS du SIL-IFX issu de matrice
sérique ou de formulation pure.
Figure 8.S6. Profils de glycosylation obtenu par analyse CE-MS/MS du SIL-IFX issu de matrice sérique ou
de formulation pure.
- 15 -
Table 8.1. Présentation des différentes étapes éventuellement inductrices de PTM endogènes.
Table 8.2. Résultats compilés de la validation de méthode CE-MS/MS pour la quantification absolue
d’infliximab dans du sérum biologique.
Table 8.3. Test de Welch pour identifier statistiquement les PTM de l’infliximab apparues post-
administration.
Table 8.S1. Valeurs des concentrations d’infliximab dans le sérum des 24 patients obtenues par CE-MS/MS ou ELISA.
Table 8.S2. Valeurs des proportions relatives des 6 glycans de l’infliximab dans le sérum de 21 patients
obtenues par CE-MS/MS.
Table 8.S3. Valeurs des proportions relatives des 6 PTM de l’infliximab dans le sérum de 21 patients
obtenues par CE-MS/MS.
Chapitre 9
Figure 9.1. Représentation schématique de l’établissement du calcul permettant de quantifier
précisément les PTM de l’infliximab seulement apparues durant le stress d’incubation
contrôlé in vitro.
Figure 9.2. Représentation schématique de la procédure appliquée pour quantifier précisément les PTM
de l’infliximab seulement apparues durant le stress d’incubation contrôlé in vitro.
Figure 9.3. Séparations CE de peptides avec ou sans les PTM deaN57 ou isoD404.
Figure 9.4. PTM de l’infliximab (original et biosimilaires) seulement apparues durant le stress
d’incubation contrôlé in vitro dans du sérum.
Figure 9.5. Rendements de l’extraction spécifique de l’infliximab (original et biosimilaires) selon le temps
d’incubation in vitro dans du sérum.
Figure 9.6. Profils de glycosylation de l’infliximab (original et biosimilaires) selon le temps d’incubation
in vitro dans du sérum.
Figure 9.7. Proportions d’oxydations de méthionines de l’infliximab (original et biosimilaires) selon le
temps d’incubation in vitro dans du sérum.
Figure 9.8. Proportions de déamidation de l’infliximab (original Remicade®) selon le temps d’incubation
in vitro dans du sérum.
Figure 9.9. Proportions de déamidation de l’infliximab (biosimilaires Inflectra® et Remsima®) selon le
temps d’incubation in vitro dans du sérum.
Figure 9.10. Différents aspects du sérum après prélèvement du sang aux patients.
Figure 9.11. Proportions de déamidation de l’infliximab (original Remicade®) selon le temps d’incubation
in vitro dans du PBS ou du bicarbonate d’ammonium.
Figure 9.S1. Proportions relatives de PTM obtenues par analyse CE-MS/MS du SIL-IFX issu de matrice sérique.
Figure 9.S2. Comparaison de l’évolution de la proportion de 𝑓𝑏𝑙𝑜𝑜𝑑
IFX
de deaN57 avec le temps d’incubation in
vitro dans du sérum et in vivo dans le corps de patients.
Figure 9.S3. Comparaison de l’évolution de la proportion de 𝑓𝑏𝑙𝑜𝑜𝑑IFX
de deaN387 avec le temps d’incubation
in vitro dans du sérum et in vivo dans le corps de patients.
Table 9.1. Valeurs de surfaces accessibles de 12 asparagines de l’infliximab selon les structures 3D
Table 9.2. Valeurs de surfaces accessibles des chaînes latérales des acides aminés en C-terminal des
asparagines considérées.
Table 9.S1. Proportions relatives brutes (avant normalisation) des PTM de l’infliximab (original et
biosimilaires) selon le temps d’incubation in vitro dans du sérum.
Chapitre 10
Figure 10.1. Analyses par photométrie de masse a. d’un mélange équimolaire SIL-IFX et NATI b. de NATI
seul c. de SIL-IFX seul d. d’un mélange équimolaire SIL-ADM et NATI.
Figure 10.2. Formes schématiques des complexes (1 :1) entre l’infliximab et le NATI.
Figure 10.3. Etude cinétique de la complexation infliximab/NATI par photométrie de masse.
Figure 10.4. Représentation schématique du protocole pour déterminer la constante de dissociation Kd
entre un infliximab et un NATI, par CE-MS/MS.
Figure 10.5. Régression linéaire du ratio peptidique MS de IFX*LC01 / ADM*HC01 avec la concentration de SIL-IFX.
Figure 10.6. Décroissance du ratio peptidique MS de IFX*LC01 / ADM*HC01 avec la concentration de NATI.
Figure 10.7. Plot de a0/Kd en fonction de la concentration de NATI a0 pour déterminer le Kd.
Figure 10.S1. Séparation CE des peptides IFX*LC01 du SIL-IFX et ADM*HC01 du SIL-ADM.
- 16 -
Figure 10.S2. Impact des concentrations de NATI a0 sur la détermination du Kd.
Table 10.1. Ions MS et MS/MS des peptides suivis pour le SIL-IFX et le SIL-ADM.
Table 10.2. Tableau d’avancement de la réaction de complexation entre un paratope de l’infliximab et un de NATI.
Chapitre 11
Figure 11.1. Représentation schématique du protocole pour quantifier simultanément l’infliximab et le
NATI dans du sérum, par CE-MS/MS.
Figure 11.2. Régression linéaire du ratio peptidique MS de IFXLC01 / ADM*HC01 avec la concentration d’infliximab.
Figure 11.3. Biais du rétrocalcul de la concentration de NATI a0 après analyse CE-MS/MS de sérums dopés
à des concentrations connues.
Figure 11.4. Application de la stratégie pour la quantification simultanée d’infliximab et de NATI à des
contrôles qualités de sérums modèles dopés en des concentrations connues.
Figure 11.5. Application de la stratégie pour la quantification simultanée d’infliximab et de NATI à 13
sérums de patients.
Figure 11.6. Représentation schématique du protocole final menant à la multi-caractérisation d’un sérum
d’un patient traité avec de l’infliximab.
Figure 11.S1. Séparation CE des peptides de suivi de l’infliximab, du SIL-IFX et du SIL-ADM.
Figure 11.S2. Spectres MS/MS obtenus après fragmentation CID des peptides signatures de l’infliximab, du
SIL-IFX et du SIL-ADM.
Table 11.1. Ions MS et MS/MS des peptides suivis pour l’infliximab, le SIL-IFX et le SIL-ADM.
Table 11.2. Concentration de NATI, d’infliximab, et proportions de certaines deaN et isoD de l’infliximab
apparues in vivo chez 13 sérums de patients.
NOTATIONS
ξ Potentiel zêta de la double couche en CE (V)
- 17 -
𝜀 Constante diélectrique de l’électrolyte support BGE (kg·cm·V-2·s-2)
𝜂 Viscosité de l’électrolyte support (kg·cm-1·s-1)
E Intensité du champ électrique (V·cm-1)
𝜇𝑒𝑜 Mobilité électroosmotique (cm²·V-1·s-1)
𝜇𝑒𝑝 Mobilité électrophorétique (cm²·V-1·s-1)
𝜇𝑎𝑝𝑝 Mobilité apparente (cm²·V-1·s-1)
𝑞 Charge globale de l’analyte
r Rayon hydrodynamique (cm)
𝐻 Hauteur d’un plateau théorique
𝜐𝑥 Vitesse de la phase mobile (cm·s-1)
𝐸𝑐 Energie cinétique (J)
V Potentiel appliqué au capillaire (V)
Dm Coefficient de diffusion (m²·s-1)
𝑀𝑇 Temps de migration (min)
𝜔 Largeur du pic (min)
𝑉𝑖𝑛𝑗 Volume d’injection (nL)
𝐾𝑑 Constante de dissociation
γ Coefficient d’activité
𝑟 − 𝑟𝑎𝑡𝑖𝑜 Rapport des Aires MS des peptides IFX*LC01/ADM*LC01 (SIL-IFX/SIL-ADM)
𝑦 − 𝑟𝑎𝑡𝑖𝑜 Rapport des Aires MS des peptides IFXLC01/ADM*LC01 (IFX/SIL-ADM)

p Probabilité d’une interaction infliximab/NATI
𝑓YX Facteur de modification d’une PTM sur un acide aminé de la protéine « X », lors
de l’étape « Y » de sa vie
𝐿X𝑍 Proportion relative brute d’une PTM sur un acide aminé de la protéine « X »
obtenue après analyse CE-MS/MS d’un échantillon « Z »
- 18 -
INTRODUCTION GÉNÉRALE
Fin 2022, on recense près de 1200 anticorps monoclonaux (mAbs) à usage thérapeutique en cours
d’essais cliniques et environ 130 approuvés par les autorités européennes ou américaines pour le
traitement de maladies. Leur intérêt thérapeutique repose sur leur grande spécificité et leur durée
- 19 -
de demi-vie relativement longue par rapport à d’autres biomolécules, leur attribuant une meilleure
efficacité et facilité d’administration aux patients. Lors de la production de ces biomolécules, il est
important de contrôler à la fois leur concentration, mais aussi certains autres critères. En Europe,
ces paramètres sont définis par l'Agence Européenne des Médicaments (EMA) et sont désignés
sous le nom de Critères de Qualité Critiques (CQA). Cette démarche est essentielle en raison de la
complexité structurelle des anticorps, qui peut entraîner des micro-hétérogénéités susceptibles de
compromettre leur efficacité thérapeutique. Par exemple, il est nécessaire de contrôler la
proportion de certaines modifications post-traductionnelles (PTM) ou de glycosylations, connues
pour leur influence sur les interactions de l’anticorps avec son antigène ou des récepteurs
biologiques. Ces dégradations structurelles sont caractérisées par des réactions enzymatiques sur
les acides aminés constitutifs de l’anticorps.
Le risque d’agrégation est également à considérer avec précaution, car il peut conduire à
l'élimination prématurée du mAb de l'organisme du patient. Par ailleurs, il est essentiel que le
traitement demeure soluble et peu visqueux pour conserver son efficacité. Ainsi, avant de pouvoir
commercialiser un nouvel anticorps en obtenant son autorisation de mise sur le marché (AMM),
les laboratoires développant les mAbs thérapeutiques doivent utiliser diverses méthodes
analytiques pour caractériser leur produit. Il convient également de mettre en place des conditions
de production et de stockage rigoureusement contrôlées pour assurer une stabilité optimale des
anticorps, réduisant ainsi les risques de micro-hétérogénéités incontrôlées et permettant
l'administration efficace de ces biomolécules aux patients.
Puis, lorsqu’un mAb a reçu une AMM et est utilisé en tant que traitement thérapeutique d’une
maladie, il est administré aux patients pour rejoindre leur circulation sanguine. Étant donné que
les mAbs ont une demi-vie d'environ vingt jours, une administration régulière est nécessaire chez
ces patients. Il est ainsi crucial de surveiller en permanence la concentration sanguine du mAb, car
cette mesure permet d'ajuster la dose thérapeutique suivante, pour conserver une efficacité
optimale du traitement. De plus, lorsque la concentration sanguine du mAb thérapeutique semble
anormalement faible, d’autres mesures quantitatives sont alors employées pour déterminer si le
patient a développé une réaction immunitaire face à ce traitement. Ces deux types de suivis
quantitatifs (du mAb thérapeutique et de la réaction auto-immune) sont donc couramment
effectués en routine de suivi clinique, à l'aide d'analyses distinctes qui sont à la fois rapides et
simples à réaliser. Ceci vise à offrir une prise en charge optimale des patients traités par mAb.
Néanmoins, ces suivis quantitatifs ne parviennent pas encore à totalement appréhender les
réponses cliniques de certains patients. De manière pour le moment peu expliquée, après
l'administration d'une dose équivalente, certains patients éliminent le traitement à un rythme plus
élevé que d’autres. On dit que le mAb a eu une clairance plus élevée. De plus, les réactions
- 20 -
indésirables, incluant l'immunogénicité ainsi que des réactions sévères, varient considérablement
d'un patient à un autre. Ce manque de compréhension entraîne une difficulté à prédire les pertes
de réponses cliniques, et complique donc la prise en charge thérapeutique. Tout en reconnaissant
les avantages indéniables des mAbs thérapeutiques en tant que traitements efficaces, la pratique
clinique suggère que la réponse des patients à ces traitements nécessiterait davantage
d'informations sur le sort des mAbs après leur administration. À titre d'exemple, le suivi structurel
dans l'organisme des patients est encore peu exploré à ce jour. Il apparaît donc impératif de revoir
l'approche du suivi des mAbs thérapeutiques, en enrichissant la dimension quantitative, avec une
autre qualitative. Cela impliquerait notamment le suivi des micro-hétérogénéités après
administration, pour mieux comprendre la dynamique et les variations structurelles de ces
anticorps dans la circulation sanguine des patients.
Pour le moment, plusieurs défis subsistent face à ces intentions. Dans un premier temps,
bien que la quantification de protéines dans des matrices biologiques soit plutôt bien établie, les
méthodes de caractérisation de la structure des anticorps ont essentiellement été appliquées à des
produits de formulation. La présence de nombreuses autres protéines et immunoglobulines dans le
sérum collecté des patients rend la caractérisation d’un mAb s’y trouvant, particulièrement
complexe. De plus, une préoccupation majeure réside dans la multiplication des méthodes pour
l’obtention de toutes ces informations. Le manque de standardisation, et surtout la nécessité de
réaliser de nombreuses manipulations en parallèle, complexifient la prise en charge clinique. Cela
implique de longues caractérisations coûteuses, ainsi que des erreurs associées à des manipulations
successives d’échantillons. Il devient donc urgent de développer des méthodes de multi-attributs
de ces échantillons biologiques, afin de collecter simultanément plusieurs informations, facilitant
alors leurs corrélations.
La spectrométrie de masse (MS) s’est imposée depuis une vingtaine d’années comme une méthode
de référence pour l’identification, la quantification et la caractérisation de biomolécules (peptides,
protéines, complexes macromoléculaires). Les développements de sources d'ionisation dites
"douces", telles que l'électrospray (ESI) et la désorption-ionisation laser assistée par matrice
(MALDI), et des méthodes de fragmentation dans le spectromètre, ont facilité la caractérisation et
même la localisation d'hétérogénéités. Les performances instrumentales continuent d’être
améliorées en termes de précision, de mesure de masse, de résolution, de gamme de masse ou
encore de sensibilité, afin de relever les défis de l’analyse d’échantillons complexes. De manière
à faciliter leur caractérisation, des méthodes séparatives sont généralement couplées à la MS.
Parmi celles-ci, on retrouve l’électrophorèse capillaire (CE), offrant une excellente efficacité de
pics. La CE est apparue dans les années 1980 comme une méthode de séparation de choix, au vu
- 21 -
de sa rapidité de séparation et sa grande efficacité. Son couplage à la MS a longtemps été un défi
technologique, mais les récents développements d’interfaces, et notamment celle sheathless,
permettent depuis une dizaine d’années le couplage CE-ESI-MS/MS, présentant une excellente
efficacité de séparation et sensibilité.
C’est dans ce contexte que se positionnent les travaux détaillés dans ce manuscrit. Ce doctorat
s’inscrit dans un projet financé par l’Agence Nationale de Recherche française intitulé
MethAmAbs-Nouvelles approches analytiques adaptées à l’étude des biothérapies dans les milieux
biologiques. Ce projet, d’une période de 3 ans et demi, a débuté en décembre 2019. L’objectif est
la mise en place d’une méthode analytique basée sur le couplage CE-ESI-MS/MS pour
simultanément quantifier et caractériser structurellement un mAb dans du sérum. L’infliximab, un
traitement anti-inflammatoire, régulièrement administré à des individus dans le cadre de la maladie
de Crohn, a été étudié dans ce contexte. Il est apparu nécessaire d’utiliser le couplage analytique
CE-MS/MS permettant, à partir de la matrice sérique, l’obtention simultanée des informations
suivantes :
• La quantification absolue de ce traitement ;
• La caractérisation et l’identification de certaines PTM de l’infliximab survenues pendant sa
circulation dans le système sanguin des patients ;
• La quantification des anticorps anti-infliximab immunogènes développés par l’organisme des
patients en réaction au traitement.
Ce manuscrit est divisé en 4 parties :

• La première partie est dédiée à la revue bibliographique, structurée en trois chapitres. Le
premier est consacré à la maladie de Crohn et à l'utilisation de l'infliximab dans ce contexte.
Ensuite, une introduction bibliographique à l'électrophorèse capillaire, la spectrométrie de
masse, ainsi qu'à leur couplage pour l'étude des anticorps monoclonaux, est présentée. Enfin,
le troisième chapitre aborde les méthodes classiques de quantification de mAb dans des
matrices biologiques ;
• La deuxième partie expose les travaux de développement et d'optimisation de la stratégie

analytique, visant la quantification et la caractérisation de certaines modifications structurelles
de l'infliximab issu d’une matrice biologique. Une approche spécifique d'extraction de cet
anticorps, suivie d'une analyse peptide-centrée bottom-up en CE-ESI-MS/MS, a été mise en
place. Cette section décrit notamment les améliorations apportées à la purification et à la
séparation électrophorétique pour atteindre une sensibilité adéquate aux objectifs.
De plus, une stratégie permettant de normaliser la quantification des modifications structurelles
de l'anticorps est proposée dans le septième chapitre. Cette normalisation permet d’identifier
- 22 -
et de caractériser les modifications post-traductionnelles de l’infliximab survenues uniquement
lorsqu’il a circulé dans l'organisme d’un patient ;
• La partie III de ce manuscrit présente dans un premier temps la validation de la méthode par
CE-MS/MS menant à la quantification absolue de l’infliximab issu de sérum.
Puis, est décrite l’application de l’approche analytique à 24 sérums prélevés de patients atteints
de la maladie de Crohn et traités avec l’infliximab. Simultanément, pour chaque sérum, la
concentration de l’infliximab et la caractérisation de ses PTM apparues post-administration ont
été obtenues.
Ensuite, le chapitre 9 expose une méthodologie in vitro mise en place pour simuler et prédire
l’évolution des PTM post-administration de l’infliximab. La stratégie a été appliquée à
différents produits commerciaux de l’infliximab (original et biosimilaires) ;
• Enfin, la Partie IV est dédiée à l’extension de la méthode analytique pour quantifier,

conjointement aux deux premiers points, le développement d’une réaction auto-immune chez
le patient.
Le chapitre 10 présente une nouvelle stratégie développée pour déterminer par CE-MS/MS la
constante de dissociation entre un anticorps monoclonal thérapeutique et un anticorps issu
d'une réaction auto-immune de l'organisme.
Pour finir, le dernier chapitre de ce manuscrit présente comment le couplage CE-ESI-MS/MS
permet, en une seule analyse d’un échantillon sérique, l’obtention simultanée de trois
informations cruciales lors d’un suivi clinique de traitement par mAb. Ces informations
regroupent la concentration absolue de l’anticorps thérapeutique, la concentration d’anticorps
anti-médicament neutralisants (traduisant une réaction auto-immune), et les PTM de
l’infliximab après son administration.
- 23 -
PARTIE I : INTRODUCTION ET REVUE
BIBLIOGRAPHIQUE
- 24 -
Partie I – Introduction et revue bibliographique
Chapitre 1 – Anticorps monoclonaux
C HAPITRE 1.
A NTICORPS MONOCLONAUX THERAPEUTIQUES
Préambule
Les anticorps sont des protéines présentes dans les fluides biologiques ou en tant que récepteurs
membranaires à la surface des lymphocytes. Ils sont produits par le système immunitaire dans le
but de neutraliser des antigènes, tels que des virus ou des bactéries que l'organisme ne reconnaît
pas et considère comme étrangers. Un site présent sur l’anticorps, appelé paratope, permet la
reconnaissance spécifique de celui-ci à l’épitope d’un antigène. Un individu produit environ
10 milliards d’anticorps, chacun spécifique d’un antigène unique [1].
Cette spécificité a été mise à profit pour l’utilisation d’anticorps à des fins thérapeutiques.
En 1975, la première méthode décrivant la production en grande quantité d’anticorps prédéfinis
par hybridation cellulaire entre des cellules de rate de souris et des cellules myéloïdes a été décrite
par Köhler et Milstein [2]. Cette méthode a ouvert la voie à la production d’anticorps monoclonaux
(mAbs), issus d’une même lignée cellulaire. Depuis, des améliorations dans ce domaine ont permis
le développement et la mise sur le marché de ces mAbs en tant que biothérapies. Il s’agit d’un des
secteurs dans le domaine pharmaceutique le plus développé. Cet engouement est principalement
expliqué par la grande spécificité des mAbs pour un antigène particulier.
1.1. Structure des mAbs

1.1.1. Structure protéique des anticorps monoclonaux
Les anticorps sont des glycoprotéines appartenant à la famille des immunoglobulines (Ig). Il s’agit
de protéines constituées d’acides aminés et possédant au moins un site de glycosylation. Chez
l’humain, les anticorps se répartissent en 5 grandes classes d’Ig, qui se différencient par leurs
propriétés physico-chimiques, leurs structures et concentrations sériques. Parmi ces classes, on
retrouve des anticorps monomériques (IgG, IgD et IgE) et polymériques (IgA et IgM). Les IgG
sont les plus abondantes (80 % des Ig) dans l’organisme.
Dans le cas de développement d’anticorps monoclonaux thérapeutiques, il s’agit
généralement d’IgG qui sont produites et commercialisées. Ces glycoprotéines, d’environ 150
kDa, forment quatre chaînes polypeptidiques, constituant deux chaînes lourdes identiques (Heavy
Chain – HC) et deux chaînes légères également identiques (Light Chain – LC). Ces chaînes sont
reliées entre elles par des ponts disulfures, ce qui confère à l’anticorps une certaine flexibilité et sa
forme de Y (Figure 1.1). Selon le nombre de ponts disulfures, les IgG sont subdivisées en plusieurs
sous-classes (IgG1 et IgG4 : deux, IgG2 : quatre, IgG3 : quinze). La séquence linéaire des acides
- 25 -
aminés dans une protéine correspond à sa structure dite primaire, et permet de la caractériser
précisément. Par convention, la structure primaire est décrite à partir de la fonction amine terminale
(N-ter) jusqu’à la fonction acide carboxylique terminale (C-ter).
Les chaînes lourdes et légères sont subdivisées en plusieurs parties, incluant les régions
constantes (Constant Heavy Chain – CH1, CH2 et CH3 et Constant Light Chain – CL), communes
à toutes les IgG. On retrouve également deux régions variables, (Variable Heavy – VH et Variable
Light – VL), incluant des séquences d’acides aminés spécifiques au mAb. C’est par ces régions
variables que l’anticorps va interagir avec son antigène. Généralement, on distingue la partie
supérieure du mAb, contenant la région de liaison à l’antigène (Fragment antigen binding region
– Fab) à celle cristallisable (Fragment crystallizable region – Fc).
Il existe quatre grandes familles d’anticorps monoclonaux thérapeutiques à ce jour : les

murins, chimériques, humanisés et humains. Ils se distinguent par leur proportion de séquence
issue d’anticorps murins ou humains, ce qui impacte la susceptibilité du traitement à
l’immunogénicité, c’est-à-dire au développement d’une défense immunitaire (Figure 1.1).
Issu d anticorps murin Issu d IgG humaine Région hypervariable (CDR)
Murin Chimérique Humanisé Humain

omab ximab zumab umab
mmunogénicité
Figure 1.1. Représentation schématique des différents types d’anticorps monoclonaux.
1.1.2. Fonctions effectrices

1.1.2.a. Inhibition de l’antigène
Les zones hypervariables (Complementary Determining Regions – CDR), spécifiques à
chaque mAb, constituent la zone d’interaction avec l’épitope de l’antigène (zone rouge, Figure
1.1). Cette interaction implique des surfaces de l'ordre de 500 à 600 Å2 avec un nombre d'acides
aminés directement impliqués dans la liaison variant de six à une vingtaine. Cette liaison spécifique
- 26 -
de l'épitope d’un antigène au paratope du mAb est non covalente et réversible, et implique des
interactions multiples (forces de Van der Waals, forces électrostatiques, liaisons hydrogènes et
interactions hydrophobes).
La force de l’interaction antigène/anticorps, mais aussi de toute autre interaction
protéine/ligand, se mesure par un paramètre appelé affinité. Elle se définit comme la somme des
forces de liaison et de répulsion entre un épitope et un paratope. Généralement, on peut définir
l’affinité par la valeur de la constante de dissociation (Kd), qui lui est inversement proportionnelle.
Dans le cas d’espèces dites polyvalentes, c’est-à-dire avec plusieurs sites de liaison, tels que les
anticorps, on distingue l’affinité intrinsèque de l’avidité. L’affinité intrinsèque se réfère
généralement à l’interaction monovalente que va faire un paratope d’un anticorps avec un épitope
d’un antigène. Cette affinité s’affranchit des données conformationnelles des autres régions de
l’anticorps. L’avidité considère, en plus de la force de cette interaction monovalente, le nombre de
paratopes de l’anticorps, ainsi que les réarrangements stériques associés à plusieurs liaisons. C’est
donc l’intensité de l’ensemble des forces des interactions non covalentes.
1.1.2.b. Cytotoxicités des mAbs

En plus de la liaison antigène-anticorps, un mAb peut se lier à d’autres récepteurs présents
sur des cellules de l’organisme menant à des activités cytotoxiques de lyse de cellules. Ces
mécanismes sont également importants dans la fonction biologique du mAb et s’effectuent après
liaison de certains récepteurs biologiques dits "FcγR" vers l’interface CH2-CH3 de l’anticorps.
Deux grandes formes de cytotoxicités peuvent être induites par les mAbs : la cytotoxicité
dépendante des anticorps (Antibody-Dependent Cell-Mediated Cytotoxicity – ADCC) et la
cytotoxicité dépendante du complément (Complement Dependent Cytotoxicity – CDC).
L'ADCC est induite par reconnaissance des récepteurs FcγR présents à la surface des cellules de
l’immunité innée (macrophage ou d’une cellule NK (Natural Killer)) par l’interface CH2-CH3 du
mAb [3–5]. Après interaction mAb/FcγR, le macrophage va induire une phagocytose menant à la
destruction de la cellule cible, tandis que les cellules NK, elles, induisent l’apoptose de la cellule
cible par l’intermédiaire de perforines.
La CDC, elle, met en jeu l’interaction entre la région Fc du mAb et une protéine C1q du
complément [6]. Cela active et clive ensuite successivement d’autres complexes jusqu’à la
polymérisation de C9, qui va créer des pores dans la cellule cible, menant à sa destruction [7].
1.1.2.c. Mécanisme de recyclage de l’anticorps

Les IgG ont un temps de demi-vie dans l’organisme d’une vingtaine de jours (selon le mAb). Cette
longue demi-vie est assurée par leur liaison au récepteur néonatal FcRn. Le FcRn empêche la
- 27 -
dégradation lysosomale des IgG plasmatiques en assurant leur extraction dans des cellules
endothéliales pour les restituer intactes dans la circulation sanguine. Les compartiments
intracellulaires de ces cellules ont un pH légèrement acide (pH ~ 6) ce qui entraîne l’interaction
du FcRn avec des résidus histidines du domaine CH2 de l’anticorps [8,9]. Puis, ces mAbs sont
recyclés vers la surface cellulaire, où ils se dissocient à pH neutre et sont libérés, prolongeant ainsi
leur durée de vie dans la circulation [10,11].
1.1.3. Modifications post-traductionnelles
Au cours de la vie de l’anticorps monoclonal, les acides aminés le composant peuvent subir des
réactions chimiques. Il s’agit de Modifications Post-Traductionnelles (PTM) car elles apparaissent
après synthèse de la protéine. Ces PTM peuvent modifier la structure ou la fonction du mAb et
jouent un rôle essentiel dans la régulation des processus cellulaires et biologiques. Il a été répertorié
près de 600 PTM dans la base de données Uniprot, pour les protéines, peptides et lipoprotéines.
Les plus communes concernant les mAbs sont présentées dans la Table 1.1, avec la différence de
masse induite sur l’acide aminé considéré. Toutes ces modifications représentent la micro-
hétérogénéité de l’anticorps.
Table 1.1. Liste des principales modifications post-traductionnelles des acides aminés d’un anticorps
Différence de
PTM Acide aminé concerné (Symbole)
masse (Da)
Phosphorylation Tyr (Y), Ser (S), Thr (T), Arg (R), Cys (C), Asp (D), His (H) + 79.966
Acétylation Cys (C), Ser (S), Lys (K) en N-term + 42.011
Thr (T), Ser (S), Glu (E), Asp (D), Leu (L), isoLeu (isoL), Arg (R), Gln (Q), + 14.017
Méthylation Asn (N), Lys (K), His (H), Cys (C) en N-term
Glycosylation Asn (N) (N-glycosylation) > 800
Ser (S), Thr (T), Pro (P), Lys (K) (O-glycosylation)
Hydroxyproline Pro (P) + 15.995
Sulfonation Tyr (Y) + 79.957
Pont disulfure Cys (C) - 2.016
Déamidation Arg (R), Asn (N), Gln (Q) + 0.984
Acide
N-terminal Gln - 17.027
pyroglutamique
Nitration Tyr (Y) + 45
Oxydation Met (M), Trp (W), His (H), Cys (C) + 15.995
Isomérisation Asp (D), Leu (L) ±0
- 28 -
Il a été démontré que certaines PTM jouent un rôle dans l’activité biologique de protéines, selon
leur nature et localisation. Ainsi, il est apparu essentiel de développer des méthodes analytiques
d’identification et de suivi de ces modifications. Certains sites de protéines thérapeutiques ont
notamment été définis par les autorités américaines ou européennes comme des critères de qualité
critique (CQA). Cela consiste en des sites d’acides aminés dits hotspots, dont la caractérisation de
PTM est nécessaire avant commercialisation, car peut impacter l’efficacité et la sûreté du
traitement [12].
▪ Déamidation des asparagines

La déamidation d’asparagine (N ➔ deaN) est une réaction pouvant se produire à pH acide ou
basique, et dont le mécanisme est décrit Figure 1.2. L’acide aminé passe par un intermédiaire
réactionnel, le succinimide, avant d’évoluer en un acide aspartique (L ou D selon l’épimère formé).
Généralement, lorsqu’on parle de l’acide aspartique, il n’y a pas de distinction entre les 2 épimères.
La déamidation d’asparagine est une modification dite non-enzymatique, souvent signalée comme
l’une des causes majeures des hétérogénéités de charge des anticorps [13]. En effet, l’acide
aspartique (D) résultant de cette déamidation présente une charge négative à pH 7.4, et augmente
la masse de l’acide aminé de 1 Da (Figure 1.2). Les déamidations peuvent se produire à toutes
étapes de la vie d’un anticorps ; de sa production dans les cellules, à son stockage. Le pH, la
température, la composition du tampon de stockage, sont tous des facteurs impactant cette PTM
[14]. Aussi, son analyse est d’autant plus complexe qu’il faut s’affranchir de ces réactions
indésirables [12,14].
La caractérisation des deaN fait l’objet de nombreuses études, car il a été démontré que
certaines déamidations ont lieu in vivo, c’est-à-dire après administration [15–17]. Des études ont
cherché à évaluer l’impact de ces déamidations, et plus particulièrement de celles localisées en
zones CDR des anticorps. Il a été montré une diminution de l’affinité de cette liaison avec
l’augmentation du pourcentage de déamidation en zone CDR [18]. Hintersteiner et al. (2016) ont
démontré que les altérations de la liaison entre un anticorps et son antigène, ou ses différents
récepteurs Fc, causées par la déamidation, ne semblent pas être dues à un changement de
conformation mais plutôt à un changement de la surface de charge [19]. Néanmoins, ces résultats
restent peu nombreux et suggèrent que l’impact biologique de la déamidation est spécifique à
l’anticorps en question et à la position de l’asparagine.
- 29 -
Figure 1.2. Mécanisme de déamidation d’asparagine (Asn, N) en acide aspartique (Asp, D) ou acide iso-aspartique (isoAsp,
isoD). La réaction passe par un intermédiaire succinimide.
▪ Isomérisation des acides aspartiques

L’isomérisation des acides aspartiques (D ➔ isoD) peut se produire après la déamidation
d’asparagine (Figure 1.2, mécanisme du bas). Comme présenté par la Figure 1.2, l’acide
isoaspartique est un isomère de constitution de l’acide aspartique. Toujours dû au site de chiralité
présent sur cet acide aminé, il est possible d’observer des épimères dont la différenciation est plus
complexe. Dans le cadre de ce projet de doctorat, l’isomérisation considérée est celle de
constitution. Ainsi, les dénominations « D » et « isoD » ne s’appliquent qu’à l’acide aspartique
(D) sous toutes ses formes épimériques et à son isomère de constitution, l’acide isoaspartique
(isoD).
Comme pour les deaN, les isoD survenant sur la zone CDR d’anticorps monoclonaux ont
été identifiées responsables de perte d’affinité à un antigène [20]. Les isoD font donc partie des
CQA d’anticorps monoclonaux et doivent être caractérisées. Cette PTM n'impacte pas la masse de
l’acide aminé, mais peut entraîner une différence conformationnelle par rapport à l’acide
aspartique. Ainsi, les stratégies basées sur des différenciations de conformations peuvent
distinguer ces deux formes. On retrouve des techniques de séparation comme l’électrophorèse
capillaire [21] ou la chromatographie d’interactions hydrophobes [22,23]. La RMN peut également
distinguer ces formes [24].
▪ Oxydations de méthionines
Les oxydations de méthionine (M ➔ oxiM) sont des PTM courantes, consistant en l’oxydation de
la méthionine en méthionine sulfoxyde. Cette oxydation oxiM augmente la taille et la polarité de
- 30 -
la chaîne latérale de l’acide aminé, résultant ainsi en une diminution de l’hydrophobie, mais
favorise les liaisons hydrogène [25]. La méthionine sulfoxyde (oxiM) présente 16 Da de plus que
son analogue non modifié (M).
En ce qui concerne l'activité biologique d'un anticorps soumis à une oxiM, certaines études
ont montré qu'un grand nombre de méthionines oxydées sur un anticorps peut limiter l'affinité
d'interaction entre la région Fc et des récepteurs comme le récepteur FcRn néonatal [26]. Ainsi il
semblerait que la demi-vie dans le sérum d'un anticorps ayant subi de nombreuses oxydations soit
plus courte que celle d'un anticorps non modifié [27].
Des études suggèrent en particulier que les oxydations de la M252 (méthionine positionnée
au 252e acide aminé d’un IgG de la chaîne lourde) et de M433 modifient la conformation de
l’interface CH2-CH3, et dégradent les activités cytotoxiques d’anticorps thérapeutiques [28,29].
De plus, cette étude a montré que le degré d'oxydation de M252 est important, car une oxydation
de 40 % ne semble pas altérer la demi-vie de l'anticorps. En revanche, une oxydation de 80 % de
cet acide aminé réduit la demi-vie d'un facteur 4.
▪ Glycosylations.
Les mAbs appartenant à la classe des IgG, ils présentent une N-glycosylation sur une asparagine
du domaine CH2 des chaînes lourdes de la région Fc. À cet endroit, on retrouve en effet une
séquence asparagine-X-serine/thréonine, où X correspond à n’importe quel acide aminé, à
l’exception d’une proline [30].
Lors de la production d’un mAb, ces glycoprotéines apparaissent comme un mélange
hétérogène de glycoformes. Elles sont constituées de différentes chaînes d’oligosaccharides
formées sur le site d’asparagine. La N-glycosylation des protéines commence dans le réticulum
endoplasmique (RE), où l’ajout de monosaccharides a lieu, puis la glycoprotéine migre vers le
canal de Golgi où elle subit d’autres modifications des mannoses qui la composent [31,32]. Ce
processus est complexe et aboutit à l’incorporation de différents types de glycans [33]. Cette
diversité glycanique est néanmoins reproductible et un profil de glycosylation représentant
l’abondance de chaque glycan peut être établi pour chaque IgG.
Les N-glycans jouent un rôle important sur l’orientation du domaine CH2 et donc dans
l’interaction de la partie Fc avec certains récepteurs présents à la surface des cellules effectrices
[34]. Il a été par exemple discuté que les régions Fc aglycosylés, c’est-à-dire sans N-glycan, ne
peuvent pas se lier à certains récepteurs nécessaires à l’activité cytotoxique des mAbs [35,36].
Ces interactions sont également impactées par la forme glycanique du site. Par exemple, les
fucosylations semblent diminuer certaines interactions avec des récepteurs FcR [37]. Ainsi, lors
de la production d’une biomolécule IgG, une préoccupation importante est la bonne
reproductibilité des proportions glycaniques la composant. Il s’agit d’un critère CQA. Il est
- 31 -
important de pouvoir contrôler la modification du glycan, mais aussi de vérifier l’homogénéité des
profils de glycosylations obtenus après synthèse des mAbs.
1.2. Infliximab, un mAb thérapeutique

1.2.1. Maladie de Crohn
1.2.1.a. Historique de la maladie

La maladie de Crohn est une maladie chronique intestinale, apparaissant sous la forme
d’inflammation sévère, tout au long du tube digestif. Elle a été identifiée pour la première fois en
1769 par le médecin italien Giovanni Battista Morgagni qui a diagnostiqué un jeune homme d’une
maladie intestinale invalidante. Les observations se multiplient, et en 1932, le Dr. Burrill. B. Crohn
publie avec plusieurs de ses confrères un article dans Journal of the American Medical Association
décrivant les symptômes de la maladie, qui fut plus tard renommée en son nom [38]. Cette maladie
pourrait résulter d’une combinaison de susceptibilité génétique, de facteurs environnementaux et
d’une altération du microbiote intestinal, conduisant à une dérégulation des réponses immunitaires
innées [39].
1.2.1.b. Mécanisme inflammatoire : rôle du TNF-α

Le facteur de nécrose tumorale (TNF-α) est une cytokine produite par diverses cellules du système
immunitaire, en particulier les macrophages et les lymphocytes T. Son nom vient de sa capacité à
déclencher des nécroses de tumeurs. Il s’agit d’une cytokine pro-inflammatoire, qui alerte le
système immunitaire de la présence d’un agent pathogène en enflammant la zone concernée. Sa
biologie et ses mécanismes d’actions sont complexes et continuent de faire l’objet de nombreuses
publications et études cliniques [40]. À faible concentration, le TNF-α est nécessaire à l’organisme,
car il permet l’augmentation des défenses immunitaires face aux infections. Néanmoins, des
concentrations localisées excessives au cours de la physiopathologie de certaines maladies telles
que la maladie de Crohn, conduisent à une inflammation incontrôlée et dangereuse. Le TNF-α est
présent dans l’organisme sous deux formes : sa forme transmembranaire (tmTNF, 26 kDa)
précurseur, qui peut être libérée sous forme soluble (sTNF, 17 kDa) [3,6]. Les deux formes peuvent
interagir avec des récepteurs exprimés à la surface de toutes les cellules nucléiques ou
endothéliales. Cela peut mener à la production de cytokines et chemokines pro-inflammatoires, au
recrutement des cellules sur le site d’inflammation, à l’apoptose des cellules ou encore à la
formation de granulomes [41–44]. Cette cascade d’interactions cellulaires aboutit à un mécanisme
d’action inflammatoire complexe et varié.
- 32 -
1.2.1.c. Prise en charge thérapeutique

En France, le nombre de patients atteints de la maladie de Crohn ne cesse d’augmenter, avec en
2020 : 120 000 cas [45]. Les causes exactes de cette maladie intestinale chronique ne sont pas
complètement élucidées. Cependant, des liens ont été établis entre les facteurs génétiques,
environnementaux et le microbiote intestinal des patients [39]. La prise en charge thérapeutique
est complexe, et peut amener à de la chirurgie si les voies médicamenteuses ont conduit à des
échecs. On retrouve par exemple la prescription de corticoïdes, généralement associés à d’autres
traitements, mais qui présentent de nombreux effets indésirables comme l’hypertension artérielle.
Pour l’instant, les prises en charge thérapeutiques ont pour objectif de limiter les symptômes de
cette maladie et améliorer la qualité de vie des patients, mais ne mènent pas à la guérison.
Vers les années 1990, il a été identifié que la maladie de Crohn était liée à une augmentation
excessive de la quantité de TNF-α aux sites de l’inflammation. Ainsi, l’élimination de cette
cytokine est devenue un objectif thérapeutique [46]. La première étude pilote en 1993, sur des
patients atteints d’une autre maladie inflammatoire, la polyarthrite rhumatoïde, a démontré que
l’utilisation d’un anticorps anti-TNF-α, l’infliximab, réduisait les symptômes inflammatoires [47].
Puis, en 1998, la Food and Drug Administration (FDA) a autorisé l’utilisation d’agents anti-TNF-
α pour le traitement de la maladie de Crohn. Ainsi, leur développement s’est accéléré et à ce jour,
plusieurs antagonistes au TNF-α sont enregistrés : l’infliximab (IFX), l’adalimumab (ADM), le
golimumab et l’étanercept (qui est une protéine de fusion). Seuls l’IFX et l’ADM sont prescrits
pour le traitement de la maladie de Crohn. Une récente étude a démontré que l’affinité entre ces
deux traitements avec le TNF-α (soluble et transmembranaire) était identique [48].
La diversité des réponses cliniques des patients traités par anti-TNF-α reste néanmoins
encore mal comprise, ce qui complique la prise en charge thérapeutique. Bien que ces traitements
soient parmi les plus efficaces, les agents anti-TNF-α ne sont pas sans risques. Selon une étude
clinique de 2008 ayant suivi 651 patients traités avec de l’infliximab sur 6 ans, le traitement fut
efficace pour 82,7 % d’entre eux. Néanmoins, 14,6 % des patients ont développé un effet
indésirable sévère [49].
Il arrive également que des patients présentent une perte de réponse clinique, c’est-à-dire
que le traitement arrête d’être efficace de manière immédiate ou après plusieurs mois, et doivent
donc changer de traitement [50,51]. Dans certains cas, ces pertes de réponses sont associées au
développement d’une immunogénicité de la part des patients. Ceux-ci vont produire des anticorps
dirigés contre l’agent anti-TNF-α, l’éliminant de la circulation sanguine. Cependant, il arrive que
d’autres patients développent cette immunogénicité, mais présentent tout de même une rémission
clinique. Ainsi, ces cas soulignent la diversité des réponses cliniques des maladies auto-immunes.
- 33 -
1.2.2. Traitement par infliximab
1.2.2.a. Commercialisation de l’infliximab

L’infliximab (IFX) a été développé pour la première fois en 1989 par des chercheurs de l’université
de médecine de New York. Il s’agit d’un anticorps monoclonal chimérique de 144 kDa, composé
d’une région constante d’immunoglobuline IgG1 humaine et d’une partie variable issue d’un
anticorps murin. Cette partie variable est dirigée contre le facteur de nécrose tumorale TNF-α de
manière spécifique [52].
La première forme d’infliximab ayant reçu une autorisation de mise sur le marché en
France en 2000 est le Remicade®. Il s’agit du produit biopharmaceutique original, qui s’est vu
produire plusieurs biosimilaires depuis (Remsima®, Inflectra®, Flixabi® et Zessly®). Les
biosimilaires sont des mAbs similaires au médicament biologique de référence (même séquence
d’acide aminé, etc.) mais produits par d’autres entreprises pharmaceutiques. Ainsi, ils peuvent
présenter des différences mineures, comme la souche de lignée cellulaire ou les excipients de la
formulation, comme présenté dans la Table 1.2. Ce traitement s’administre par voie intraveineuse,
et possède une durée de demi-vie de près de 14 jours [41]. Ainsi, les patients traités avec cet
anticorps en sont administrés par perfusion à intervalles de 2 à 6 semaines, puis toutes les 8
semaines après stabilisation [53].
Table 1.2. Formes d’infliximab titulaire d’une autorisation de mise sur le marché en France, adapté des travaux de thèse de
Legrand. P [54]
Laboratoire
Nom Lignée
titulaire de Présentation Excipients
commercial cellulaire
l’AMM
100mg/ Saccharose, polysorbate 80, phosphate
Remicade® Janssen
lyophilisat monosodique, phosphate disodique
Sp2/0
Saccharose, polysorbate 80, phosphate
100mg/
monosodique monohydrate, phosphate disodique Sp2/0
lyophilisat
dihydrate
100mg/1mL en Acide acétique, acétate de sodium, trihydraté,
Celltrion
Remsima® Healthcare
seringue sorbitol, polysorbate 80, eau pour préparation Sp2/0
pré-remplie injectables
100mg/1mL en Acide acétique, acétate de sodium, trihydraté,
stylo sorbitol, polysorbate 80, eau pour préparation Sp2/0
pré-remplie injectables
100mg/
Inflectra® Pfizer Europe lyophilisat
monosodique monohydrate, phosphate disodique Sp2/0
dihydrate
Samsung 100mg/
Flixabi® Bioepis lyophilisat
monosodique monohydrate, phosphate disodique CHO
heptahydrate
100mg/ Succinate disodique hexahydraté, Acide succinique
Zessly® Sandoz GmbH
lyophilisat Saccharose Polysorbate 80
CHO
- 34 -
1.2.2.b. Mécanisme d’action

Les fonctions effectrices de l’infliximab sont celles communes aux IgG1. Dans un premier temps,
le rôle de ce traitement est de cibler le TNF-α, son antigène, dans le corps du patient. En se liant à
cette cytokine, sous forme soluble sTNF-α ou transmembranaire tmTNF-α, l’infliximab va ainsi
inhiber son activité [55]. En se complexant à l’infliximab, le TNF-α ne sera plus reconnu par les
récepteurs de l’organisme et ses mécanismes d’action, tels que la formation de granulomes, le
recrutement des cellules lymphocytaires ou l’inflammation, seront interrompus (Figure 1.3,
droite). L’affinité de l’infliximab avec le sTNF-α a été évaluée à 2.7·10-11 M, et de 4.7 ·10-10 M
pour le tmTNF-α [48].
tmTNF
sTNF
Chemo ines Cyto ines

C9
C3
C2
C1q
ran ymes
et
perforines
Fc R
Macrophages Cellule N
Figure 1.3. Mécanismes d’action de l’infliximab dans le système humain.
- 35 -
L’infliximab peut aussi effectuer ce qui est appelé le mécanisme de signalisation inversée
[56]. Pour cela, l’anticorps reconnaît du tmTNF-α sur une cellule via sa région Fab. Le tmTNF-α
agit comme un ligand et initie le processus de l’apoptose de la cellule et supprime la production
de cytokines (Figure 1.3) [57,58]. Les activités cytotoxiques ADCC et CDC sont également
induites par l’infliximab dans l’organisme. Cet mAb se lie d’abord au tmTNF-α présent sur la
cellule cible par sa région Fab (Figure 1.3), puis à des récepteurs FcγR ou au complément C1q pour
initier ces processus. L’infliximab possède une demi-vie de 14 jours, et son recyclage est réalisé
par liaison avec le récepteur néonatal FcRn.
1.2.2.c. Immunogénicité
L’immunogénicité traduit la capacité d’une substance à provoquer une réponse immunitaire
spécifique. Lors d’un traitement par mAb thérapeutique, il arrive que des patients développent une
réaction auto-immune. Leur organisme produit des anticorps anti-médicaments (Anti-drug-
antibody – ADA), dirigés contre diverses séquences du mAb thérapeutique. Dans le cas particulier
de l’infliximab, ces anticorps sont appelés ATI (Antibody-to-Infliximab). Il n’existe pas d’ATI
universel, puisqu’ils sont propres à chaque individu. Il a été répertorié que ces ATI pouvaient
exister sous formes de plusieurs isotypes d’immunoglobulines. Ce sont en majorité des IgG, et
plus particulièrement des sous-types IgG1 et IgG4 qui ont été rapportés pour les ATI de
l’infliximab [59]. Néanmoins, quelques cas minoritaires de IgM et IgE ont été observés.
Parmi ces ATI développés, les majoritaires (> 90 %) sont des anticorps neutralisants
(NATI, Neutralizing Antibody to Infliximab). Les NATI sont dirigés contre des segments de la
partie variable de l’infliximab, l’empêchant de se lier au TNF-α, et donc neutralisant son activité
biologique. Les non-NATI, eux, n’impactent pas l’interaction infliximab/TNF-α, mais peuvent
entraîner la formation d’agrégats propices à une élimination précipitée de l’organisme. Il s’agit
néanmoins généralement des NATI qui font l’objet de suivis cliniques afin d’évaluer
l’immunogénicité des patients traités par infliximab.
La valeur de la fréquence d’apparition des ATI chez les patients traités par infliximab est
peu établie, avec un intervalle allant de 3 à 83 % selon les études [60,61]. Cette disparité peut être
due aux différentes méthodologies analytiques employées pour leur détection et quantification.
Certaines ne maintiennent pas les complexes ATI/infliximab de faibles interactions, ne permettent
pas la détection des IgG4, ou sont très peu sensibles. Ces problématiques peuvent donc parfois
impacter le suivi clinique des patients et limitent la prise en charge thérapeutique.
- 36 -
Chapitre 2 – Couplage CE-MS/MS pour l’analyse d’anticorps monoclonaux
C HAPITRE 2.
C OUPLAGE CE-MS/MS POUR L ’ ANALYSE
D ’ ANTICORPS MONOCLONAUX
Préambule
L’électrophorèse capillaire (CE) couplée à la spectrométrie de masse (MS) s’est imposée comme
une méthode pertinente pour la caractérisation de biomolécules. La séparation électrophorétique
permet d’obtenir des informations complémentaires à celles apportées par la chromatographie
liquide, aujourd’hui considérée comme la méthode de référence pour la séparation de
biomolécules. La spectrométrie de masse, quant à elle, permet une identification et caractérisation
sensible et sélective, apportant des informations quantitatives et structurales d’échantillons
complexes. Aussi, le couplage des deux instruments est apparu totalement approprié à ce projet de
doctorat, pour la multi-caractérisation d’anticorps issus de matrices biologiques.
Dans un premier temps, ce chapitre vise à présenter les principes fondamentaux de la CE et de la

MS. Puis, la dernière partie de ce chapitre présente quelques applications et différentes stratégies
du couplage CE-MS/MS pour la caractérisation de la structure primaire d’anticorps monoclonaux.
2.1. Électrophorèse capillaire

2.1.1. Mode de séparation en électrophorèse capillaire
L’électrophorèse capillaire (CE) est une technique de séparation d’espèces en solution. Arne
Tiselius (1902-1971) a introduit le principe de l’utilisation des phénomènes électrophorétiques
pour séparer des analytes. L’utilisation de la CE s’est diversifiée pour la séparation de divers
composés ; les acides aminés [62], les peptides [63], les protéines entières [64], les ions
inorganiques [65,66], ou encore les acides nucléiques (ADN et ARN) [67]. Il existe plusieurs
modes de séparation électrophorétique en CE, qui diffèrent par la nature de l’électromigration que
vont subir les analytes. L’électrophorèse capillaire de zone (CZE) est le mode électrophorétique le
plus implémenté pour le couplage à la spectrométrie de masse.
2.1.1.a. Électrophorèse capillaire de zone (CZE)

L’électrophorèse capillaire de zone consiste à utiliser un capillaire, généralement en silice vierge,
rempli d’un électrolyte support (Background Electrolyte – BGE). Après injection des analytes à
l’entrée du capillaire, l’application d’un potentiel de part et d’autre de celui-ci permet la migration
- 37 -
des espèces présentes, selon une mobilité dépendante de leur charge et rayon hydrodynamique. La
migration repose sur deux phénomènes : la mobilité électroosmotique et celle électrophorétique
(Figure 2.1).
Anode Cathode
Figure 2.1. Représentation schématique d’une séparation d’analytes en électrophorèse capillaire de zone (CZE).
▪ Phénomène d’électro-osmose
Les parois du capillaire sont recouvertes de groupements silanols qui se déprotonent si le pH est
supérieur à 2,5. Cette couche de charge négative va entraîner une accumulation de cations solvatés
composant le BGE le long de ces parois, par liaisons électrostatiques aux silanols. Ces cations vont
se mettre en mouvement lors de l’application d’un champ électrique vers la cathode, résultant en
un écoulement de front plat (Figure 2.1). Ce déplacement correspond au flux électroosmotique
(EOF), représenté par les flèches vertes. L’électro-osmose correspond donc à l’écoulement de
l’électrolyte support contenu dans le capillaire sous l’influence du champ électrique tangentiel. La
vitesse linéaire de ce flux est définie par l’équation (2.1) :
𝜀𝜉
𝜐𝑒𝑜 = ( ) 𝐸 = 𝜇𝑒𝑜 𝐸 (2.1)
4𝜋𝜂
ξ : Potentiel zêta de la double couche (V)
ε : Constante diélectrique de l’électrolyte support B E ( g·cm·V-2·s-2)
η : Viscosité de l’électrolyte support ( g·cm-1·s-1),
E : Intensité du champ électrique (V·cm-1),
μeo : Mobilité électro-osmotique (cm²·V-1·s-1).
Dans certains cas, les parois internes du capillaire peuvent être greffées pour modifier la polarité
des charges présentes à la surface. La nature du greffage va alors modifier la force ou la direction
du flux électroosmotique, ou bien le supprimer. En effet, l’EOF circule dans la direction allant vers
l’électrode dont la polarité est la même que les charges présentes à la surface des parois.
▪ Phénomène d’électrophorèse
L’électrophorèse, quant à elle, est la contrainte physique appliquée aux espèces chargées en
solution qui leur permet de migrer sous l’application d’un champ électrique en direction de
l’électrode dont la polarité est opposée. Les cations migrent vers la cathode et les anions vers
l’anode, à une vitesse qui est fonction de l’intensité du champ électrique, mais aussi de la charge
- 38 -
et du rayon hydrodynamique de l’analyte. Les analytes vont migrer d’autant plus rapidement que
leur charge est élevée et que leur rayon hydrodynamique est faible. La vitesse électrophorétique
𝜐𝑒𝑝 (cm·s-1) s’exprime sous la forme
𝑞
𝜐𝑒𝑝 = 𝐸 = 𝜇𝑒𝑝 𝐸. (2.2)
6𝜋𝜂𝑟
E : Intensité du champ électrique (V·cm-1)

μep : Mobilité électrophorétique (cm²·V-1·s-1).
q : Charge globale de l’analyte
η : viscosité de l’électrolyte support (kg·cm-1·s-1)
r : Rayon hydrodynamique (cm).
La migration des composés dans le capillaire dépend donc de ces deux phénomènes, et la mobilité
apparente (μapp) d’un analyte peut donc s’écrire sous la forme décrite par
𝜇𝑎𝑝𝑝 = 𝜇𝑒𝑜 + 𝜇𝑒𝑝 . (2.3)
2.1.1.b. Isotachophorèse (ITP)

L’isotachophorèse (ITP) est une méthode de séparation proche de la CZE. Elle consiste à injecter
les analytes dans le capillaire, entre un électrolyte meneur et un électrolyte terminal positionné
après l’échantillon.
Si l’on souhaite séparer des cations, la mobilité électrophorétique des analytes doit être inférieure
à celle des cations composant l’électrolyte meneur, mais supérieure à celle des cations composant
l’électrolyte terminal (Figure 2.2). La séparation s’effectue sous l’application d’une tension
électrique. Les espèces à séparer vont migrer sous l’effet de ce champ, de sorte que les analytes se
répartissent en fonction de leur mobilité électrophorétique, tout en étant maintenus entre
l’électrolyte meneur et celui terminal. Après quelques instants, un état stationnaire est atteint, dans
lequel les analytes sont répartis dans des zones distinctes par ordre de mobilité décroissante. Les
zones contenant les analytes vont alors migrer par vélocité constante. Chaque zone possède un
champ électrique spécifique [68]. La conséquence directe de cette caractéristique est que le signal
correspondant à chaque analyte ne forme pas de pics, mais des plateaux successifs au niveau de la
fenêtre de détection.
- 39 -
tat initial tat stationnaire
Figure 2.2. Représentation schématique d’une séparation d’analytes en isotachophorèse (ITP).
2.1.1.c. Isotachophorèse en mode transitoire (t-ITP)

L’isotachophorèse en mode transitoire est un intermédiaire entre l’ITP et la CZE. Le principe
consiste à remplir initialement le capillaire avec un électrolyte support (BGE). Les analytes se
trouvent dans un autre électrolyte, appelé meneur, dont la conductivité est supérieure à celle du
BGE. Après injection de ces analytes à l’entrée du capillaire, le BGE est à nouveau injecté, de
manière à contenir la zone d’analytes entre deux portions de BGE. Sous l’application d’une
tension, les ions contenus dans l’électrolyte meneur vont migrer plus rapidement que ceux du BGE,
vers la sortie du capillaire, et vont donc se heurter à la zone de BGE. Cela va mener à leur
focalisation dans un volume de capillaire inférieur à celui injecté. Ainsi, cette étape permet une
préconcentration des analytes dans le capillaire. Le meneur, dont la mobilité électrophorétique est
élevée, est évacué du capillaire durant la première partie de la séparation, qui passe alors dans un
état de CZE classique. Ainsi, l’étape de préconcentration par t-ITP permet une plus grande
efficacité de pic, et l’injection d’une plus grande quantité d’analytes dans le capillaire. Sans cette
étape de préconcentration, le volume d’injection doit se faire à un volume d’environ 0,4 % du
volume total du capillaire, pour assurer une bonne séparation des composés. L’étape de t-ITP
permet d’injecter près de 50 à 75 fois plus, soit un volume de près de 20 % de celui du capillaire,
tout en maintenant les mêmes performances séparatives [69].
L’utilisation d’une t-ITP au lieu d’une CZE classique aboutit à une sensibilité beaucoup
plus importante, nécessaire lors de l’analyse de composés biologiques présents en faible quantité
dans des matrices complexes. Ainsi, la t-ITP fait l’objet de beaucoup d’attention et a été utilisée
par différents groupes pour la séparation de peptides et protéines [70–72]. Néanmoins, le premier
inconvénient associé à cette méthode de séparation est la perte de la rapidité de séparation associée
à la CZE classique. En effet, l’étape de préconcentration est chronophage, menant à des temps
d’analyse entre 30 minutes et une heure, selon les électrolytes meneurs et supports utilisés, la
longueur du capillaire, et la tension appliquée à celui-ci. Par ailleurs, le couplage à la MS nécessite
l’utilisation d’électrolytes (meneur et BGE) compatibles avec cette détection.
- 40 -
2.1.2. Efficacité de séparation
En ce qui concerne les performances séparatives, la CZE permet des séparations rapides, tout en
maintenant des efficacités comparables à celles de la chromatographie liquide. L’équation de Van
Deemter permet de modéliser l’efficacité séparative de nombreuses méthodes, dont la CE, et peut
s’écrire sous la forme suivante (2.4) :
𝐵
𝐻 =𝐴+ + 𝐶𝜐𝑥 (2.4)
𝜐𝑥
H : Hauteur d’un plateau théorique
𝜐𝑥 : Vitesse de la phase mobile (cm·s-1)
La diffusion d’Eddy, représentée par le terme A, correspond à la distribution des trajectoires qu’un
analyte suivra dans l’espace de séparation. Le terme B correspond à la diffusion longitudinale et
le terme C est la résistance au transfert de masse. Cette résistance reflète la capacité de la phase
stationnaire à s’opposer à l’entraînement des molécules d’analytes vers la sortie. C’est à partir de
cette équation que l’on peut comprendre la source de la grande efficacité de la séparation
électrophorétique. Les termes A et C sont, en électrophorèse capillaire, nuls, car inhérents à la
phase stationnaire, qui est absente en CE. Par ailleurs, la diffusion longitudinale (terme B) est
limitée grâce au front plan caractéristique de l’écoulement laminaire de l’EOF. Cette diffusion
longitudinale est essentiellement due à la chaleur produite par effet Joule, sous l’effet du champ
électrique, et peut être limitée par l’utilisation de capillaires de faibles diamètres [73].
2.2. Spectrométrie de masse

2.2.1. Introduction
La spectrométrie de masse (MS) est une technique d’analyse permettant la détection et

l’identification d’espèces ioniques par détermination de leur rapport masse/charge (m/z). Elle s’est
avérée particulièrement adaptée à la caractérisation de biomolécules [74]. Un spectromètre de
masse est défini comme un dispositif permettant d’obtenir un spectre de masse des ions introduits
à l’entrée, et repose sur l’ionisation des molécules, suivie de leur séparation en phase gazeuse. Il
est généralement constitué de 4 parties :
▪ Une source d’ionisation dans laquelle les composés à analyser sont ionisés et transférés en
phase gazeuse ;
▪ Une interface qui dirige ces ions formés vers l’analyseur de masse ;
▪ L’analyseur de masse qui permet de séparer et différencier les ions en fonction de leur m/z ;
▪ Le détecteur qui assure la production de signaux électriques qui seront alors interprétés en
spectre de masse.
- 41 -
C’est en 1912 que le premier instrument de spectrométrie de masse a été construit par J.J Thomson.
Cet instrument, connu sous le nom de spectrographe parabolique, permet de déterminer les
rapports m/z d’ions. Un flux de cations issu de tubes à rayons cathodiques est dévié en fonction de
la masse des ions sous l’effet de champs magnétiques et électrostatiques [75]. Les spectromètres
de masse n’ont cessé d’évoluer depuis, avec, par exemple, l’innovation de l’analyseur par temps
de vol (Time of flight – TOF) qui permet de séparer des ions en fonction de leur vitesse, et donc de
leur masse. Les premiers instruments TOF ont été construits dans les années 1940.
Dans le cadre de ce projet de doctorat, un spectromètre de masse hybride de type TTOF 5600® de
Sciex composé d’un analyseur TOF succédant à un quadripôle a été utilisé pour le couplage CE-
MS. Cette partie décrit les principales parties de ce spectromètre de masse, explicitant leur mode
de fonctionnement.
2.2.2. Interfaces de couplage CE-ESI
La MS est particulièrement adaptée à l’analyse de biomolécules, car elle représente une

technique sensible, robuste, et permet l’obtention d’informations structurales. Généralement,
l’ionisation de composés d’un échantillon liquide s’effectue par électrospray (ESI). Le couplage
CE-MS nécessite le maintien du flux continu d’analytes dans la CE, impliquant la préservation du
champ électrique tout au long du capillaire. Contrairement à la CZE classique, couplée à la
spectroscopie UV, l’extrémité du capillaire de séparation dans un couplage CE-MS est positionnée
dans la source ESI. Il est donc nécessaire de trouver un moyen de maintenir ce champ électrique
jusqu’à l’extrémité de sortie du capillaire.
La complexité de mise en œuvre du couplage CE-ESI-MS représente l’une des principales raisons
de l’utilisation préférentielle de la LC-MS en tant que méthode de référence pour l’analyse de
composés. Différentes interfaces ont été développées afin de permettre un couplage direct entre la
CE et les instruments ESI-MS. Les premiers couplages CE-ESI-MS présentaient une sensibilité
bien moindre que celle obtenue en LC-MS [76]. Ces interfaces sont nommées sheath-liquid
(Figure 2.3.a) ou liquid-junction (Figures 2.3.b et 2.3.c). Dans l’interface sheath-liquid, le contact
électrique est maintenu à la jonction du liquide additionnel (connecté à l’électrode de sortie de la
CE) et du BGE en sortie du capillaire de séparation (Figure 2.3.a). Cette interface permet
d’améliorer la tolérance de l’analyse MS avec certains BGE, en les diluant, et reste la plus
couramment mise en œuvre [77,78]. En ce qui concerne les interfaces liquid-junction, leur principe
consiste aussi à utiliser un liquide additionnel conducteur pour assurer le contact électrique avec
le BGE du capillaire de séparation [79]. Différentes conceptions ont été développées comme celle
en forme de T (Figure 2.3.b) ou celle par pression (Figure 2.3.c) qui limitent les effets de dilution
- 42 -
induits par l’interface sheath-liquid, sans pour autant les éliminer. Les designs de liquid-junction
créent des volumes morts dans le système qui perturbent le front plat de l’EOF et entraînent un
élargissement des pics.
a SI b SI c apillaire de SI
apillaire de apillaire de séparation

a séparation
séparation ression
nébuliseur
MS MS MS
unction
iquide conducteur
iguille SI
iguille SI
iquide conducteur
iquide conducteur
Figure 2.3. Premières interfaces développées pour le couplage CE-ESI-MS. a. interface de type sheath-liquid. b. interface de
type liquid-junction par une jonction en T. c. interface de type liquid-junction par pression.
Ainsi, pour répondre aux besoins de sensibilité, les interfaces sheathless ont été
développées, ne nécessitant pas l’utilisation d’un liquide additionnel [80,81]. Seul le BGE est
ionisé dans la source, ce qui implique la nécessité d’utiliser des BGE suffisamment volatils et
compatibles avec l’ionisation par ESI. Il existe différents designs de ces interfaces dites sheathless
tels que l’utilisation d’un capillaire revêtu d’un matériau conducteur sur sa paroi externe, d’une
connectique intra-capillaire conductrice ou d’un capillaire poreux [82,83].
Dans le cadre de ce doctorat, il s’agit de l’interface sheathless avec extrémité du capillaire
poreux qui a été utilisée, dont la représentation schématique est présentée en Figure 2.4. Cette
interface met en jeu deux capillaires distincts [84]. Le premier capillaire est celui de séparation,
où les analytes vont migrer sous l’effet du champ électrique appliqué. Au niveau de la source ESI,
est disposée l’extrémité de ce capillaire, dont les parois ont été rendues poreuses à la suite d’une
attaque par acide fluorhydrique. Cette attaque permet l’élimination de la gaine en polyimide et
rend la silice poreuse, qui est alors disposée dans une canule remplie du BGE, tout en maintenant
son extrémité dirigée dans l’ESI. Pour fermer le circuit électrique, un deuxième capillaire, appelé
de contact, est disposé pour que sa sortie se trouve dans la canule, afin de l’alimenter
continuellement en BGE. Ainsi, les électrons et les petits ions présents dans le capillaire de
séparation pourront migrer à travers les pores, fermant ainsi le circuit électrique de la CE [82]. La
taille des pores obtenus après attaque du capillaire est suffisamment faible pour permettre aux
petits ions de passer, mais pas aux analytes [85]. Ainsi, l’interface CE-ESI est communément
appelée CESI (Figure 2.4).
- 43 -
SI Spectromètre
apillaire de anule de masse
artie poreuse
séparation ne de aylor
cathode
anode
d
Ions et
apillaire de contact
électrons de
faible rayon
Figure 2.4. Représentation schématique de l’interface CESI.
Le couplage CESI est d’autant plus intéressant qu’il implique des nano-débits induits durant la
séparation en CE par le flux EOF. Ainsi, les sources ESI adaptées à ces débits sont celles nano-
ESI, dont le développement a été entrepris par Mann et Wilm [86]. La miniaturisation des sources
ESI a permis de limiter les phénomènes de compétition d’ions, en diminuant la quantité de solvant
introduite dans la source. Ce phénomène, également appelé suppression d’ions, est courant en ESI
et consiste en une diminution du rendement d’ionisation des analytes au profit du solvant, limitant
la sensibilité de l’analyse [87]. Tandis que l’ESI conventionnelle génère des gouttelettes de 1 à
2 µm de diamètre, la nano-ESI en forme de moins de 200 nm. Elle permet donc une meilleure
tolérance à la contamination par des sels ou à l’utilisation de solvants aqueux [88]. Les ions
produits en ESI sont ensuite guidés vers le spectromètre de masse par des cônes appelés
« skimmers », auxquels sont appliqués des potentiels électriques, et qui séparent la source ESI du
vide poussé.
2.2.3. Source d’ionisation électrospray S
La quête d’appareils permettant la caractérisation du rapport m/z de macromolécules a conduit au

développement d’une technique majeure d’ionisation de composés en phase liquide : la source
électrospray (ESI), dans les années 1960 [89]. L’ESI consiste à produire de fines gouttelettes à
pression atmosphérique à partir d’un échantillon liquide. Ces gouttelettes sont chargées par
l’application d’une différence de potentiel élevée (ΔV~1500-4500 V) entre l’extrémité de
l’émetteur et un orifice délimitant l’entrée dans la MS. Cette tension fournit un gradient électrique
suffisamment élevé pour charger la surface du liquide. Dans le cas d’un couplage CE-MS en mode
sheathless, l’émetteur correspond à l’extrémité du capillaire de séparation (Figure 2.4). À la sortie
de l’émetteur, les ions de polarité opposée au champ électrique vont migrer vers l’intérieur de
l’émetteur, et ceux de même polarité vont se diriger vers la contre-électrode, c’est-à-dire l’orifice
de la MS. Les ions accumulés à la surface du liquide sortant de l’émetteur vont alors former
- 44 -
un cône de Taylor. Lorsque la charge de la solution de ce cône atteint la limite de Rayleigh, il se

disperse sous forme de gouttelettes. En se dirigeant vers la contre-électrode placée à l’entrée de la
MS, le solvant qui les maintient va se vaporiser sous l’effet d’un flux d’azote chauffé. Ainsi, les
charges à la surface des gouttelettes vont se rapprocher et devenir instables jusqu’à ce que la limite
de Rayleigh soit à nouveau atteinte. Les gouttelettes subissent alors un processus appelé fission de
Coulomb, conduisant à des ions désolvatés en phase gazeuse (Figure 2.4).
La source ESI peut produire des ions positifs ou négatifs, avec, en mode positif, des ions
issus de la protonation des sites basiques. Les espèces formées peuvent alors être multichargées.
Pour une molécule donnée, le spectre ESI-MS est donc composé de plusieurs pics, correspondant
à différents états de charge. L’ESI est très utilisée pour l’analyse de biomolécules complexes,
puisqu’elle permet l’obtention d’ions intacts. Il s’agit d’une source dite « douce », formant en
majorité des ions moléculaires, et est applicable pour des molécules polaires [90]. La source ESI
est un outil sensible, robuste et fiable permettant d'étudier, à des quantités femto-molaires, des
biomolécules non volatiles et thermolabiles qui ne peuvent pas être analysées par d'autres
techniques conventionnelles. Couplée à une technique de séparation en phase liquide telle que la
LC ou la CE, la source ESI peut être utilisée pour l’ionisation de petites molécules comme de
macromolécules.
2.2.4. Spectromètre de masse de type Q-TOF
En sortie de la source ESI, les ions sont transmis par plusieurs quadripôles, ayant des fonctions
différentes. Dans le cas du TripleTOF® 5600 utilisé dans le cadre de ce projet de doctorat, trois
quadripôles se succèdent, comme représenté sur la Figure 2.5.
Figure 2.5. Représentation schématique du TTOF 5600.
- 45 -
2.2.4.a. Sélectionneurs quadripolaires

Les deux premiers quadripôles, après la curtain plate et l’orifice plate, sont le Qjet® et le Q0,
servant à focaliser les ions entrants avant leur arrivée dans le Q1 (Figure 2.5). Ce Q1 va alors
permettre de filtrer les ions en fonction de leur m/z. Le principe de fonctionnement est basé sur la
sélectivité des ions en fonction de leur trajectoire dans le champ électrique oscillant.
Le quadripôle est constitué de quatre électrodes disposées parallèlement. Elles ont une
section circulaire ou hyperbolique et sont positionnées de manière à laisser un espace pour la
circulation des ions au centre (Figure 2.6.a). Un potentiel est appliqué entre ces électrodes, afin
que celles opposées soient de même polarité. Sur chacune des électrodes, deux potentiels sont
appliqués : un continu U (DC) et un de radiofréquence Vcos(𝜔t) (RF) [91]. La somme algébrique
de ces deux potentiels est alors obtenue pour chaque électrode et un champ électrostatique est créé
entre elles. En pénétrant dans ce champ, les ions auront une trajectoire particulière en fonction de
leur masse et de leur charge. Cette trajectoire est décrite par les équations de Mathieu, dont la
résolution met en évidence les potentiels U et V pour lesquels un ion de m/z va circuler au travers
des électrodes. Pour qu’un ion soit détecté, il faut que sa trajectoire soit contenue entre les quatre
électrodes sur toute leur longueur, afin qu’il puisse être transféré au détecteur. Une amplitude
d’oscillation trop importante entraînerait sa collision avec une électrode, et donc sa perte.
L’ensemble des solutions des équations de Mathieu peut être modélisé par un diagramme de
stabilité, spécifique à chaque ion (Figure 2.6.b). Ce diagramme représente la tension DC en
fonction de celle RF, qui sont deux paramètres directement proportionnels aux potentiels U et V
pour un ion de m/z donné. Sous la ligne continue bleue, on trouve le domaine dans lequel cet ion
sera contenu dans le quadripôle et dirigé correctement vers le détecteur. Le quadripôle peut être
utilisé en mode sélection, ou en mode balayage.
2
Tension DC
Trajectoire Trajectoire
instable stable
:
:3
Tension RF
Intensite
m/
Figure 2.6. Principe de fonctionnement d’un quadripôle. a. Disposition et potentiel des électrodes. b. Zones de stabilités pour
des ions de m/z différents. Mode scan : balayage de RF pour avoir DC/RF constant. c. Résolution et précisions de masse obtenues.
- 46 -
▪ Mode balayage
En mode balayage MS, le principe consiste à effectuer un balayage de U tout en gardant U/V
constant. Ainsi, le quadripôle va faire passer de manière séquentielle chaque m/z vers le détecteur.
On obtient une droite représentée Figure 2.6.b. Plus la pente de cette droite est faible, plus il y aura
d’ions qui passeront, mais la résolution de ces ions sera d’autant plus faible. La figure 2.6.c
schématise le courant d’ions mesuré par le détecteur en sortie du quadripôle pour trois ions de
masse différente, selon 2 pentes de droite de stabilité. Avec une pente plus faible, les pics
s’élargissent, diminuant la résolution et le centre de la position de masse diminue à une masse
apparente plus faible, diminuant la précision de masse [92]. Il peut être difficile de trouver une
droite suffisamment bien ajustée pour passer par toute une gamme de masse tout en restant au
sommet des domaines de stabilités, afin d’optimiser la résolution et la précision de masse.
Généralement, un quadripôle a une gamme de m/z allant de 15 à 2000 et une résolution estimée
entre 1000 et 6000.
▪ Mode sélection
Il est également possible de configurer le quadripôle pour permettre uniquement aux ions d’un
seul ratio m/z de passer à travers. Par exemple, ce mode est généralement utilisé lors d’une analyse
en tandem MS/MS afin de sélectionner un ion pour le faire passer seul dans la cellule de collision
et obtenir son spectre de fragmentation.
2.2.4.b. Cellule de collision

La cellule de collision se trouve au Q2, à la sortie du Q1 (Figure 2.5). Les ions ayant réussi à
traverser le quadripôle Q1 peuvent, dans le cas d’une analyse en tandem (MS/MS), être fragmentés
dans cette cellule. Pour le TTOF 5600®, la fragmentation s’effectue par dissociation induite par
collision (collision induced dissociation, CID). Les ions précurseurs traversent la cellule et
rencontrent un flux orthogonal de gaz inerte (ici de l’azote). Le flux d’ions précurseurs possède
une certaine énergie cinétique induite à l’entrée de la cellule. Ces ions vont entrer en collision avec
les molécules de gaz entraînant une rupture de certaines liaisons covalentes.
Dans le cas d’une fragmentation peptidique, l’énergie cinétique va se transformer en
énergie interne au sein du peptide (vibrations et rotations). Or, ce peptide possède au moins un
proton issu de l’ionisation ESI, qui, d’après Paizs et al. (2005), est mobile au sein des acides aminés
le composant [93]. Lors de la fragmentation, ce proton va se placer sur l’azote de l’amide de la
chaîne peptidique, entraînant la formation d’un dérivé d’oxalozone protoné suite à l’attaque
nucléophile de l’oxygène du voisin N-terminal (Figure 2.7). L’énergie de collision peut être
adaptée par variation d’énergie cinétique du gaz inerte. Avec ce mode de fragmentation, les ions
formés sont appelés des ions y et b.
- 47 -
Figure 2.7. Mécanisme de dissociation des peptides par CID. Adapté de Paizs et al. (2005) [93].
2.2.4.c. Analyseur à temps de vol (TOF)

Après la cellule de collision Q2, des lentilles optiques focalisent les ions (précurseurs dans le cas
d’une analyse MS et fragments pour la MS/MS) vers un collimateur, en amont de l’analyseur TOF.
Son principe consiste cette fois non plus à sélectionner, mais à déterminer les rapports m/z des ions
entrants. Le TOF va analyser plusieurs ions de masses différentes en même temps. Dans le
collimateur, les ions sont accélérés grâce à l’application d’un champ électrique (Figure 2.8). Quand
la particule chargée est accélérée dans cette zone, son énergie potentielle est transformée en énergie
cinétique. Étant donné que le champ électrique est le même pour tous les ions présents dans ce
collimateur, leur énergie cinétique sera différente, à cause de leur masse :
𝐸𝑐 = 0.5 𝑚 𝑣 2 = 𝑧 𝐸 (2.5)
En sortie du collimateur, les ions entrent dans le tube de vol, où aucune perturbation électrique ou
magnétique n’est induite. Ce tube est soumis à un vide très poussé (de l’ordre de 10-7 mbar) pour
permettre un vol libre des ions. Ainsi, la vitesse, dépendant du m/z, sera différente pour chaque ion
qui arrivera au détecteur à des temps définis par
𝑚
𝑡 = 𝐿√ (2.6)
2𝑧𝐸
m/z : Charge de l’ion sur sa masse (Th)
E : Différence de potentiel imposée au niveau du collimateur (V)
L : Longueur du tube de vol (m)
t : Temps de vol (s)
L’objectif de cet analyseur de masse est donc de déduire, par la mesure du temps de vol dans ce
tube, la valeur des m/z des ions qui le traversent. Les ions ayant un faible m/z arriveront les premiers
au détecteur. La résolution d’un analyseur TOF peut être affectée par plusieurs incertitudes [94].
La première correspond à celle sur la mesure des temps de départ et d’arrivée de l’ion. Cette
incertitude est liée aux performances de la source pulsée et du détecteur. De plus, une dispersion
- 48 -
des temps de vol pour plusieurs ions de même m/z, peut être observée et résulte à la fois de la
dispersion en énergie ΔE du collimateur, et de la position initiale des ions dans celui-ci, avant
accélération.
Pour limiter cette dispersion et ainsi refocaliser les ions de même m/z, il est possible
d’utiliser le mode réflectron, que possède le TTOF 5600® (Figure 2.8). Il se distingue du mode
linéaire où les ions traversent directement le tube jusqu’au détecteur, par l’utilisation d’un
réflecteur électrostatique. Celui-ci est composé d’une série d’électrodes annulaires qui créent un
champ électrique dans un espace limité du vol. Pour deux ions de m/z identiques, mais d’énergies
cinétiques légèrement différentes, l’ion ayant celle supérieure fera un chemin un peu plus long que
l’autre dans le réflectron. Ainsi, le retard de l’ion d’énergie cinétique plus faible sera rattrapé avant
le détecteur. Il s’agit d’un analyseur très résolutif (5000-75000) et ayant une bonne précision de
mesure de masse (< 2 ppm). De plus, le TOF permet l’analyse sur une très large gamme de m/z
(jusqu’à 25 000 Th). Cela explique l’intérêt de cet analyseur pour les larges biomolécules.
Detecteur
Re lectron
one one de vol

d acceleration
Figure 2.8. Représentation schématique d’un analyseur à temps de vol avec réflectron, avec Ec1< Ec2, adapté des travaux de
thèse de E. Wagner [95].
2.2.5. Détecteur
Le détecteur permet de convertir la mesure de m/z de l’analyseur en un signal électrique, utilisé

pour obtenir un spectre de masse. Il existe deux catégories de détecteurs : le collecteur de Faraday
et le multiplicateur d’électrons. Le premier étant moins sensible, il est très peu utilisé en MS. Les
détecteurs multiplicateurs d’électrons sont généralement utilisés, tels que dans le TTOF5600®. Ce
détecteur est constitué d’un grand nombre de micro-canaux en silice parallèles et indépendants.
Une différence de potentiel est appliquée aux extrémités des canaux. Lorsqu’un ion de l’analyseur
entre en contact avec la paroi d’un micro-canal, il provoque l’émission d’un autre ion. Cet ion va
lui aussi provoquer l’émission d’autres électrons. Ces électrons secondaires vont ainsi de suite se
multiplier, et le courant ainsi généré est mesuré. Ce détecteur permet un gain d’environ 104 grâce
à son importante surface de canaux.
- 49 -
2.3. Couplage CE-MS pour la caractérisation des mAbs
2.3.1. Introduction
Le couplage MS avec la chromatographie liquide (LC-MS) est largement utilisé en raison de sa

facilité de mise en œuvre et de sa robustesse. Les récents développements techniques concernant
la séparation par électrophorèse capillaire (CE) et spectrométrie de masse (MS) ont également mis
en évidence la CE-MS comme technique analytique puissante pour la caractérisation des
biomolécules [96].
Cette partie a fait l’objet d’un chapitre de livre publié dans l’ouvrage scientifique intitulé Capillary
Electrophoresis‐Mass Spectrometry for Proteomics and Metabolomics (Editions Wiley, 2022),
faisant un état de l’art des méthodes CE-MS utilisées pour la caractérisation d’anticorps
monoclonaux. Trois approches majeures peuvent être utilisées pour la caractérisation de mAbs par
spectrométrie de masse. Elles sont définies par le niveau structurel de ces biomolécules lors de
leur analyse. La stratégie bottom-up consiste en l’étude au niveau peptidique de la protéine, suite
à sa digestion. L’approche middle-up correspond au niveau des sous-unités du mAb. Enfin,
l’analyse des mAbs sous forme intacte peut être également implémentée.
Pour des raisons de clarté, seule la partie du chapitre faisant état des applications de la stratégie
bottom-up est présentée dans ce manuscrit.
- 50 -
2.3.2. Caractérisation de la structure primaire des anticorps par CE-MS/MS
Publication: CE-MS methods for the characterization of monoclonal

antibodies
Tessa Reinert1, Alain Beck2, Pascal Houzé3, Rabah Gahoual3, Yannis Francois1
apillary lectrophoresis‐Mass Spectrometry for roteomics and Metabolomics (eds. Ramautar,

R. & Chen, D. D. Y.) Wiley
2022, 281–312
10.1002/9783527833092.ch11
2.3.2.a. Introduction
Among biotherapeutic products, monoclonal antibodies (mAbs) are experiencing a remarkable

success in different therapeutic fields like oncology and immunological disorders. Their
development is still progressing and a significant number of mAbs are currently in clinical trial,
including several for the treatment of the SARS-CoV-2 [97,98]. The suitability of mAbs used as
therapeutic treatments is explained by their intrinsic characteristics, namely their complete
specificity for the epitope of the targeted antigen in addition to their favorable pharmacological
properties. This class of biotherapeutic agents includes different formats such as mAbs, bispecific
antibodies, antibody-drug conjugates (ADC), glycoengineered antibodies and antibody fragments
(fusion proteins) [99].
MAbs are derived from immunoglobulin G (IgG). Thereby, they represent highly complex
glycoproteins composed of two heavy chains (HC) and two light chains (LC) identical
respectively, linked by the intermediate of several disulfide bonds. These tetrameric molecules
exhibit a molecular mass generally around 150 kDa [100]. The structure of the protein can be
divided into two distinctive regions: the variable domain (Fab) which is responsible for the
interaction with the antigen, and the constant domain (Fc) common to every IgG, that mediates the
effector functions of the mAbs [101]. A majority of the therapeutic mAbs express a similar N-
glycosylation located in the HC Fc domain (Figure 2.9). However, various mAbs are exhibiting
additional N-glycosylation and O-glycosylation along their peptide backbone [102,103].
- 51 -
Figure 2.9. Schematic representation of the structure of a monoclonal antibody.
In addition to their extensive structure, mAbs can be submitted to a variety of micro-

heterogeneities, resulting from enzymatic and chemical modifications, commonly referred to as
post-translational modifications (PTMs) [104]. Due to their structural complexity and their usage
as therapeutic agents, intensive research has been conducted in order to furnish analytical
methodologies capable of providing a comprehensive characterization of the different facets
defining the structure of mAbs [105,106]. In this context, mass spectrometry (MS) has gradually
become an essential technique for the characterization of mAbs especially due to its outstanding
selectivity and the possibility to obtain structural information for biomolecules [74].
Conventionally, MS instrumentation is hyphenated to liquid chromatography (LC-MS) due to its
easy implementation and good robustness. However, recent technical developments regarding
capillary electrophoresis (CE) hyphenation with mass spectrometry (CE-MS) have allowed CE-
MS to be highlighted as a powerful analytical technique for the characterization of biomolecules
[96]. Indeed, the electrophoretic migration generated in CE is particularly relevant for the
separation of biomolecules like peptides, proteins, and even nucleic acids due to their chemical
nature. Also, electrospray ionization-mass spectrometry (ESI-MS) is often used for the
characterization of biomolecules [107]. Therefore, the low flowrate of background electrolyte
(BGE) generated by the electroosmotic flow is particularly favorable to the production of a
nanoESI which allows to maximize ionization efficiency [108]. As a direct consequence, a
significant number of research articles describe the use of CE-MS method for the characterization
of mAbs and it is recognized in the biopharmaceutical industry as a relevant technique for the
analysis of this type of therapeutic protein [109,110].
The primary objective of the following chapter is to detail the implementation of CE-MS for the
structural characterization of mAbs. The different analytical workflows used for the
characterization of the protein are described in a compelling manner. Indeed, mAbs cannot be
completely characterized using a single method because of their structural complexity. Therefore,
it is necessary to apply complementary analytical methods in order to obtain information regarding
- 52 -
the different levels constituting the structure of the protein. Because of the absence of a stationary
phase and the application of an electrophoretic migration, CE can be used for the separation of
peptides as well as intact mAbs, which enables CE-MS for the analysis of mAbs at different levels
of structure. […] For each analytical strategy, rather than remaining limited to the CE-MS
conditions, a particular emphasis is provided to the requirements regarding sample preparation and
data treatment.
2.3.2.b. MAbs characterization approaches

Due to their nature, mAbs are complex macromolecules composed of a few hundred amino acids
spatially structured in a precise manner. The mAbs structure is conventionally characterized by
the intermediate of three distinctive strategies (Figure 2.10):
▪ The bottom-up approach considers the characterization of the mAbs at the peptide level ;
▪ The middle-up and middle-down analyses concern the subunits (Fab, Fc, HC and LC) of the
mAbs usually independently ;
▪ The intact protein, or top-down approach, consists of the analysis of the complete mAbs.
Figure 2.10. Representation of the principal analytical approach used for the characterization of mAbs. Adapted from
Dadouch et al. (2021) [111].
Depending on the implemented approach, mAbs sample preparation differs drastically. Also, the
CE-MS analysis conditions are partially different. This is explained because of the types of
analytes (peptides, intact proteins) that are separated and characterized for each characterization
approach.
The methodology referred to as the “bottom-up” strategy is directly derived from bottom-
up proteomic analysis [112]. This analytical strategy consists of the proteolytic digestion of the
- 53 -
mAb into peptides. The peptide mixture generated is consequently separated by CZE (Capillary
Zone Electrophoresis) and then ionized, most of the time with an electrospray ionization (ESI)
source, before MS analysis [90]. CZE is the capillary electrophoresis technique most spread for
mAb analysis when mass spectrometry is employed. Scriba et al. (2009) demonstrated that
peptides can be efficiently separated in CZE separation mode [113]. The peptides composing the
sample are then identified using MS data in order to characterize the amino acid sequencing of the
protein. Note that it is possible to use tandem MS (MS/MS) for the identification of the peptides
(CE-MS/MS analysis). In this case, the peptide identification is based concomitantly on the m/z
ratio measured for the proteolytic peptide and on the fragments obtained from collision-induced
dissociation (CID). Results obtained are compared to the theoretical value generated in silico from
the sequence of the mAbs. This methodology, referred to as peptide fragment fingerprint (PFF)
enables unambiguous identification and precise amino acid sequencing [114].
Therefore, this characterization workflow can provide an important quantity of information

regarding the primary structure of the mAbs, starting with amino acid sequence characterization.
Figure 2.11 highlights this strategy with the analysis of infliximab using CZE-MS/MS. The
electropherogram obtained (Figure 2.11.a) shows the separation of several peptides, such as
“DILLTQSPAILSVSPGER” at the migration time of 31.5 minutes. It is possible to extract the ion
corresponding to this peptide charged two times resulting in an EIC (Extracted Ion Chromatogram)
(Figure 2.11.b) and the MS spectra corresponding to the spectrometer acquisition at the exact
migration time (Figure 2.11.c). Finally, the MS/MS spectra are also acquired (Figure 2.11.d) and
present the m/z of the ion’s fragments obtained. These fragments allow for the recovery of the
amino acid sequence of the peptide analyzed.
The bottom‐up analysis can also be implemented for the characterization of PTMs. PTMs
are chemical modifications that can appear on the side chain of amino acids residues [115].
Similarly to the amino acid sequence characterization, mAbs are submitted to proteolytic
digestion, and the peptide mixture obtained is then analyzed by CZE–MS/MS. The occurrence of
PTMs can be identified from the mass shift between the intact peptide and its modified counterpart.
In the case of MS/MS analysis, the peptide backbone fragmentation generated from CID allows to
attribute in a precise manner the residue concern by the PTM [116]. In addition, the level of
modification can be evaluated independently for the different modified residue by measuring the
ratio of MS signal intensities between the modified peptide and the unmodified equivalent [117].
- 54 -
Figure 2.11. Electropherogram a. of Infliximab analyzed with CZE-MS/MS. b. EIC of the DILLTQSPAILSVSPGER peptide
at the m/z of 948.52. c. MS and d. MS/MS spectra obtained at the migration time of 57.88 min.
Finally, the bottom‐up strategy can also be used to achieve the characterization of mAb
glycosylation. Glycosylation is also a type of PTM, corresponding to the expression of complex
carbohydrate linked to the peptide backbone, which is often considered independently because of
its complexity. Following the proteolytic digestion, the glycosylation remains linked to the peptide.
Therefore, MS/MS data obtained from the analysis of the peptide mixture enable the identification
of the glycan linked to the peptide. The fragments identified from the MS/MS spectra enable to
decipher the structure of the glycan moiety. As a consequence, this methodology enables to
localize the residue bearing the glycosylation, to the structure of the glycan in addition to the
relative abundance of each type of glycan expressed for a particular glycosylation site [118].
2.3.2.c. Applications of the bottom-up strategy in CE-MS/MS

A) ANALYTICAL WORFLOW
▪ Sample preparation
The primary structure is conventionally characterized using a bottom-up strategy, in
order to obtain the amino acid sequence, PTMs, and glycosylation characterization. Therefore, it
is necessary to perform a proteolytic digestion protocol prior to the CE-MS analysis of the peptide
mixture obtained (Figure 2.10) [119]. Before digestion, the mAb sample needs to be denatured
using a chaotropic reagent in order to expose the entire peptide backbone of the protein to the
proteolytic enzyme, ensuring optimal digestion [120]. The most common chaotropic agent for
- 55 -
mAbs digestion is RapiGest SF® (sodium 3-(2-methyl_2-undecyl-1,3-dioxolan-4-yl) methoxyl)-

1-propane sulfonate). It is an acid labile surfactant that maintains the activity of most common
enzymes and is compatible with MS [121]. Other chaotropic agents, such as guanidine and urea,
can also be used. However, they involve the addition of important concentrations of chaotropic
agent, which may not be favorable to CZE-MS analysis.
Then, the mAb goes through the reduction of the disulfide bonds. Several agents can be used, such
as Tris(2-carboxyethyl) phosphine (TCEP) or Tris(hydroxypropyl)phosphine (THPP). However,
the most common is dithiothreitol (DTT) [122]. This step is usually followed by alkylation with
iodoacetamide (IAA) to prevent the restoration of disulfide bonds by blocking the free thiols.
Finally, digestion of the mAb can be performed in order to obtain peptides. A significant number
of enzymes are available [123], but the most commonly used is trypsin [124]. Trypsin is a protease
which can cleave bonds at the C-terminal side of the basic residues lysine (K) and arginine (R).
The peptide mixture obtained can consequently be characterized using CZE-MS analysis.
Regarding the characterization of PTMs, previous studies have identified that the alkaline
pH of the buffer usually used for trypsin digestion could induce deamidation of asparagine, which
inevitably introduces a bias [125]. Recently, a few studies have been performed to limit
endogenous modifications. Kori et al. (2016), found that working with Tris buffer and 10 %
acetonitrile significantly reduce the deamidation of asparagine [126]. It is also possible to use
enriched 18O water during digestion so the endogenous deamidations can be distinguished from
the original ones [127,128]. With 18O labeling, deamidation occurring during trypsin digestion
causes a + 2.984 Da mass shift due to the 18O incorporation on newly formed Asp/iso-Asp residue
(+2 Da) and the deamidation (+0.984 Da). In 2019, Cao et al. worked at lower pH using a
combination of low-pH-resistant Lys-C and modified trypsin and noted a limitation of endogenous
deamidations [129]. Since a long incubation time at 37°C is usually performed for tryptic digestion
and may be favorable to endogenous modifications, some studies have tried to reduce the digestion
time using pressure cycling technology (PCT) assisted tryptic digestion [130]. Other procedures
tried to automate trypsin digestion. For instance, micro-reactors were developed with immobilized
trypsin in capillaries [131].
Like PTMs, glycosylations can be characterized using the analysis of proteolytic peptides
in a bottom-up approach. However, for a given glycosylation site located on a specific residue, a
significant number of glycan structures are expressed, exhibiting different relative abundances,
which makes the analysis of glycosylation particularly complex. To address this complexity,
several strategies have been developed, depending on the characterization approach used (Figure
2.12). In addition to the analysis of the peptide mixture obtained from proteolytic digestion, it is
- 56 -
also possible to release the glycan moiety from the peptide and label it with a fluorescent dye.
Glycan release is performed using enzymatic digestion, in most cases with the peptide-N-
glycosidase F (PNGase F) which is able to remove N-linked oligosaccharides [132]. Consequently,
the released glycans can be labeled using a fluorescent dye to enable detection using fluorescence.
The most commonly used dye is APTS (1-aminopyrene-3,6,8-trisulfunic acid), which has been
routinely applied in the biopharmaceutical industry which allows fluorescence detection and is
compatible with MS analysis [133,134].
Figure 2.12. Schematic of the different analytical workflows used for the characterization of mAbs glycosylation.
▪ CE separation considerations for peptide analysis

CZE is adapted to the separation of peptides because, in this separation mode, peptides having
different compositions in terms of amino acid residues will necessarily have different effective
mobilities. The BGE used is principally composed of acetic acid or formic acid. An acidic BGE
allows to quasi-systematically obtain cationic peptides and ensure maximum protonation of the
silanol present on the capillary wall in order to prevent analyte adsorption. In addition, the BGE
flowrate generated by the electro-osmotic flow (EOF) is favorable with hyphenation with ESI-MS.
One of the main limitations of CE is sample loading capacity, which usually represents a few
nanoliters. As a consequence, different methods have been developed in order to significantly
increase sample volume injection while maintaining an optimal separation efficiency [135] [136].
The two main methods for sample staking of biomolecules in CZE are transient isotachophoresis
(t-ITP) and dynamic pH junction. t-ITP is a preconcentration method where the sample is
solubilized in a leading electrolyte, different from the BGE. The leading electrolyte has a higher
electrophoretic mobility than the BGE, and migrates faster than any analyte ion in the sample
- 57 -
solution [69]. It results in a staking effect of the analyte, allowing a better sample loading capacity
than classic CZE. t-ITP enables the injection of sample volumes up to 25% of the capillary volume
with improved separation efficiency. Dynamic pH junction has been recently used for top down
and bottom-up proteomics. In pH junction preconcentration, the sample is prepared in an alkaline
buffer and the BGE is acidic. When the electric field is applied, negatively charged peptides
migrate toward the anode until the junction with the BGE [137]. This effect leads to the staking of
the peptides which become positively charged when transitioning to the acidic BGE. Afterward,
normal CZE is occurring and peptides migrate toward the ESI source [96].
B) AMINO ACID SEQUENCE CHARACTERIZATION USING CE-MS(/MS)
The analysis of proteolytic peptide mixtures can be performed using CZE-ESI-MS or CZE-
MALDI-MS in order to potentially identify every peptide generated. Biacchi et al. (2014)
performed the amino acid sequence characterization of a humanized mAb by CZE-UV/MALDI-
MS. They designed an in-house coupling instrument that enables CZE separation, followed by
automated fraction collection and deposition on a MALDI plate. The offline CZE-UV/MALDI-
MS analysis demonstrated the possibility to obtain a sequence coverage of 92 % for HC and 100
% for LC of the considered mAb [138].
In 2006, Gennaro et al. presented the potential of CZE-ESI-MS for the characterization of
mAbs using a Lys-C digestion. They used a CE-MS system equipped with a coaxial sheath-liquid
interface in order to maintain the electric field during the separation [139]. In a similar manner,
Whitmore et al. (2012) compared the analysis of a mAb peptide digest using sheath-liquid CZE-
ESI-MS and sheathless CZE-ESI-MS. They demonstrated the possibility to obtain a complete
sequence coverage of a mAb with sheathless CZE-ESI-MS [63]. Shortly afterward, Gahoual et al.
(2013) developed a methodology implementing sheathless t-ITP CZE-ESI-MS/MS on several
mAbs and demonstrated the possibility to obtain systematically 100 % sequence coverage in a
single analysis. In addition, the peptides were identified based on the high-resolution MS
measurements and the MS/MS spectra concomitantly in order to provide unambiguous
identification [140]. Dada et al. (2017) evaluated several solvent mixture systems to enhance the
performance of the amino acid sequence characterization of ADC samples achieved by CZE-ESI-
MS [141]. Authors showed that adding N,N-dimethylacetamide (DMA) or N,N-
dimethylformamide (DMF) to the solvent system improved the separation efficiency.
In addition to product characterization and control, the bottom-up approach and amino acid
sequence characterization can also be of great interest for mAb biosimilarity assessment. Indeed,
several patents protecting the first generation of mAbs have recently expired, giving many
companies the opportunity to produce similar ones. To prevent issues originating from those new
- 58 -
drugs on the market, the US Food and Drug Administration (FDA) and European Medicine
Agency (EMA) regulated a biosimilar as a “biological medicinal product that contains a version
of the active substance of an already authorized product”. Those regulatory agencies also indicate
critical quality attributes (CQAs) that must be the same for a mAb and its biosimilars [142]. Having
the same amino acid sequence is one of the CQAs and can be investigated with a bottom-up
strategy. Gahoual et al. (2014) performed a detailed biosimilarity assessment regarding amino acid
sequence using sheathless t-ITP CZE-ESI-MS/MS by comparing trastuzumab and cetuximab from
their respective biosimilars. They demonstrated the possibility to identify a difference of a single
amino acid sequence between the innovator mAbs and the corresponding biosimilar [143].
C) PTMS CHARACTERIZATION AND RELATIVE QUANTIFICATION USING CE-MS(/MS)
As mentioned, PTMs refers to chemical modifications of amino acid side chains. There are a
significant number of PTMs that usually affect specific residues which generate a mass difference
between an intact peptide and its modified counterpart (Table 1.1, chapter 1). In vivo PTMs of
protein are a common phenomenon that can have a decisive influence on the activity of a protein
[144]. Thus, they can be implicated in the inhibition/activation of proteins, and they are reported
to act as biochemical signal transmitters or molecular clocks [145]. PTMs can also be generated
due to environmental conditions (temperature, pH). Concerning therapeutic mAbs, PTMs can
occur during the production process and/or storage, for instance. PTMs like asparagine
deamidation and methionine oxidation may negatively affect the biological activity or the
pharmacological properties of mAbs [146]. Therefore, they require thorough characterization in
order to provide identification, locate precisely the affected residues, and estimate the level of
modification of the protein [147,148]. Similarly to the amino acid sequence, PTMs are usually
identified by the analysis of the peptide mixture originating from the mAbs.
Gahoual et al. (2013) demonstrated the possibility to use the same dataset as amino acid sequence
characterization from sheathless CZE-ESI-MS/MS analysis to reveal information on PTMs for
several mAbs. CZE-ESI-MS/MS data allowed to identify precisely several PTMs of interest
including C-terminal glutamic acid cyclization, methionine oxidation and asparagine deamidation.
For each PTM, the CZE enabled the separation of the intact peptide for its modified homologous,
providing optimal sensitivity, which gives the opportunity to detect PTM levels as low as 2 %
[140]. In 2015, Lew et al. implemented an identical method to identify hotspots such as glutamic
acid cyclization, methionine oxidation, asparagine deamidation, and C-terminal lysine
heterogeneity using only 100 fmol of trastuzumab [149]. Later on, Gahoual et al. (2016) used
sheathless CZE-ESI-MS/MS for the identification of asparagine deamidation and aspartic acid
isomerization of different tryptic peptides from trastuzumab. Using synthetic peptides, they
- 59 -
demonstrate the systematic separation of the intact peptides from their modified counterparts when
exhibiting Asp deamidation and/or aspartic acid isomerization due to the selectivity provided by
the electrophoretic separation. The identification of the fragment ions using MS/MS data allowed
to systematically point the exact residue subjected to the modification [21].
The implementation of CZE separation in conjunction with MS/MS analysis explains the
outstanding level of characterization achieved regarding mAb PTMs. Indeed, since the selectivity
provided by the electrophoretic separation is dependent on the charge and the size of the analytes,
it involves the separation of a large number of PTMs, even when exhibiting small mass differences.
Thus, this characteristic enables to characterize independently the intact peptide from the modified
homologous. In the case of asparagine deamidation, for instance, the absence of separation would
lead to the inability to identify the PTM due to isotopic profile overlap [150]. Also, the separation
is interesting from a MS perspective because it allows the peptides to be transferred consecutively
to the MS which limits the ion suppression effect and guarantees a maximized signal intensity. In
the case of aspartic acid isomerization, the PTM does not involve a mass change of the residue
therefore, it cannot be identified with conventional MS/MS analysis. However, the CZE separation
enabled to distinguish the similar peptides having different isomers of aspartic acid, which was
attributed to the hydrodynamic radius change of the peptide between the two conformations. For
this particular PTM, the incorporation of CZE allowed to enrich the level of characterization
achieved compared to conventional methods. As such, the relevant properties of CZE-MS(/MS)
for the characterization of PTMs have been demonstrated beyond the analysis of mAbs, including
for challenging PTMs like methylation and phosphorylation [151,152].
D) GLYCOSYLATION DETERMINATION USING CE-MS(/MS)
Commonly, mAbs which are for the most part IgG1 protein, incorporate at least one N-linked
glycosylation positioned in the HC Fc region (Figure 2.10). Glycosylations are influencing
significantly the physico-chemical properties of the mAbs and participates to the inherent
heterogeneity of the protein [30,153]. As part of the primary structure of mAbs, the
characterization of the glycosylation can be performed at the peptide level or on released glycans.
The proteolytic digestion of a studied mAbs generates alongside conventional peptides,

glycopeptides composed of the glycan moiety still linked to the corresponding peptide. The
presence of the polar glycan moiety significantly increases the hydrophilic nature of the peptide
which requires dedicated methods for analysis in liquid chromatography [103]. Because the BGE
is an aqueous solution, the glycopeptides migrate in a consistent manner based on their
composition which prevents the introduction of biases for the glycoprofilling. Recently, a
- 60 -
significant number of research articles have been describing the analysis of glycopeptides using
CZE-MS(/MS) in order to perform the glycoprofilling of the mAbs. In 2006, Gennaro et al.
reported the separation and analysis of glycopeptides isolated from Lys-C digest using CZE-ESI-
MS [139]. In 2014, Gahoual et al. developed a sheathless t-ITP CZE-ESI-MS/MS for the
characterization of the primary structure of mAb. They showed the possibility to perform alongside
the amino acid sequence characterization, the identification and relative quantification of the 15
most abundant N-glycans of trastuzumab. The structure of the different glycans was deduced from
the MS/MS spectra obtained through CID fragmentation. CID allows only the fragmentation of
the glycan moiety. This preferential fragmentation can be explained as the glycosidic linkages of
glycoforms are more labile than amide bonds of peptide backbone. In addition, they demonstrated
that CZE enabled to achieve partial separation of glycopeptides exhibiting a difference of one
galactose [140,154].
Similarly Kammeijer et al.(2017) used sheathless CZE-MS for the analysis of
glycopeptides and demonstrated the partial separation of glycopeptides having a sole difference of
a sialic acid [155]. They also showed the separation of non-sialylated glycoforms, as shown in
Figure 2.13. Also, Giorgetti et al. (2018) performed sheathless t-ITP-CZE-MS/MS analysis of
natalizumab’s peptides. The MS/MS spectra they obtained allowed to determine precisely the
glycosylation structures expressed by the mAbs [156]. Based on the intensity of ions obtained, it
is possible to perform relative quantitation of glycan species in a sample, also referred as
glycoprofilling. In another research, they managed to obtain that information on 7 therapeutic
mAbs by CZE-ESI-MS/MS illustrating the robustness of the glycoprofilling achieved using this
method [157]. the information provided by the MS/MS spectra allowed to decipher the structure
of the glycan in addition to enable to locate the glycosylation site.
Figure 2.13. CE-ESI-MS analysis of prostate specific antigen (PSA) non-sialylated glycopeptides after a tryptic digestion.
Extracted from Kammeijer et al. (2017) [155].
- 61 -
2.4. Conclusion
Comme présenté dans le chapitre de livre, le couplage CE-MS/MS suivant une stratégie bottom-
up peut être employé pour la caractérisation de la structure primaire des anticorps. Les aspects
structuraux secondaires ou tertiaires, se référant à l’agencement des séquences d’acides aminés,
ou encore l’agrégation des mAbs, ne sont pas possibles suivant cette stratégie. Pour explorer ces
dimensions, il est nécessaire de recourir à d’autres méthodes, basées sur des discriminations de
taille, comme la chromatographie d’exclusion stérique.
Néanmoins, la caractérisation de la structure primaire des mAbs est essentielle, notamment car
elle permet l’évaluation de plusieurs CQA établis par les autorités réglementaires. L’analyse
peptide-centrée bottom-up mène à la caractérisation de la séquence d’acides aminés, la localisation
et l’identification de certaines PTM, voire de quantifier leur abondance relative. Par ailleurs,
l’évaluation de la biosimilarité d’anticorps monoclonaux s’effectue en partie par cette approche.
Ainsi, plusieurs applications du couplage CE-MS/MS pour la caractérisation de la structure
primaire d’anticorps monoclonaux ont pu être présentées dans ce chapitre. Ces applications ont été
réalisées sur des mAbs issus de leur formulation, et non pas d’une matrice biologique.
Une autre information importante est que jusqu’à présent et d’après nos connaissances
actuelles, la quantification des anticorps n’a pas encore été décrite avec le couplage CE-MS/MS.
Or, la quantification de traitement thérapeutique est essentielle lors de suivi clinique, afin
d’identifier rapidement des pertes de réponses et adapter le traitement. D’autres méthodologies
analytiques sont couramment utilisées à cette fin, et sont présentées dans le chapitre suivant.
- 62 -
Chapitre 3 – Méthodes pour le suivi quantitatif de mAbs thérapeutiques
C HAPITRE 3.
M ETHODES POUR LE SUIVI QUANTITATIF DE M A BS
Préambule
Une fois l'anticorps injecté dans l'organisme du patient, sa quantification est un préalable
indispensable à l'évaluation de ses propriétés pharmacocinétiques et pharmacodynamiques. Les
anticorps ont des demi-vies relativement longues (la médiane étant de 14 jours [158,159]) dans le
système immunitaire, comparées à d'autres biomolécules thérapeutiques, mais leur clairance peut
varier d’un patient à un autre. La concentration doit donc être suivie de manière routinière afin
d’ajuster la dose du traitement.
La majorité des mAbs thérapeutiques est administrée par voie intraveineuse, bien que
quelques-uns (adalimumab, omalizumab et palivizumab) soient administrés par voie sous-cutanée,
mais diffusent pour rejoindre la circulation sanguine. En raison de leur grande taille et de leur
nature hydrophile, les IgG ont une faible pénétration tissulaire, donc restent dans le plasma. Par
conséquent, la quantification des mAbs thérapeutiques après leur administration est généralement
réalisée à partir d'échantillons sanguins prélevés au patient. Après centrifugation du sang, on
obtient le plasma qui, sans anticoagulant, mène à du sérum. Les méthodes analytiques sont alors
soumises à un obstacle de taille (ou plutôt ici, de concentration) : les mAbs thérapeutiques se
retrouvent en concentrations très faibles (1- 50 µg·mL-1) parmi de nombreuses protéines, incluant
notamment des IgG naturelles (1-5 mg·mL-1). La présence de la matrice et de ses composés mène
à des défis analytiques pour conserver une sensibilité suffisante.
De plus, les méthodes quantitatives développées dans ce contexte doivent répondre à de
nombreux critères établis par les autorités en vigueur. On retrouve essentiellement l’Agence
Européenne du Médicament (EMA, Europe) et Food and Drug Administration (FDA, États-Unis)
qui sont deux autorités majeures du domaine pharmaceutique [160,161]. Elles ont établi des
critères que les méthodes de quantification doivent valider pour garantir, entre autres, l’exactitude
et la précision du résultat [162]. Ainsi, chaque nouvelle méthodologie quantitative développée doit
faire l'objet d'une validation de méthode, pour être appliquée en routine.
Par ailleurs, la concentration sanguine du mAb thérapeutique n’est pas la seule mesure
quantitative régulière des patients traités par cette biothérapie. Il est apparu que ces traitements
peuvent générer la production d’anticorps immunogènes par l’organisme des patients, impactant
l’activité thérapeutique. Ainsi, leur détection et quantification sont elles aussi extrêmement
importantes pour le suivi clinique, et présentent des défis supplémentaires, discutés dans ce
chapitre.
- 63 -
3.1. Quantification de mAbs par ELISA

3.1.1. Principe
Le dosage d'immunoabsorption enzymatique (Enzyme Linked ImmunoSorbent Assay – ELISA) est

un test immunologique qui repose sur l’étude de l’interaction entre deux composés, dont l’un est
ajouté en concentration fixe à une matrice biologique, pour définir la concentration du deuxième.
Il s’agit d’un immuno-dosage rapide, sensible, facile à mettre en œuvre, sur un petit volume, sans
utiliser d’étape de purification préalable de l’échantillon. Il existe de nombreux formats de ces
tests ELISA, adaptés à diverses applications, qui permettent la quantification d’antigènes ou
d’anticorps dans des matrices biologiques. Lors de la quantification de mAbs thérapeutiques dans
du sérum, un des formats particulièrement répandus est celui schématisé sur la Figure 3.1. Il est
utilisé pour détecter la présence d'anticorps dirigés contre des antigènes spécifiques (cercles
orange, Figure 3.1), tout en évaluant leur capacité à former des complexes antigène/anticorps.
Fluorescence/
Absorbance
Figure 3.1. Dosage ELISA pour la quantification de mAbs dans du sérum.
La première étape consiste à revêtir une surface solide (plaque à 96-puits) avec l’antigène
spécifique du mAb thérapeutique à quantifier. Puis, la matrice sérique contenant le mAb est
ajoutée. Un temps d’incubation est nécessaire pour laisser la première interaction se réaliser. Si
l'analyte d'intérêt est présent dans l'échantillon, il se liera spécifiquement à la surface revêtue,
formant ainsi des complexes antigène-anticorps. Plusieurs lavages successifs sont alors effectués
afin d’éliminer la matrice.
Enfin, un anticorps secondaire, dirigé lui aussi contre la partie CDR du mAb primaire, et
préalablement conjugué à une enzyme fluorescente, est ajouté pour effectuer la deuxième
interaction spécifique avec le mAb. Une enzyme couramment utilisée pour la conjugaison à ces
anticorps secondaires est la peroxydase de raifort (HRP, horseradish peroxidase). Après
élimination des anticorps secondaires non liés à l’analyte, un substrat chimique est ajouté qui est
converti par l'enzyme en un produit détectable. Parmi ceux possibles, on peut retrouver le 3,3',5,5'-
tétraméthylbenzidine (TMB) dont les chromophores produisent un bleu intense lors de la
- 64 -
dégradation enzymatique du peroxyde d’hydrogène par HRP. Enfin, l’ajout d’une solution d’acide
sulfurique stoppe la réaction. Alors, le TMB va de nouveau donner un électron à HRP, et se
transformer en di-imine, entraînant la coloration du mélange en jaune, absorbant à 450 nm [163].
La mesure de l’absorbance à cette longueur d’onde permet de définir la concentration initiale de
mAb.
3.1.2. Applications pour la quantification de mAbs thérapeutiques
Différents kits sont commercialisés, et largement implémentés en routine pour le suivi clinique de
patients traités par mAbs thérapeutiques [164,165]. Les tests ELISA sont généralement très
sensibles, ce qui permet de détecter et de quantifier de faibles concentrations de protéines
thérapeutiques dans du sérum. Par ailleurs, leur facilité de mise en œuvre et la rapidité d’analyse
les rendent particulièrement attractifs. Les différents formats existants peuvent également être
appliqués à d’autres formes de biothérapies comme les ADC (Antibody Drug Conjugates) [166].
Différents développements ont été investigués afin de limiter le temps et le coût de ces analyses,
déjà très compétitifs [167], ou encore pour augmenter la sensibilité [168].
Ces essais sont considérés comme spécifiques, puisqu’ils requièrent deux interactions
antigène-anticorps (certains formats n’en nécessitent qu’une seule). Cependant, il arrive que
plusieurs mAbs thérapeutiques aient la même cible antigénique, comme l’infliximab et
l’adalimumab, deux agents anti-TNF-α. Il arrive parfois que certains patients nécessitent un
changement thérapeutique d’un agent vers un autre. Alors, durant cette période de changement,
les immunodosages ELISA ne sont pas capables de distinguer ces agents mAbs.
Malgré leurs nombreux avantages, les tests ELISA présentent également certains autres
inconvénients. Ils peuvent être sensibles aux interférences induites par d’autres composés présents
dans la matrice, entraînant des résultats erronés ou faussement positifs/négatifs. Or, le sérum
contient de nombreuses protéines entraînant ces effets. Par exemple, les facteurs rhumatoïdes ou
les anti-IgG naturellement présents dans le sang peuvent se lier à l’anticorps fixé sur la plaque et
être détectés comme analyte. De plus, la stratégie nécessite une fixation préalable d’anticorps sur
une surface solide, ce qui peut altérer le paratope et restreindre la première interaction entre
l'antigène et l'anticorps. Les lavages successifs de ces tests peuvent également entraîner la
dissociation de certaines interactions formées [59]. Afin d’assurer la reproductibilité de cette étape,
certains laboratoires utilisent des programmes de lavages automatisés des plaques.
- 65 -
3.1.3. Cas particulier de la quantification d’anticorps anti-drug (ADA)
Les tests ELISA peuvent également être utilisés pour quantifier non pas les mAbs
thérapeutiques, mais des anticorps naturels de l’organisme. Par exemple, récemment, un test
ELISA pour quantifier des mAbs dirigés contre le SARS-CoV-2, un virus respiratoire, a été
développé [169]. Ce test consiste à identifier la pathologie par le biais de la réponse immunitaire
développée par l’organisme. Il est également décrit l’utilisation de tests ELISA pour la détection
et la quantification d’anticorps anti-médicaments (ADA), dirigés contre le mAb thérapeutique,
suite à une réaction immunogène d’un patient [170,171]. Cette réaction auto-immune, néfaste pour
le traitement thérapeutique, doit être contrôlée. Aussi, les autorités de régulation telles que EMA
et FDA indiquent la nécessité de quantifier les ADA développés. Les tests ELISA sont
couramment utilisés en routine pour le suivi clinique de ces réponses. Il faut noter que cette
stratégie permet la quantification d’un certain type d’ADA : les neutralisants, c’est-à-dire ceux
dirigés contre le paratope de l’anticorps thérapeutique.
En plus de ceux cités, d’autres effets indésirables de ces immunodosages sont retrouvés
essentiellement pour la quantification d’ADA. La présence d’antigène libre du mAb thérapeutique
dans le sérum peut entraîner une compétition entre l’ADA et cet antigène. Cela est décrit dans la
littérature comme drug-target interference [172]. Par ailleurs, certains formats ELISA ne
permettent pas de détecter les ADA de type IgG4, ne possédant qu’un seul site de reconnaissance.
Enfin, certains ADA ont une très faible affinité avec leur médicament cible, mais restent importants
à identifier. Les lavages des ELISA ne parviennent pas, dans certains cas, à maintenir ces
interactions, qui peuvent donc mener à des faux négatifs.
- 66 -
3.2. Quantification de mAbs par spectrométrie de masse

3.2.1. Défis de la quantification par MS
La singularité de la spectrométrie de masse réside dans sa capacité à identifier les molécules en se

basant sur leur rapport masse/charge et leurs motifs de fragmentation. Durant plusieurs décennies,
la MS a été essentiellement utilisée pour l'analyse chimique qualitative. Pour répondre aux besoins
pressants de mesures moléculaires quantitatives, un certain nombre de laboratoires se sont
concentrés sur les améliorations technologiques et méthodologiques susceptibles de faire de la MS
une plateforme quantitative [173]. Celle-ci a néanmoins rencontré à ses débuts beaucoup de défis.
Les calibrations linéaires obtenues par spectroscopies UV par exemple semblaient beaucoup plus
attractives que celles résultant d’analyses par MS. Cela est dû à plusieurs facteurs impactant ses
capacités quantitatives. Dans un premier temps, des défis instrumentaux, avec par exemple les
efficacités de transmission d’ions dans le spectromètre, ou de détection, sont à considérer en MS.
Dans un second temps, l’efficacité d’ionisation des analytes, leurs concentrations, la répétabilité
limitée de leurs signaux, et les interférences spectrales sont autant de paramètres à évaluer pour
assurer une quantification robuste.
Le choix de la technique d’ionisation, nécessaire à l’entrée de la MS est important, car elle affecte
le nombre d’états de charge et les spectres MS des analytes introduits. La technique de désorption-
ionisation par MALDI est intéressante, car génère peu d’états de charges, la rendant très sensible.
Néanmoins, il s’agit de l’ionisation par électrospray (ESI) qui a contribué à rendre la MS attractive
pour la quantification de biomolécules, car a permis son couplage à des méthodes séparatives,
décomplexifiant les mélanges et limitant alors les interférences. Les méthodes de préparation
d’échantillons peuvent également être implémentées, surtout dans le cas de matrices biologiques,
toujours pour réduire les effets de matrices, et augmenter la spécificité de l’analyse. Il est
également possible de procéder à des étapes de dilution ou de concentration des analytes, afin de
se placer dans des conditions adéquates à la sensibilité de la méthode. Cependant, toutes ces étapes
sont consommatrices de temps et peuvent limiter la mise en œuvre de la procédure. De plus, la
préparation d’échantillon peut affecter la mesure quantitative en induisant des pertes ou altérations
de l’analyte. Les sections de ce chapitre présentent les stratégies les plus implémentées pour la
quantification de mAbs par MS, et décrivent comment s’affranchir des erreurs liées à la préparation
et à l'analyse afin d'obtenir une quantification absolue. Par opposition à la relative, elle permet de
déterminer la concentration exacte d’une molécule dans une matrice, et non pas sa proportion par
rapport à un autre composé.
- 67 -
3.2.2. Quantification d’un mAb à partir de ses peptides
La gamme en masse limitée de certains spectromètres basse résolution, et la perte de sensibilité

liée à l’obtention d’espèces multichargées lors de l’ionisation ESI de protéines entières, limitent
leur quantification sous forme intacte. Aussi, il est généralement préférable de digérer les mAbs
au préalable de leur analyse par MS. Les ions alors générés après ionisation ESI présentent
majoritairement 2 ou 3 états de charges, qui peuvent être suivis selon différentes stratégies. Cette
section décrit les principales étapes à prendre en compte lors d’une stratégie d’analyse peptidique
de mAbs par MS.
3.2.2.a. xtraction et protéolyse en ymatique de l’anticorps

L’étape de préparation d’échantillon regroupe toutes les manipulations depuis la collecte de
l’échantillon d’intérêt jusqu’à son injection dans l’instrument de séparation. On peut, lors d’une
stratégie d’analyse MS peptidique, scinder cette étape en deux parties : la purification et la
digestion. L’étape de purification permet d’éliminer la matrice biologique et tous les autres
éléments qui la composent, à l’exception de l’analyte (mAb). Il existe une pléthore de
méthodologies à cette fin, à commencer par les méthodes de précipitation d’IgG, très efficaces
pour éliminer l’albumine, soit environ 60 % des protéines plasmatiques totales [174]. Cependant,
bien que simples et abordables, elles sont consommatrices de temps (précipitation de nuit) et sont
peu spécifiques. Une approche alternative consiste à effectuer une extraction ciblée du mAb en
utilisant, par exemple, l'antigène cible se liant spécifiquement à la région CDR de l'anticorps. Cet
antigène peut être fonctionnalisé sur une surface solide pour faciliter l'extraction [175,176].
Une fois le mAb extrait de la matrice, il peut être digéré, suivant les mêmes étapes que
celles présentées dans le chapitre de livre (Section 2.4.2.c du manuscrit). Brièvement, une enzyme,
telle que la trypsine, permet de le digérer en peptides par hydrolyse de liaison entre des acides
aminés particuliers. Il est intéressant de rendre disponible le maximum de sites de l’anticorps en
utilisant des détergents comme le RapiGest®, particulièrement utilisé avant l’analyse MS. Une
fois l’anticorps complètement dénaturé, un réducteur de ponts disulfures, tel que le dithiothreitol
(DTT), peut être ajouté pour dissocier les chaînes lourdes et légères du mAb. Pour éviter que ces
ponts disulfures ne se reforment au cours de la digestion, il est possible d’utiliser un agent alkylant
pour occuper les places de ces sulfures, tel que l’iodoacétamide (IAA). Toutes ces étapes
permettent d'augmenter l’efficacité de digestion.
3.2.2.b. Acquisitions MS des peptides

Une fois le digest peptidique obtenu, il peut être décomplexifié par une méthode séparative avant
d’être ionisé en ESI et analysé dans le spectromètre de masse. Si une analyse en tandem MS/MS
- 68 -
est utilisée, alors différentes stratégies d’acquisition de ces ions peptidiques peuvent être
implémentées. Le choix de la stratégie à réaliser dépend de l’objectif de la méthode, mais aussi du
spectromètre disponible. La méthode la plus utilisée pour un suivi quantitatif d’ions est appelée
MRM (Multiple Reaction Monitoring) et peut être effectuée par des triples quadripôles. L’objectif
est, au cours d’un cycle de scan MS, de sélectionner un ion précurseur, de le fragmenter, et de
suivre dans un second quadripôle (ou TOF par exemple) un ou plusieurs de ses fragments. Il en
résulte la possibilité de suivre le signal de cette fragmentation au cours du temps, ce qui permet
d’obtenir une information quantitative et fiable de la présence du composé. Cette approche
nécessite de cibler les ions à suivre avant leur analyse.
D'autres stratégies permettent l’obtention des spectres MS/MS d’ions précurseurs, telles
que la DDA (Data Dependant acquisition) ou encore la DIA (Data Independant Acquisition). La
méthode DDA fragmente au cours d’un cycle les ions les plus intenses issus du spectre MS du
scan balayage. En mode DIA, pour chaque cycle, l'instrument se concentre sur une fenêtre de
masse étroite de précurseurs et acquiert des données MS/MS de tous ceux détectés dans cette
fenêtre, qui est ensuite étendue à l'ensemble de la gamme de masse. Les méthodes DDA et DIA
sont répandues pour la quantification d’espèces, bien que moins utilisées que la MRM [197,198].
La DDA est plus sensible que la DIA, mais présente une moins bonne précision et reproductibilité.
3.2.2.c. Sélection des peptides signatures

Après digestion peptidique du mAb thérapeutique, une multitude de peptides sont obtenus et
analysés en MS. La sélection des peptides à suivre pour la quantification d’un mAb doit être menée
avec précaution afin de garantir sa spécificité. Notamment, les mAbs chimériques, humains ou
humanisés, présentent de fortes homologies de séquences avec les IgG naturellement présentes
dans l’organisme. Étant donné le grand nombre d’IgG dans les matrices biologiques, il est
nécessaire de sélectionner des peptides dont la séquence d’acides aminés est spécifique au mAb.
Afin d’assurer cette spécificité, il est possible d’utiliser plusieurs outils, tel que « Protein
Prospector » (http://prospector.ucsf.edu) permettant la digestion in silico de l’anticorps, et
« Protein Blast » (https://blast.ncbi.nlm.nih.gov/Blast.cgi) permettant de cribler les peptides
générés et les comparer aux séquences peptidiques d’un organisme cible à partir d’une base de
données telle que UniProtKB®. Les peptides sélectionnés doivent ensuite être étudiés pour
s'assurer qu’ils ne présentent pas de PTM, qui pourraient entraîner une hétérogénéité non
systématique. De préférence, les asparagines, les méthionines ou les cystéines, qui peuvent subir
respectivement des déamidations, oxydations ou alkylations, sont à éviter.
- 69 -
3.2.2.d. Sélection de l’étalon interne

Afin d'utiliser un peptide résultant de la digestion protéolytique d'un anticorps comme indicateur
de sa concentration, il est crucial que ce peptide rapporteur soit présent en concentration
équimolaire par rapport au mAb d'origine. Ainsi, il faut considérer que la digestion peptidique a
été complètement efficace, ce qui n’est pas toujours le cas. Par ailleurs, les pertes ou altérations du
mAb durant l’étape de purification ou encore les fluctuations de l’efficacité d’ionisation du peptide
sont autant de problématiques pouvant affecter l’intensité du signal m/z de l’ion considéré, et donc
sa quantification. L’utilisation d’un étalon interne, introduit le plus tôt possible à l’échantillon en
concentration connue, permet de normaliser la réponse du mAb à la sienne, et ainsi de déterminer
la concentration absolue du mAb au départ dans sa matrice. L’étalon interne doit répondre à
plusieurs critères :
• Il doit, dans un premier temps, avoir des caractéristiques physico-chimiques les plus proches
du mAb à quantifier. Ainsi, lors du dosage, il pourra se comporter de manière similaire ;
• Il ne doit pas se trouver dans la matrice de départ, car sa concentration doit être connue ;
• Afin d’être identifié en spectrométrie de masse, l’étalon doit présenter un écart de masse
distinguable et connu par rapport à l’analyte (Δm > 3 Da).
Des étalons marqués par isotopes (Standard Isotope Labeled – SIL) ont été mis au point et sont
considérés comme les molécules qui imitent le mieux le comportement des analytes, tout en
répondant aux critères cités précédemment. Le marquage SIL implique de substituer certains
atomes courants (comme le carbone 12C, l'azote 14 N ou l'hydrogène 1H) par des isotopes stables
(non radioactifs) plus lourds (par exemple, le carbone 13C, l'azote 15N ou le deutérium 2H) d’une
molécule. Cela crée des versions légèrement modifiées de la molécule d'origine, qui peuvent être
détectées par MS. Ces étalons SIL existent sous de multiples formes, et peuvent être introduits à
différentes étapes de la préparation d’échantillons.
▪ Peptides marqués par des isotopes stables

La stratégie AQUA (Absolute QUAntification) est l’une des méthodes de quantification absolue
de protéines les plus utilisées [179,180]. Cette approche repose sur l’utilisation de peptides
synthétiques isotopiquement marqués (SIL-peptides), ajoutés à la protéine digérée en tant
qu’étalons internes. Généralement, ces peptides sont marqués 15N,13C sur un acide aminé
particulier. Le digest peptidique est ensuite extrait et analysé par MS. La concentration de la
protéine est déterminée par le rapport des intensités d’un peptide naturel et de celui isotopiquement
marqué. AQUA considère donc que la purification/extraction préalable de la protéine est totale,
ainsi que le peptide sélectionné est systématiquement digéré. Cela permet de s’affranchir des
erreurs liées à l’analyse, comme la suppression d’ions lors de l’ESI.
- 70 -
▪ Polypeptide marqué
Les QconCATs sont des protéines artificielles, consistant en la concaténation de plusieurs peptides
SIL [181]. Il résulte alors une protéine recombinante marquée par des isotopes, pouvant être
ajoutée à l’échantillon avant la digestion. Les peptides concaténés digérés servent de standard
interne pour différentes protéines. L'un des principaux inconvénients de cette approche est que
l'efficacité de la digestion des protéines peut varier de manière significative entre les QconCATs
et les protéines natives en raison des différentes compositions en acides aminés. Cependant, les
QconCATs peuvent être composés de peptides marqués de diverses protéines, permettant leur
quantification simultanée.
▪ Anticorps entier marqué

La stratégie de quantification utilisant des étalons de protéines entières et marquées est appelée
PSAQ (Protein Standard Absolute Quantification) et fut décrite par Brun et al. (2007) [182]. Ces
étalons sont incontestablement les plus adaptés à la quantification absolue de protéines, mais sont
onéreux, ce qui limite fortement leur utilisation. Lors d’une stratégie peptide-centrée, les suivis du
mAb d’intérêt et de l’étalon interne s’effectuent sur un ou plusieurs peptides. Ainsi, il est essentiel
d'anticiper les peptides générés lors de la digestion des anticorps (analytes et étalon interne), afin
de s'assurer que chaque peptide de l'étalon interne présente un marquage isotopique permettant de
le distinguer par MS. En particulier, pour les anticorps monoclonaux, Sigma commercialise les
SILuTMMAb (Stable-Isotope Labeled universal Monoclonal Antibody), des anticorps entiers de
type SIL. Ces mAbs sont marqués (15N,13C) au niveau des lysines et des arginines des chaînes
lourdes et légères, et sont donc parfaitement adaptés à une digestion tryptique, qui résultera en
l’obtention de peptides possédant tous un marquage, identifiable par MS (+ 8 Da pour la lysine, et
+10 Da pour l’arginine). L’ajout à la matrice de départ du mAb marqué entier permet alors de
s’affranchir de toutes les étapes de manipulation d’échantillon et de l’analyse MS.
3.2.2.e. Mise en place d’une quantification par étalon interne
▪ Principe de l’ DMS
La première application de la protéolyse pour la quantification absolue d’une protéine par MS date
de 1996 et a été développée par Barr et al. [183]. Dans cette méthode, un étalon interne marqué
isotopiquement est ajouté en concentration connue à la protéine de départ. Son marquage permet
de le distinguer par MS par incrément isotopique de la masse de l’étalon par rapport à celle du
peptide analyte. Par produit en croix, étant donné que la concentration de l’étalon est connue, il est
possible de remonter à celle du peptide analyte. Cette stratégie est nommée IDMS (Isotopic
Dilution Mass Spectrometry).
- 71 -
▪ Principe de la gamme d’étalonnage avec étalon interne

La quantification en IDMS est très répandue, mais l’application d’un simple produit en croix pour
revenir à la concentration initiale du mAb peut présenter des limites de répétabilité. De plus, il est
compliqué d’estimer le domaine de linéarité entre la réponse du mAb et sa concentration. Il est
donc généralement plus robuste de réaliser des gammes d’étalonnages préparées dans la matrice
biologique. À cette matrice sont ajoutées des concentrations croissantes du mAb et des
concentrations fixes de l’étalon interne, pour atteindre au moins cinq points de calibration (Figure
3.2). Simultanément est préparé l’échantillon contenant le mAb à quantifier, auquel est ajoutée la
même concentration d’étalon interne que pour la gamme. Chacun des échantillons est alors préparé
suivant la méthodologie implémentée (purification, digestion, technique séparative et analyse
MS). L’intégration MS des peptides sélectionnés spécifiques au mAb et à l’étalon interne permet
d’établir une relation linéaire, qui peut alors être utilisée pour déterminer la concentration du mAb
de l’échantillon inconnu.
Figure 3.2. Principe de quantification d’un mAb issu d’une matrice sérique par MS, par ajout d’étalons internes. En pointillé :
différentes possibilités d’étalons et de stratégies quantitatives. Adapté de Wang et al. (2016) [184].
- 72 -
Selon l’étalon interne choisi, la mise en place de la stratégie quantitative va différer. La

Figure 3.2 présente brièvement les méthodologies possibles. En 2016, Wang et al.(2016)
présentent la méthode TAQSI (Targeted Absolute Quantitative proteomics SILAC internal
standards) par quantification avec une gamme d’étalonnage de protéines calibrantes intactes [184].
3.2.3. Validation d’une méthode quantitative MS
Après avoir établi les conditions de la méthode de quantification, il est indispensable de la valider
afin de garantir le résultat apporté. Dans le cas des méthodes quantifiant des protéines dans des
matrices biologiques, des directives sont proposées par les réglementations EMA et FDA
[160,161]. Plusieurs critères doivent y être démontrés afin d’appuyer la validité de la méthode
analytique pour la quantification de mAb. La validation permet de prouver la fiabilité d’une
méthode analytique qui sera utilisée telle qu’elle en routine. Les points présentés dans cette partie
ne constituent pas une liste exhaustive de tous les paramètres qu’il faut vérifier pour la validation
d’une méthode de quantification. Il s’agit néanmoins de paramètres cruciaux, requis par les
réglementations EMA et FDA.
▪ Linéarité. Ce critère doit être validé, si la réponse de la méthode est proportionnelle à la

concentration du mAb. Une gamme de solutions calibrantes est réalisée dans la matrice, avec des
concentrations croissantes de l’analyte sur au moins 6 points de concentration, chacun réalisé en
réplicas de trois, répartis sur des jours différents. Si un étalonnage interne est réalisé, il faut aussi
préparer des blancs (juste matrice) et des zéros (matrice dopée à l’étalon). Le tracé de la réponse
en fonction de l’analyte, doit mener à une relation linéaire (de coefficient de corrélation r² > 0.99).
Le rétrocalcul de toutes les solutions calibrantes à partir de la relation linéaire établie permet de
vérifier que les points sont proches de la droite de régression (Figure 3.3.a, Δ). Il faut alors que les
valeurs de concentration du mAb rétrocalculées soient inférieures à 20 % de la concentration
nominale.
▪ Précision et justesse. Ces deux critères sont essentiels lors d’une validation analytique, et
permettent de démontrer que les résultats quantitatifs sont exacts et répétables dans le temps. Ils
doivent être établis à partir de solutions appelées Contrôles de Qualité (QC). Les QC sont réalisés
par dopage de la matrice avec de l’analyte et de l’étalon interne, issus de lots différents de ceux
utilisés pour la gamme étalon. Généralement, les solutions QC sont réparties en 4 points de
concentration de l’analyte, inclus dans la gamme étalon. Ces QC sont réalisés en réplicas inter-
journée (réalisés le même jour) et intra-journée (réalisés des jours différents). À partir de ces
- 73 -
réplicas, il est possible de calculer la précision, qui se calcule par leur coefficient de variation,
devant être inférieur à 15 % pour être validée.
𝐸𝑐𝑎𝑟𝑡−𝑡𝑦𝑝𝑒 (𝑟é𝑝𝑙𝑖𝑐𝑎𝑡𝑠)
𝐶𝑉 (%) = 100 ∗ (3.1)
𝐶𝑜𝑏𝑠
Concernant la justesse, elle se détermine par la moyenne de la concentration mesurée (Cobs) des
réplicas (inter-jours ou intra jours) et par le biais de cette valeur par rapport à la valeur nominale
(Cthéorique), devant être inférieure à 20 %
𝐶𝑜𝑏𝑠
𝐽𝑢𝑠𝑡𝑒𝑠𝑠𝑒(%) = 100 ∗ 𝐶 (3.2)
𝑡ℎé𝑜𝑟𝑖𝑞𝑢𝑒
▪ Effets de matrice. L’idée est de déterminer l’impact qu’ont la matrice et ses composants
sur la mesure quantitative de l’analyte. Des solutions références sont réalisées, par mesure des
analytes et étalons dans un tampon pur. Parallèlement, on réalise des solutions de matrices modèles
(blancs) auxquelles la purification est appliquée. Puis les analytes et étalons y sont ajoutés, avant
analyse MS. Pour la même concentration d’analytes dans les solutions références ou modèles, le
CV de la concentration mesurée après analyse doit être inférieur à 20 %. Généralement,
l’utilisation d’étalon interne est très efficace pour la suppression des effets de matrice.
▪ Stabilité. Il est également très intéressant de s’assurer de la stabilité des analytes, surtout
après leur préparation mais avant leur analyse. Si des échantillons sont préparés et stockés
plusieurs heures dans l’échantillonneur automatique (autosampler), avant leur analyse, il faut
s’assurer que ce stockage n’impacte pas la concentration mesurée. Généralement, les mesures de
stabilité sont réalisées pour des stockages dans l’échantillonneur (quelques heures), à 4 °C
(plusieurs jours), et pour des cycles de congélation/décongélation. Le CV est calculé entre des
solutions ayant subi ces stockages et d’autres fraîchement préparées.
▪ Sensibilité. Elle permet de déterminer la concentration minimale que la méthode

analytique permet de quantifier sans ambiguïté. Il existe plusieurs stratégies pour déterminer la
LLOQ (Low Limit Of Quantification) d’une méthode. La plus simple à mettre en œuvre consiste à
calculer la concentration pour laquelle le rapport entre le signal de l’analyte et le signal du bruit
est égal à 10.
▪ Sélectivité. La sélectivité d’une méthode analytique caractérise sa capacité à restreindre le

nombre de composés lors de l’analyse. Elle se distingue subtilement de la spécificité de la méthode,
caractérisant plutôt la capacité de la méthode à mettre en évidence une espèce précise. La
sélectivité est déterminée par l’utilisation de blancs, consistant en de la matrice pure modèle
- 74 -
(exempte des mAbs à quantifier) issue de lots différents, à laquelle la méthode analytique est
appliquée. Les ions du mAb (m/z) sont extraits et caractérisés. Il faut que le signal soit à 15 %
inférieur à celui de l’analyte quand il est présent à la concentration correspondant à la LOQ.
Figure 3.3. Principaux critères d’une validation de méthode quantitative.
- 75 -
C ONCLUSION
Les traitements par agents mAbs anti-TNF-α restent les plus prescrits par les médecins, car
les plus efficaces. Il persiste tout de même une nécessité à mieux comprendre le devenir de ces
traitements après administration aux patients, afin de mieux appréhender leurs réponses cliniques,
et ainsi adapter leur suivi. Cela met en évidence le besoin de développer des méthodes analytiques
permettant de suivre des informations importantes de ces traitements post-administration. Il faut
être en mesure de quantifier ces anticorps, d’évaluer leurs activités biologiques, l’évolution de
leur structure, et de définir si le patient présente une perte de réponse, une immunogénicité ou
encore des symptômes caractéristiques d’effets indésirables.
La quantification d’anticorps dans les matrices biologiques présente de réels défis pour les
chimistes. Les analyses quantitatives mises en place doivent être développées méthodiquement, en
prenant en compte les réglementations en vigueur ainsi que les attentes de l’analyse. Comme
présenté dans ce chapitre 3, il est nécessaire de suivre la concentration de mAbs thérapeutiques et
immunogènes lors d’un suivi clinique de patients. Étant donné que les décisions cliniques (dosage,
changement de traitement) sont essentiellement basées sur ces suivis quantitatifs, il est primordial
de garantir leur fiabilité. Aussi, il est important de tout mettre en œuvre pour limiter les biais (pertes
associées au traitement de l’échantillon, effets de matrices, principe de la mesure). Par ailleurs, il
apparaît important de développer des méthodes analytiques permettant la caractérisation
structurale de mAbs après administration, et de corréler ces propriétés qualitatives du traitement
aux informations quantitatives.
Certaines erreurs de diagnostic peuvent découler de l’utilisation de multiples méthodes

analytiques pour analyser un même échantillon. Les méthodes permettant d'obtenir
simultanément plusieurs informations à partir d'une seule analyse présentent donc un intérêt
considérable, non seulement pour leur facilité de mise en œuvre, mais également pour des raisons
économiques. L’analyse par spectrométrie de masse est particulièrement appropriée au suivi
simultané de plusieurs ions caractéristiques de différents analytes et a été largement implémentée
pour la quantification de protéines dans des matrices biologiques. De plus, le chapitre 2 de ce
manuscrit, consacré à la présentation du couplage CE-MS/MS, a démontré sa pertinence pour la
caractérisation structurale d’anticorps monoclonaux. Ainsi, au cours de ce projet de doctorat,
nous avons cherché à mettre à profit cette capacité, pour obtenir simultanément plusieurs
informations d’un traitement thérapeutique, l’infliximab, à partir d’une matrice biologique.
- 76 -
Partie II – Mise en place de la méthode CE-MS/MS
Chapitre 4 – Sélection des peptides
PARTIE II : MISE EN PLACE DE LA METHODE

ANALYTIQUE
- 77 -
- 78 -
Il faut savoir que les méthodes « multi-attributs » (Multiple Attribute Monotoring – MAM)
sont apparues récemment et sont basées sur des flux analytiques de pointe, pour suivre plusieurs
CQA de biothérapies en une seule analyse. Jusqu’à récemment, les CQA étaient contrôlés à l’aide
d’un panel de techniques analytiques orthogonales, comprenant des approches
chromatographiques, biophysiques, et de MS. Les méthodes MAM sont apparues surtout dans une
approche dite de Quality by Design (QbD) pour les entreprises pharmaceutiques. Elles permettent
de suivre simultanément plusieurs critères comme les glycosylations, les déamidations, les
oxydations (etc.) des mAbs développés. Elles sont essentiellement basées sur des plateformes LC-
MS, au vu de la robustesse de la chromatographie liquide et de la capacité de la MS à suivre
plusieurs analytes simultanément. Des études ont évalué ces approches MAM appliquées à des
mAbs et ont souligné leurs avantages [185,186].
Un aspect pour le moment en cours d’exploration est l’application de ces méthodes de
caractérisation aux mAbs après leur administration aux patients. Le suivi in vivo de plusieurs CQA
permettrait de mieux comprendre le devenir de ces biomolécules dans l’organisme des patients.
L’objectif de ce projet de doctorat fut d’implémenter le couplage CE-MS/MS pour la
quantification et la caractérisation de plusieurs PTM d’un mAb en matrice biologique.
Bien que la quantification d’anticorps monoclonaux par LC-MS ait été largement décrite
dans la littérature [187,188], le couplage CE-MS n’a pas encore été utilisé à ces fins, à notre
connaissance. Néanmoins, certaines études ont pu appliquer ce couplage à la quantification de
peptides [189] ou d’autres protéines [190].
Concernant la caractérisation des mAbs, comme présenté dans la partie introductive de ce
manuscrit, il existe plusieurs approches MS. Au laboratoire LSMIS, l’approche bottom-up, centrée
sur l’analyse de peptides, fut la première à être développée sur le couplage CE-ESI-MS,
notamment afin de réaliser la caractérisation fine de la structure primaire de mAbs [140]. Les
approches middle-up et intact ont aussi pu être expérimentées sur ce même couplage, et ont montré
une séparation partielle des variants de charge et la caractérisation de certaines PTM [157]. Parmi
elles, il a été possible d’identifier des N-glycosylations, et même quelques déamidations.
Cependant, ces déamidations, ne modifiant la masse que de 1 Da, sont difficiles à identifier lors
de l’analyse en niveau middle-up (25 kDa) ou intact (150 kDa) à cause d’une résolution et précision
de masse du QTOF limitées. De plus, la localisation précise des déamidations sur la chaîne
peptidique nécessite la fragmentation des précurseurs. Or, la CID n’est pas adaptée à la
fragmentation de protéines entières.
Ainsi, la stratégie bottom-up, reconnue pour la quantification de protéines, a également pu
prouver sa capacité à identifier et caractériser des PTM d’anticorps monoclonaux. Dans le cadre
de ce projet, une stratégie analytique par CE-ESI-MS/MS, basée sur une approche peptide-centrée,
- 79 -
a été développée afin de quantifier l’infliximab issu d’une matrice biologique et de simultanément
identifier ses PTM. L’approche globale implémentée est présentée Figure 4.1.
a
partir de peptides
signatures
Collection de Ajout de Separation Analyse des
Puri ication Digestion
serum contenant l etalon des peptides peptides en
des mAbs des mAbs
l in liximab interne en CE MS
d autres peptides
Temps (min)
Figure 4.1. Méthodologie schématisée de l’approche de quantification et caractérisation structurale de l’infliximab mise en place.
En raison de la complexité de la matrice et de la sensibilité nécessaire aux deux objectifs,

de l’ordre du µg.mL-1, le développement de ce type d’analyse nécessite une attention particulière
pour l’ensemble des étapes de la Figure 4.1. Ainsi, la partie II de ce manuscrit vise à présenter les
développements et optimisations réalisés pour l’établissement de la méthode analytique CE-
MS/MS à ces fins. Les étapes présentées sur la Figure 4.1 ont été considérées au cours de cette
partie II qui est divisée en 4 chapitres :
• Le chapitre 4 présente tout d’abord l’étalon interne choisi, permettant la quantification absolue
de l’infliximab dans du sérum de patient. Puis, est présentée la sélection des peptides signatures
tryptiques de l’infliximab, dont le suivi des ions m/z en MS mène à sa quantification. Enfin,
les sites de PTM également suivis lors de l’analyse CE-MS/MS sont proposés ;
• Dans le chapitre 5 est décrit le développement de la méthode de purification, afin d’extraire
spécifiquement l’infliximab et son étalon interne de la matrice biologique. Trois grandes
méthodologies ont été considérées, et leurs apports en termes de facilité de mise en œuvre, de
rendement et de caractérisation des sites de PTM choisis, sont comparés ;
• Le 6eme chapitre présente ensuite les conditions de l’analyse CE-MS/MS du digest peptidique
de l’infliximab et de l’étalon interne. En particulier, les conditions de séparations
électrophorétiques ont été brièvement optimisées par un plan d’expérience afin de sélectionner
celles apportant à la fois une meilleure efficacité de pics mais aussi une résolution optimale de
certains composés. Puis, les conditions de l’analyse MS sont décrites ;
• Enfin, une stratégie permettant de quantifier les PTM apparues seulement après administration
du traitement monoclonal au patient, a été implémentée et est décrite dans le chapitre 7. Ce
chapitre a mis en évidence des PTM artificielles induites par la préparation d’échantillon, qui
ont alors été normalisées afin de ne plus les considérer.
- 80 -
C HAPITRE 4.
S ELECTION DES PEPTIDES À SUIVRE
Préambule
Conformément au schéma de la Figure 4.1, l’approche analytique adoptée implique la séparation
électrophorétique du digest peptidique de l’infliximab et de l’étalon interne. Par suite, ces peptides
sont ionisés en ESI, analysés en MS et, si une fragmentation s’effectue sur ces peptides, le spectre
MS/MS résultant de ces fragments peut être obtenu. Dans le cadre de ces travaux de doctorat, il
s’agit du TTOF 5600®, un spectromètre type QTOF, qui a été utilisé. Il permet l’acquisition MS
et tandem MS/MS des ions issus de l’ESI à son entrée. Pour la séparation électrophorétique, il
s’agit de l’instrument CESI 8000® qui a été utilisé, permettant son couplage sheathless à la MS.
Les deux objectifs de l’analyse sont la quantification d’infliximab et la caractérisation de certaines

de ses PTM. Par conséquent, l'ensemble des acquisitions en MS et en MS/MS obtenues au cours
de chaque analyse doit mener à l’obtention de ces informations. Il a été choisi de réaliser les
acquisitions MS par stratégie DDA. Cela permet d’assurer une acquisition de tous les peptides
issus du digest. Parmi ces peptides, il a alors fallu choisir ceux destinés à la quantification de
l’anticorps, ainsi que les peptides indiquant des modifications post-traductionnelles. Puis, à partir
des signaux MS de ces peptides, il sera possible d’optimiser certaines étapes cruciales de la
préparation d’échantillon pour améliorer la sensibilité de l’analyse.
4.1. Quantification absolue : Sélection de l’étalon interne et

des peptides signatures
4.1.1. Sélection de l’étalon interne
L’utilisation d’un étalon interne, ajouté en concentration connue dans la matrice sérique de départ,
permet de remonter à la concentration de l’analyte et corrige les pertes des étapes de préparation
d’échantillon et d’analyse. Pour la quantification de l’infliximab, le standard interne choisi a
consisté en de l’infliximab sous forme intacte dont les lysines et arginines sont marquées par des
isotopes stables lourds de carbone 13C et d’azote 14N. Ce standard est appelé SIL-IFX (Stable
Isotope Labeled-infliximab). Il s’agit d’un SILuTMMAb de l’infliximab commercialisé par Sigma.
Cet étalon est ajouté à la matrice sérique avant la purification. Chaque peptide du SIL-IFX obtenu
par digestion tryptique (digestion choisie dans le cadre de ce projet), mènera à une différence de
- 81 -
masse par rapport à son homologue léger issu de l’infliximab de +8 Da (si lysine en N-terminal)
ou +10 Da (si arginine en N-terminal).
4.1.2. Sélection des peptides signatures
La quantification d’infliximab (IFX) par stratégie peptide-centrée bottom-up implique l’utilisation

du signal MS d’un peptide, qui sera proportionnel à la quantité de l’anticorps dont il est issu. La
digestion tryptique fut choisie dans le cadre de ce projet doctoral, menant à l’hydrolyse des liaisons
après les arginines et lysines constituant l’infliximab. Cette digestion résulte en l’obtention de 62
peptides de l’infliximab, présentés et nommés en Annexe 1. Parmi ces peptides, il a fallu
sélectionner ceux à suivre pour déterminer la concentration d’infliximab. Pour que la méthode de
quantification soit la plus spécifique possible, il est nécessaire de sélectionner des peptides
signatures de l’infliximab dits protéotypiques.
L’infliximab étant un mAb chimérique, il possède une partie constante commune à d’autres
IgG naturellement présentes dans le sang. Il n’est pas exclu, au vu de la concentration élevée de
ces autres protéines par rapport aux quelques µg·mL-1 de l’infliximab, qu’il subsiste des
interférents de ces IgG1 après purification de la matrice biologique, dont certains peptides
présenteront des homologies de séquences. Ainsi, les peptides protéotypiques se trouvent sur sa
partie variable, issue de séquences murines. D’autres critères ont été pris en compte lors de cette
sélection de peptides, notamment un nombre d’acides aminés supérieur à 6, et la vérification
qu’aucun de ces acides aminés ne sont prompts à subir des PTM. En effet, cela entraînerait une
différence de migration en CE et/ou de m/z en MS du peptide.
Cette pré-sélection a résulté en l’obtention de 4 peptides candidats de l’infliximab (HC05,

HC12, LC01 et LC03, présentés en Annexe 1). Afin de vérifier que ces peptides soient spécifiques
à l’infliximab, une recherche blast a été réalisée, permettant le criblage complet sur la base de
données Uniprot. Puis, la sélection a été de nouveau affinée en prenant en compte l’intensité du
signal observé pour chacun des 4 peptides, dépendante de leur efficacité de digestion et
d’ionisation. Dans le cadre d’une quantification, il est nécessaire de suivre deux peptides, l’un pour
établir la concentration de l’échantillon inconnu (Quantifier) et un autre pour vérifier cette valeur
(Qualifier). Pour que la méthode soit la plus sensible possible, les deux peptides présentant la plus
grande intensité de signal après digestion du produit infliximab formulé, et analyse CE-MS/MS,
furent choisis et sont présentés dans la Table 4.1.
Dans la suite de ce manuscrit, les valeurs indiquées de concentration d’infliximab obtenues

par CE-MS, les limites de quantification des différents protocoles, ou encore les efficacités de pics
- 82 -
proviennent du peptide LC01, le Quantifier. Cependant, l’analyse du HC12 a systématiquement

été réalisée, afin de contrôler nos observations. Le SIL-IFX étant digéré et analysé en même temps
que l’infliximab, ses peptides peuvent être suivis simultanément. Il est possible de suivre les
signaux correspondants aux peptides LC01 et HC12 du SIL-IFX, présentant un incrément de 10
Da par rapport à ceux de l’infliximab (Table 4.1). La notation avec un astérisque (*) a été utilisée
pour distinguer le SIL-IFX de l’IFX.
Table 4.1. Peptides choisis pour le suivi quantitatif de l’infliximab dans le sérum humain. Ions m/z des peptides chargés
deux et trois fois en ESI
Utilisé en m/z pour m/z pour
mAb Peptide Nom
tant que [M+2H]2+ [M+3H]3+
Infliximab DILLTQSPAILSVSPGER IFXLC01 Quantifier 948,525 632,686
(IFX) TEDTGVYYCSR IFXHC12 Qualifier 647.275 431.852
DILLTQSPAILSVSPGER* IFX*LC01 Etalon 953,525 636,019
SIL-IFX
TEDTGVYYCSR* IFX*HC12 Etalon 652.275 435.185
4.2. Caractérisation structurale : Sélection des sites de PTM

Conjointement à la quantification de l’anticorps, la méthode analytique cherche à caractériser,
identifier et estimer le taux de modification de certains sites de PTM de l’infliximab. Le couplage
CE-MS/MS peut être utilisé à ces fins, si tant est que plusieurs aspects soient respectés :
• Le recouvrement de séquence doit permettre de détecter convenablement les peptides ;
• Si la PTM induit une faible différence de masse (Δm < 2 Da), le profil isotopique du peptide
comportant cette PTM aura un recouvrement avec celui du peptide non modifié. Il faut alors que
la technique de séparation en amont de la MS soit capable de séparer les deux formes peptidiques
afin de les distinguer. Cet aspect concerne donc particulièrement les deaN ou isoD, notamment
lorsqu’ils sont fragmentés en CID (d’autres techniques de fragmentation comme l’ETD (Electron
Transfert Dissociation) ont permis de distinguer des isoD [191]) ;
• Les signaux MS du peptide précurseur et de son homologue avec une PTM doivent être
suffisamment intenses pour les distinguer du bruit de fond. Les PTM étant généralement de faible
abondance, il faut alors une bonne sensibilité de la méthode pour les distinguer. De manière à
s’assurer de la quantification relative de certaines PTM, il a fallu les identifier par MS et MS/MS,
ce qui nécessite un signal MS de l’ion précurseur suffisant pour une stratégie Top20 DDA (> 104).
L’analyse CE-MS/MS d’un digest peptidique de l’infliximab en formulation, a pu être établie selon
l’approche développée précédemment dans notre groupe [140]. Le logiciel Biotools® identifie
80 % de recouvrement de séquence en MS et 76 % en MS/MS pour de l’infliximab à 25 µg·mL-1.
Les 20 % non observables sont dus à des peptides obtenus par digestion tryptique particulièrement
- 83 -
gros, dont l’ionisation est difficile et dont les m/z dépassent les limites du quadripôle. Parmi ces
peptides, on retrouve un peptide de 46 acides aminés localisé sur la chaîne légère de l’anticorps
(LC07) et un autre peptide composé de 58 acides aminés situé sur la chaîne lourde (HC16), dont
le suivi des PTM ne peut pas être effectué.
Parmi les autres peptides de l’infliximab, nous avons sélectionné ceux présentant différents
sites propices aux PTM. Il s’agit d’oxydations de méthionine (oxiM), de déamidations
d’asparagines (deaN), d’isomérisations d’acides aspartiques (isoD) et de la N-glycosylation
d’infliximab. Ces quatre types de modifications sont connus pour se produire lors de la production
ou du stockage des anticorps thérapeutiques. Des études ont également montré qu’elles peuvent
être responsables d’un changement de l’activité biologique de l’anticorps.
Concernant le choix de la localisation de ces PTM, c’est-à-dire les acides aminés étudiés,
il s’est porté sur les acides aminés définis comme étant des hotspots, rapportés dans la littérature
[192]. Les hotspots sont définis au vu de leur fréquence d’apparition ou de leur localisation. Les
principaux hotspots de l’infliximab suivis dans le cadre de ce projet sont présentés sur la Figure
4.2. Certains sont situés sur sa partie variable, qui est sollicitée lors d’une interaction antigène-
anticorps, avec notamment l’asparagine N57 se trouvant dans la région CDR. D’autres sites suivis,
tels que N300, D283 et M255, se situent sur la partie Fc au niveau de la jonction CH2-CH3, requise
lors de la reconnaissance du mAb à divers récepteurs (FcRn, FcγRs).
À noter que les localisations des hotspots de l’infliximab sont connues. Par exemple, il est
établi que c’est l’asparagine N300 qui porte la glycosylation du mAb. L’objectif ne fut pas de
localiser les sites de PTM de l’anticorps, mais de quantifier leur proportion. Il a donc fallu dans un
premier temps assurer la capacité de la méthode analytique à identifier et quantifier la proportion
de certaines PTM de l’infliximab, connues pour présenter un niveau significatif (> 1 %). Pisupati
et al.(2017) [193] ont décrit des niveaux de modifications de certaines oxiM et deaN hotspots,
après analyse LC-MS/MS de l’infliximab pur (dans sa formulation) directement digéré sans stress
préalable, dont les valeurs sont présentées sur la Figure 4.2.
Le défi analytique de la méthode CE-MS/MS mise en place est notamment la caractérisation de

différents acides aminés simultanément (en une seule analyse). Les méthodes analytiques menant
à plusieurs informations conjointement permettent de limiter les erreurs associées aux
manipulations successives. Ainsi, les corrélations entre plusieurs informations sont d’autant plus
fiables si elles sont obtenues après une seule même préparation. En particulier, l’étude des PTM,
peut s’avérer difficile au vu des réactions spontanées pouvant se produire lors de la manipulation
- 84 -
d’échantillon, de son stockage, ou de son analyse. Par conséquent, si plusieurs PTM doivent être
suivies et comparées, il est préférable de sélectionner une stratégie analytique permettant leur
caractérisation simultanée. C’est pour cette raison que l’électrophorèse capillaire a été choisie en
tant que technique séparative, puisqu’elle repose sur une séparation dépendante de la charge et du
rayon hydrodynamique. Ainsi, les PTM induisant des différences de charges, telle que la deaN, et
celles entraînant un changement conformationnel (glycosylations, isoD), peuvent être séparées par
cette stratégie. De plus, le couplage MS permet d’ajouter une autre dimension à la discrimination
des espèces : leur masse. Cela est bénéfique pour les oxiM et les glycans que l’on cherche à
identifier ne se séparant que partiellement en CE. Les peptides issus du SIL-IFX, pourront être
identifiés par cette dimension massique, et non confondus à ceux de l’infliximab.
Figure 4.2. Représentation schématique de l’infliximab et localisation des hotspots sélectionnés pour le suivi structural de
l’infliximab post-administration. Les % représentés à côté de certains acides aminés, correspondent aux proportions de PTM
observées par Pisupati et al. (2017) de l’infliximab pur [193]. La localisation sur les peptides tryptiques des acides aminés suivis
est présentée à droite.
- 85 -
- 86 -
Chapitre 5 – Développement de la méthode de purification
C HAPITRE 5.
D EVELOPPEMENT DE LA METHODE DE PURIFICATION
Préambule
Les précédents travaux réalisés au laboratoire LSMIS ont établi des protocoles de digestion
tryptique et d’analyse CE-MS/MS d’anticorps monoclonaux purs, préparés dans leur formulation,
pour leur caractérisation structurale (étude de niveau de certaines PTM). Ces travaux ont démontré
la capacité de l’analyse CE-MS/MS pour la caractérisation de multiples PTM simultanément.
Dans le cadre de ces travaux de thèse, il a été nécessaire d’établir un protocole d’extraction de
l’infliximab de la matrice sérique, afin de se placer dans des conditions de digest peptidique purifié
des autres protéines plasmatiques. Cette extraction sérique est basée sur une purification par
affinité, utilisant des billes ferromagnétiques fonctionnalisées avec l’antigène de l’infliximab, le
TNF-α. Ce chapitre présente les différents protocoles ayant été considérés pour la mise en œuvre
de cette purification. Les critères d’une purification adéquate se sont basés sur les objectifs de la
méthode analytique, à savoir :
▪ La limite de quantification obtenue (LOQ). Cette valeur, dépendante de la sensibilité de

la méthode analytique, fut comparée selon les différentes approches afin de proposer une stratégie
quantitative qui soit compétitive avec les méthodes ELISA existantes. Nous avons cherché à
maintenir une LOQ égale ou inférieure à 0,5 µg·mL-1. Cet aspect a été évalué par suivi des ions
m/z des peptides signatures de la quantification de l’infliximab.
▪ Le deuxième critère qui a été considéré est l’influence du protocole de purification sur la
détermination de certaines PTM. Les PTM pouvant être présentes en très faible abondance, il a
fallu limiter les interférents pouvant impacter leur détection. En outre, la CE est une méthode
séparative extrêmement dépendante de la force ionique de l’échantillon injecté. Ainsi, les effets de
matrice peuvent limiter la séparation des analytes. La résolution des PTM de faibles différences
de masse avec leur homologue non modifié a donc été déterminée selon les protocoles envisagés.
Il s’agit essentiellement des peptides présentant une deaN, isoD ou oxiM, décrits dans le chapitre
4, qui ont permis de positionner les approches de purification sur la caractérisation des PTM de
l’infliximab.
Les travaux de ce chapitre font l’objet d’un article en anglais en cours de finalisation. Cet article
présente donc la mise en place d’un protocole d’extraction, suivi d’une digestion tryptique et d’une
analyse CE-MS/MS. Ce protocole de purification-digestion-analyse a par la suite été implémenté
tout au long des travaux de cette thèse.
- 87 -
Enhancing affinity purification of monoclonal antibodies from human

serum for subsequent CE-MS analysis
Tessa Reinert, Pascal Houzé, Yannis-Nicolas Francois, Rabah Gahoual
Publication in preparation
Abstract :
Due to the separation technique employed, capillary electrophoresis coupled to mass spectrometry (CE-
MS) analysis performances are significantly influenced by the chemical composition and the complexity of
the sample. In various applications, that impact has prevented the use of CE-MS for the characterization
and quantification of proteins in biological samples. Here we present the development and evaluation and
a sample preparation procedure, based on affinity purification, for the specific extraction of the monoclonal
antibody (mAbs) infliximab from human serum in order to perform subsequent proteolytic digestion and
CE-MS/MS analysis. Three distinctive sample preparation strategies were envisaged. In each case, the
different steps composing the protocol were thoroughly optimized and evaluated in order to provide a
sample preparation addressing the important complexity of serums samples while providing an optimal
compatibility with CE-MS/MS analysis. The different sample preparation strategies were assessed
concerning the possibility to achieve an appropriate absolute quantification of the mAbs using CE-MS/MS
for samples mimicking patient serum samples. Also, the possibility to perform the characterization of
several types of post-translational modifications (PTMs) was evaluated. The sample preparation protocols
allowed the quantification of the mAbs in serums samples for concentration as low as 0.2 µg·mL-1 (2.03
nM) using CE-MS/MS analysis, also the possibility to characterize and estimate the modification level of
PTMs hotspots in a consistent manner. Results allowed to attribute the effect on the electrophoretic
separation of the different steps composing sample preparation. Finally, they demonstrated that sample
preparation for CE-MS/MS analysis could benefit greatly for the extended applicability of this type of
analysis for complex biological matrices.
5.1. Introduction
Since their introduction in the late 1980s, monoclonal antibodies (mAbs) have experienced
increasing success in the treatment of various diseases, leading to their advent in the mid-2000s
[99,194]. The appeal of therapeutic mAbs can be explained by their favorable pharmacokinetic
and pharmacodynamic properties. In addition, their ability to target a specific epitope
corresponding to the antigen represents a crucial asset for the development of this type of
biomolecule for therapeutic application. Last year alone, 12 mAb-based therapeutics were
approved, and 140 are currently in clinical trials, including several for the treatment of SARS-
CoV-2 [97,98,195]. Because of their structural complexity and use as biopharmaceuticals, mAbs
have required the development of dedicated analytical methods to provide a comprehensive
structural characterization of the product. However, almost all analytical developments described
in the literature have focused on the characterization of mAbs in the context of their production,
- 88 -
whereas methods for the analysis of mAbs in biological samples remain scarce [196,197].
Therefore, it appears essential to develop novel analytical strategies to study the outcomes of mAb
after administration to patients. Bottom-up peptide-centric analysis represents a relevant
methodology that offers the possibility of using mass spectrometry (MS) to obtain quantification
in addition to the characterization of protein primary structure, including post-translational
modifications (PTM) [116,130,198].
Currently, almost all mAb products are administered by parenteral injection into the patient’s
bloodstream; therefore, mAbs are present in the serum. Human serum represents an extremely
complex matrix composed of a wide variety of proteins, such as albumin and immunoglobulin
(IgG) [199]. The presence of a large number of proteins can interfere with the mass spectrometry
(MS) analysis of mAbs, particularly because of the large difference in concentration between
serum proteins and administered mAbs. Consequently, the analysis of a specific protein present in
a biological sample requires proper sample preparation to remove other proteins and salts that
would otherwise hamper MS analysis. Sample purification can improve the reproducibility of the
method and significantly reduce interferences to increase sensitivity, particularly by removing
albumin, which accounts for approximately 50 % of the total serum protein [200]. Various
purification techniques, such as pellet digestion or protein precipitation, can be used to remove
albumin from serum samples. However, their lack of specificity is a limitation for mAb isolation,
as a large fraction of serum proteins are IgG. An alternative method to enhance the specificity of
sample preparation is affinity purification [201]. This type of extraction is emerging for mAb
analysis, but its implementation requires a particularly demanding setup and optimization [175,202].
Capillary zone electrophoresis hyphenated to tandem mass spectrometry (CZE-MS/MS) has been
shown to be particularly suitable for the separation and characterization of peptide mixtures
[141,154]. Indeed, the electrokinetic separation provided by CZE allows the separation of a large
number of peptides in the same experiment based on their chemical nature. In addition, the
mobility mechanism of CZE enabled baseline separation of peptides exhibiting faint PTM from
their unmodified counterparts. For instance, the systematic separation of modified peptides
carrying asparagine deamidation and/or aspartate isomerization could be demonstrated regardless
of the peptide sequence, even though they imply a mass shift of + 0.98 Da and no mass difference,
respectively. This feature is a powerful asset of CE, as a lack of separation prior to MS analysis
would result in overlapping isotopic profiles of peptides, preventing clear identification [21]. The
diversification of CE-MS applications has also been supported by technical improvements in
coupling interfaces, which have enhanced sensitivity [203–205]. As a result, CZE-MS has been
found to be particularly relevant for the characterization of biomolecules [108,139,206]. CE
separation is particularly sensitive to sample composition due to the limited capillary volume
- 89 -
available and the phenomenon of electrophoresis. Samples may exhibit significant electrical
conductivities relative to the background electrolyte (BGE) due to the presence of high
concentrations of salts and/or organic solvents. Therefore, the sample composition can disrupt the
homogeneity of the electric field, resulting in reduced separation efficiency and compromised
reproducibility. To characterize and quantify mAbs in biological samples using CZE-MS/MS, it
is necessary to develop a sample preparation method that allows relevant affinity extraction and
purification of proteins to ensure optimal compatibility with CZE electrophoretic separation.
In the present work, we describe the development of a selective purification method adapted for
the analysis of the active fraction of infliximab (IFX) in human serum using CZE-MS/MS analysis.
IFX is a chimeric mAb targeting tumor necrosis factor (TNF-α), which is used as a therapeutic
treatment mainly for Crohn’s disease and rheumatoid arthritis [207,208]. The affinity purification
of IFX was based on the implementation of ferromagnetic beads incorporating immobilized TNF-
α, which were prepared in-house. Consequently, isolated IFX was released and subjected to trypsin
digestion, followed by bottom-up analysis using CE-MS instrumentation. Different strategies were
compared regarding IFX release from functionalized beads and buffer exchange to perform
proteolytic digestion and CZE separation. The sequential steps of the different sample preparation
protocols were systematically investigated to determine their impact on the extraction yield, IFX
recovery, and the ability to maintain optimal efficiency of CZE separation.
5.2. Materials and methods

▪ Chemicals. The chemicals used were of high-purity grade and purchased from Merck
Sigma-Aldrich (Saint Louis, MO, USA) unless stated otherwise. The water used to prepare the
buffers and sample solutions was obtained using an ELGA Purelab UHQ PS water purification
system (Bucks, UK). Infliximab (IFX) samples were EMA/FDA-approved formulations
(Remicade®) purchased from the manufacturer (Merck Sharp and Dohme). Stable-isotope-labeled
infliximab (SIL-IFX) internal standard was purchased from Sigma-Aldrich (St. Louis, MO, USA).
RapiGest SF surfactant was purchased from Waters (Milford, MA). Streptavidin M-280
DynabeadsTM were obtained from Fisher Scientific Invitrogen (Carlsbad, CA) and biotinylated
TNF-α from Biotechne (Rennes, France). Sequencing grade modified Trypsin was purchased from
Promega (Madison, WI, USA). (PBS) tablets used for reconstitution in water were purchased from
Gibco Fisher. Blank sera extracted and purified from the total blood were provided by the French
Institution of Blood (Paris, France).
- 90 -
▪ Reference and serum samples. IFX stock solutions at a concentration of 1 g·L-1 were
prepared after reconstitution in Milli-Q H2O and directly stored at -20°C until use. Two kinds of
samples were prepared : IFX spiked references samples and IFX spiked serum standard.
The reference samples were prepared by introducing IFX stock solution to ammonium
bicarbonate buffer (50 mM, pH 8) to a final volume of 100 µL and concentration of 25 µg·mL-1.
The standard serum samples were prepared by introducing IFX stock solution to model
blank serum (initially free of IFX) to a final volume of 100 µL and concentration of 25 µg·mL-1.
▪ Affinity Purification of IFX from serum samples. The standard serum samples were
purified to specifically extract IFX. First, 217 µL of streptavidin M-280 DynabeadsTM (10
mg·mL-1) was incubated with biotinylated TNF-α (148 µL, 10 µg·mL-1 in PBS) at room
temperature for 1 hour. Excess biotinylated TNF-α was removed by three consecutive washing
steps using 500 µL PBS solution. Subsequently, the 100 µL standard serum sample were added to
the TNF-α-functionalized beads. The mixture was incubated at RT for 1 hour under mild agitation.
Then the serum was removed, and the magnetic beads were washed twice using 500 µL of PBS.
▪ IFX release from the magnetic beads and buffer exchange.

A. Acidic dissociation followed by membrane filtration
The citrate buffer (pH 3.0) was prepared by mixing 70 µL of sodium citrate dihydrate (C6H5Na3O7)
100 mM with 930 µL of citric acid (C₆H₈O₇) 109 mM. After washing with PBS, IFX captured on
the TNF-α magnetic beads were dissociated by the addition of 50 µL citrate buffer. The mixture
was left at RT for 10 min, and the supernatant was collected. Another 50 µL of citrate buffer was
added to the magnetic beads and incubated at RT for 10 min, followed by supernatant collection.
The supernatants were pooled, and the pH of the solution was neutralized by the addition of NaOH
1M. Consequently, buffer exchange was performed using an Amicon© centrifugal membrane filter
provided by Merck Millipore (Molsheim, France). The filter was conditioned with 50 mM
ammonium bicarbonate (pH 8.0). The sample was then subjected to 2 consecutive centrifugation
cycles. For each centrifugation cycle, the filter was filled with 50 mM ammonium bicarbonate,
and centrifugation was performed for 10 min using an Eppendorf 5424® centrifuge system.
Finally, the sample was collected in a new tube and adjusted to a final volume of 70 µL using the
ammonium bicarbonate buffer.
B. Organic solvent dissociation followed by evaporation

IFX dissociation from TNF-α magnetic beads was alternatively achieved by addition of 50 µL of
MeOH/H2O/FA: 48.5/48.5/3 (v/v/v) solution to the sample, which was left at 20°C for 10 min.
The supernatant was collected, and the operation was repeated once. Both supernatants were then
- 91 -
pooled and dried for 2h using a miVac DNA concentrator system (Genevac, NY, USA) at a
temperature of 35°C. The samples were finally reconstituted with 70 µL of 50 mM ammonium
bicarbonate.
▪ Proteolytic digestion of the IgG samples. The IFX samples (references or after
purification of serums) are all in ammonium bicarbonate 50 mM, pH 8. Prior to sample digestion,
4 µL of SIL-IFX stock solution at a concentration of 0.25 µg·µL-1 was added to all IFX samples.
Proteolytic digestion of IFX and SIL-IFX obtained by affinity purification from serum
samples was achieved following a workflow derived from a commonly used protocol for the
digestion of mAbs in solution into peptides [119]. Briefly, mAbs were denatured using 5 µL of
RapiGest SFTM 0.1% and incubated at 80°C for 10 min. After cooling to RT (Room Temperature),
10 µL of 50 mM dithiothreitol were added to the mixture, and the sample was incubated at 80°C
for 20 min. Then, 10 µL of 50 mM iodoacetamide was added, and the sample was incubated at RT
in the dark for 20 min. 1 µL of trypsin at 0.25 µg·µL-1 was added to the sample and left at RT for
2h. Trypsin (1 µL) was again added, and the sample was incubated at 37°C overnight. Next, 1 µL
FA (98 %) was added. The peptide digests were dried. Finally, the sample was reconstituted in 5
µL 100 mM ammonium acetate at pH4.
▪ Capillary zone electrophoresis – tandem mass spectrometry for peptide analysis.

Analysis of the IFX peptide digests was performed on a CESI8000® Capillary Electrophoresis
system (Sciex separations, Darmstadt, Germany) coupled by the intermediate of a sheathless CE-
ESI-MS interface to a Sciex TripleTOF 5600 mass spectrometer (Darmstadt, Germany) operated
by Analyst® software (Sciex, Darmstadt, Germany). The separation was performed using a
homemade bare-fused silica capillary (total length 100 cm; 30 μm i.d.) having a characteristic
porous tip of 2 cm on the outlet end positioned inside the ESI source, and a second capillary (total
length 80 cm; 50 μm i.d.) filled during the experiments with background electrolyte (BGE),
consisting of 10 % acetic acid to maintain electrical connectivity between CE electrodes. 68 nL of
peptide digest was injected hydrodynamically, and a 23 kV electric field was applied, leading
peptides to migrate toward the ESI source. ESI source parameters were set as follows: ESI voltage
-1.5 kV while gas supplies (GS1 and GS2) were deactivated, source heating temperature 100 °C,
and curtain gas value 2. Experiments were performed in Top20 information-dependent acquisition
(IDA, Sciex), and accumulation time was 250 ms for MS scans and 100 ms for MS/MS scans,
leading to a total duty cycle of 1.9 s. The mass/charge (m/z) range was 100−2000 in MS and
50−2000 in MS/MS. Data were obtained as .wiff and the ratio of IFX over its internal standard
SIL-IFX was calculated using Skyline software developed by the University of Washington
(Seattle, WA, USA) [209].
- 92 -
▪ Parameters studied to assess eligible IFX purification.

A. Process Efficiency
The efficiency of the sample preparation workflow was estimated for each protocol using equation
(5.1). It corresponded to the complete recovery of IFX, from its extraction by affinity beads prior
to digestion (Figure 5.1). Briefly, the infliximab (IFX) mass spectrometry signal was monitored
by the intermediate of the peptide IFXLC01 (sequence DILLTQSPAILSVSPGER) which was
beforehand selected because it was specific to IFX and had the highest ionization efficiency. The
same peptide was considered for SIL-IFX, however, including (13C6; 15N4) labeling for the arginine
residue, and referred to as IFX*LC01. The m/z ions of the twice charged peptides (m/z : 948,525
for IFXLC01, and m/z : 953,525 for IFX*LC01) were monitored and systematically identified using
MS/MS spectra from the characterization of y and b-ions corresponding to CID fragmentation of
the peptide (Table 5.S1). The integration of these ions with time enabled us to define the ratio of
IFXLC01 over IFX*LC01. To estimate the process efficiency of a workflow, this ratio was
calculated for a serum standard sample and for a reference sample (no serum matrix).
̅̅̅̅̅̅̅̅̅̅̅̅̅̅̅̅̅̅̅̅̅
𝐴𝑟𝑒𝑎
(𝐴𝑟𝑒𝑎 IFX )
SIL−IFX serum
Process Efficiency (%) = 100 ̅̅̅̅̅̅̅̅̅̅̅̅̅̅̅̅̅̅̅̅̅̅̅̅
𝐴𝑟𝑒𝑎 IFX
(5.1)
(𝐴𝑟𝑒𝑎 )
SIL−IFX reference
Where Area IFX and Area SIL-IFX represent the peak areas corresponding to IFXLC01 and IFX*LC01.
Further considerations of the performance of individual steps of IFX purification were

performed by calculating the extraction recovery yield or filtration recovery yield (Figure 5.1).
rotocol
rotocol
Evaporation
Serum with Extraction with Dissociation CE MS/MS
Digestion analysis
infliximab the beads from the beads
xtraction rotocol
Filtration
recovery yield
iltration recovery yield
Process efficiency
Figure 5.1: Representation of the different parameters considered to evaluate the protocols of sample preparation prior CE-
MS/MS analysis of peptide digest of infliximab on the analytical workflow.
B. Limit of Detection and Quantification

The LOD and LOQ were calculated by monitoring the IFXLC01 peptide signal. The LOD and
LOQ were assessed when intensity of signal/noise (S/N) reached 3 and 10 respectively.
- 93 -
C. Electrophoretic resolution
The impact of the workflow on the electrophoretic separation was evaluated through the
determination of the resolution between unmodified peptides and the same ones presenting a
deamidation (deaN) or isomerization (isoD). The m/z ions of twice charged peptides with or
without a deaN or isoD were extracted and monitored. The resolution was calculated as follows
(𝑀𝑇2 −𝑀𝑇1 )
Resolution = ×2 (5.2)
𝜔1 +𝜔2
With MT1 and MT2 corresponding to the migration times of the unmodified peptide and modified
one, and 𝜔1 and 𝜔2 the width of their signals.
▪ Size exclusion chromatography – multi-angle light scattering analysis. Size exclusion

liquid chromatography analyses were performed using a Prominence HPLC system equipped with
a SIL-10A UV absorbance detector, a RID-20A refractive index detector (Shimadzu, Marne-la-
Vallée, France) and a miniDAWN Treos II multi-angle light scattering (MALS) detector acquired
from Wyatt Technology (Santa Barbara, USA). Two distinctive softwares were used to pilot the
SEC-UV-MALS-RI instrument: LC Solution (Shimadzu corporation) for the HPLC-UV-RI part
and Astra version v7.2 (Wyatt technology, Santa Barbara, USA) for the MALS detector. SEC
separations were realized using a Biozen SEC3 column (300×4.6 mm; 1.8 µm) provided by
Phenomenex (Le Pecq, France) using a mobile phase constituted of 50 mM phosphate buffer (pH
6.8) and 300 mM NaCl. Flow rate was 200 µL·min-1 and injection volume was 20 µL. UV
detection was performed at a wavelength of 280 nm. MALS detector was equipped with a 658 nm
laser, and measurements were performed simultaneously at 3 different angles (49°, 90° and 131°).
IFX at a concentration of 0.5 µg·µL-1 in H2O milliQ or in 50 mM citrate buffer was injected for
the analyses.
▪ Dynamic light scattering analysis. Dynamic light scattering (DLS) analysis was
performed on a Zetasizer (Malvern Panalytical, Malvern, UK), using 2 angles (13° and 173°)
monitored by the Zetasizer software. 400 µL of sample was analyzed. Measurements were realized
at a temperature of 25°C in triplicate. IFX at a concentration of 0.5 µg·µL-1 in H2O milli-Q or in
50 mM citrate buffer was injected for the analyses.
5.3. Results and discussion

The reported therapeutic range for IFX (infliximab) indicates that serum concentrations
after administration should fall within the range of 1 to 25 µg·mL-1. Affinity purification is
necessary to isolate low concentrations of IFX from a complex mixture composed of 1-5 mg·mL-1
- 94 -
of a wide variety of natural IgGs [210]. Consequently, a peptide-centric analytical strategy, derived
from bottom-up proteomic analysis, was adopted, as it maintains optimal sensitivity, especially
considering the low-level quantification targeted.
In addition, it allowed the simultaneous characterization of the primary structure of IFX

with respect to the occurrence of PTMs. Thus, tryptic digestion of purified IFX was performed as
the final sample preparation step prior to CE-MS/MS analysis. Different sample preparation
methods were applied to the preparation of IFX-spiked serum to evaluate the impact of various
approaches regarding MS signal intensity, signal-to-noise ratio, extraction yield, in addition to
PTM identification and modification level estimation. The goal was to determine the most
appropriate conditions to maximize the efficiency of the process to achieve optimal sensitivity
while maintaining the selectivity and efficiency of the electrophoretic separation. Concerning
asparagine deamidation (deaN) and aspartate isomerization (isoD), separation is mandatory for
adequate identification, as they will show isotopic overlap with their unmodified counterparts in
MS. Therefore, the peptide resolution was evaluated for each protocol. For analyte pre-
concentration in CE, the transient isotachophoresis mode was performed, using ammonium acetate
100 mM as the leading electrolyte and acetic acid as the background electrolyte (BGE) [143].
Under these conditions, the migration time of the peptides depends on the duration of the ITP,
which in turn depends on the conductivity difference between the two electrolytes. For the same
CE conditions (applied voltage, leading electrolyte, and injection volume), the resolution between
identical peptides should be similar. We evaluated whether the different sample preparation
methods proposed here slightly modified the ionic strength or conductivity of the sample, thus
affecting the resolution between the PTM.
To support the analysis of IFX in human serum by CE-MS/MS, different sample

preparation methods, shown in Figure 5.2, were investigated. In the workflow referred to as
protocol A, the extracted IFX was not released from the magnetic beads, and therefore proteolytic
digestion was performed in situ, while still immobilized on the affinity purification media. This
approach has the advantage of reducing the number of sequential sample preparation steps and of
easily placing the beads in a buffer compatible with digestion. In the other two workflows, IFX
was removed from the purification beads prior to digestion by acid dissociation followed by buffer
exchange through membrane filtration in the case of protocol B or by solvent evaporation for
protocol C (Figure 5.2). Release of extracted IFX from the beads could potentially facilitate trypsin
access to the mAbs, which could be beneficial for maximizing digestion yield. However, for both
protocols, the solutions used to dissociate the IFX-immobilized/TNF-α interaction had to be
removed because of their incompatibility with trypsin digestion.
- 95 -
S
Digestion
addition
Reference
AmBic with
Protocol « A »
IFX
Acid uffer
dissociation exchange
Protocol « B »
Amicon® filtration
Serum Addition of Serum PBS
with IFX TNF removal washing
Protocol « C »
beads
Evaporation
Legend
Serum Citrate buffer AmBic 50mM PBS MeOH/H2O/FA Infliximab SIL Infliximab
Figure 5.2. Sample preparation workflows considered for IFX quantification and characterization in serum using CE-MS/MS
analysis include direct digestion of IFX immobilized on beads (protocol A), acidic dissociation followed by centrifugal
membrane filtration (protocol B) or organic solvent dissociation and solvent evaporation (protocol C). The SIL-IFX internal
standard was added before digestion to provide CE-MS/MS signal normalization. Reference samples consisted of H2O solutions
spiked with IFX and SIL-IFX.
5.3.1. Direct digestion of mAbs immobilized on beads (Protocol A)

▪ Quantification
The IFX-spiked serums were subjected to affinity purification using TNF-α-functionalized
magnetic beads. Then the beads were transferred to ammonium bicarbonate for digestion (Figure
5.2). The process efficiency of this sample preparation procedure was determined at 62 ± 17 %
(see material and method).
CE-MS/MS data also allowed the estimation of a LOQ of 1.2 ± 0.6 µg·mL-1 and a LOD of
0.4 ± 0.2 µg·mL-1, using the thresholds of S/N >10 and 3, respectively (Table 5.1). Therefore, the
method should be acceptable for the quantification of IFX in most patient serum samples (typically
between 0.5-25 µg·mL-1).
- 96 -
Table 5.1. Comparison of the three strategies on their process efficiency, their repeatability, their detection, and
quantification limits, and their PTM visibility for spiked serum with Infliximab at (µg·mL-1).
Protocol A Protocol B Protocol C

Process efficiency 62 ± 17 % 19 ± 22 % 58 ± 24 %
LOD (µg·mL-1) 0.4 ± 0.2 0.8 ± 0.8 0.1 ± 0.02
LOQ (µg·mL-1) 1.2 ± 0.6 2.8 ± 2.5 0.2 ± 0.1
In addition, the recovery yield of bead-based IFX extraction from serum was evaluated by
quantifying residual IFX using a commercial ELISA assay. Indeed, the residual IFX in the post-
extraction "waste" was quantified after extraction in serum at different initial concentrations of
IFX (Figure 5.S1). The ELISA assays showed almost complete extraction of IFX from serum at
lower concentrations (> 95%). However, remaining IFX levels were significant for serums spiked
at 25 µg·mL-1, indicating a lower extraction yield at the highest level of concentration (80 ± 5 %).
The decrease in IFX extraction yield was attributed to the capacity of the TNF-α immobilized on
the ferromagnetic beads reaching its limit. Similar effects were observed for the other protocols
because the affinity extraction conditions were the same (Figure 5.2). This effect should not affect
the performance of the absolute quantification because of the incorporation of the SIL-IFX internal
standard and because the IFX concentration allows a satisfactory MS signal sensitivity at higher
concentrations.
▪ PTM characterization
CE-MS/MS data were investigated to characterize PTM hotspots concomitantly with IFX
quantification. The results demonstrated the possibility of using the developed analytical strategy
to characterize asparagine deamidation (deaN), methionine oxidation (oxiM), and aspartate
isomerization (isoD). As compiled in Table 5.2, the intensity of the MS signal corresponding to
the intact peptide and its modified counterpart can be used to independently determine the level of
modification for different PTMs. However, the analysis of IFX from protocol A resulted in a non-
systematic characterization of the PTM level for each replicate considered (Table 5.2). Figure 5.3
illustrates the electrophoretic separation observed for an IFX-specific peptide described to
potentially exhibit an asparagine modification (deaN57). Indeed, the asparagine located on the
amino acid sequence SINSATHYAESVK is normally deamidated at 10 % and is interesting to
monitor because of its CDR position [211]. For the reference product corresponding to IFX
submitted only to the digestion process (Figure 5.3, A), the electropherograms showed the good
separation of both peptide forms, highlighting the capacity of CZE conditions to achieve baseline
separation due to the presence of the modification. In contrast, in serum samples containing IFX
prepared using protocol A (Figure 5.3, B), the peptides showed partial co-migration with other
analytes presenting the same m/z. The presence of interfering compounds can induce ion
- 97 -
competition in the electrospray ionization source, preventing the detection of lowly abundant ions.
In addition, several PTMs were difficult to quantify after protocol A, due to a significant
background signal. Protocol A involved the proteolytic digestion realized directly on the
ferromagnetic beads (Figure 5.2). Therefore, digests not only contained peptides originating from
the mAb of interest, but also from TNF-α and streptavidin immobilized on the surface of the beads.
CZE-MS/MS electropherograms of samples obtained using protocol A showed 20 and 75-fold
greater signal intensities for peptides corresponding to TNF-α and streptavidin, respectively,
compared to the other protocols. Thus, this observation was also advocating for the existence of
ion competition effect, which significantly hinders CE-MS/MS analysis due to the sample
preparation protocol. Nevertheless, it is important to note for peptides that CE-MS/MS analysis
was not impacted by the presence of concomitant interferences, the modification levels obtained
were similar to the reference samples, emphasizing that the extraction protocol does not induce
artifactual PTMs.
Figure 5.3. Extracted Ion Electropherogram (EIE) of the m/z corresponding to peptide SINSATHYAESVK (m/z = 703.85; 2+)
for a. digestion of IFX marketed formulation without prior extraction (reference); b. direct digestion of IFX immobilized on beads
(protocol A)) and c. Extraction of IFX using H2O/MeOH dissociation and buffer exchange (protocol C) from spiked serum
samples.
The resolution between the peptide forms for deaN and isoD was investigated as an
indicator of separation efficiency (Table 5.2). Results showed that protocol A provided a resolution
systematically superior to 1.1 for the considered PTMs. However, high values of standard
deviations could be observed, which was explained by the poor repeatability of the transient
isotachophoresis (t-ITP) preconcentration step performed at the beginning of the CZE-MS/MS
analysis. The variability regarding t-ITP was the consequence of significant differences in ionic
strength among the replicates which impacted the conductivity of the leading electrolyte (LE)
composing the sample, resulting in a lower apparent mobility of the LE (Figure 5.S2). Thus, the
application of protocol A may not completely remove ions from the treated serum or the washing
buffer solution. The application of t-ITP generates a stacking effect of the sample content because
of mobility differences between the BGE and the LE. For that reason, samples which contained a
- 98 -
LE demonstrating a higher apparent mobility provided a more efficient t-ITP pre-concentration.

In addition, as mentioned previously, the digestion generated significantly more complex samples
due to the presence of TNF-α and streptavidin in important quantities. That complexity influenced
the ionic strength of the sample and contributed to the variability of t-ITP preconcentration.
Table 5.2. PTM observed, resolution between modified and unmodified counterparts, and percentage of modified peptides
estimated according to the protocol of sample preparation (n = 5 for each protocol). The number of samples that succeeded in
obtaining the level of PTM is presented in the row “repeatability of the separation” after 5 replicate samples. The other samples
led to insufficient separation to collect this information. When none of the five replicates allows PTM characterization, the cells
are noted as “HC” stands for Heavy Chain and “LC” for Light Chain.
deaN57 deaN387 deaN137 deaN158 oxiM18 oxiM255 oxiM85 isoD404 isoD283

(HC) (HC) (LC) (LC) (HC) (HC) (LC) (HC) (HC)
Modification
level (%)
11 ± 3 % 69 ± 5 % 17 ± 5 % 15 ± 5 % 7±4% 10 ± 6 % 5 ± 4 % 2±1% 4±1%
Reference
Identification
repeatability
4/4 4/4 4/4 4/4 4/4 4/4 4/4 4/4 4/4
Resolution
between ions
1.8 ± 0.1 0.9 ± 0.1 0.9 ± 0.1 1.6 ± 0.2 n.d. n.d. n.d. 1.2 ± 0.3 1.4 ± 0.2
Modification
level (%)
21 ± 14 % 62 ± 8 % 13 ± 4 % 15 ± 4 % 12 ± 3 % n.d. n.d. 3±4% 3±1%
Protocol A
Identification
repeatability
3/5 5/5 5/5 5/5 4/5 0/5 4/5 3/5 4/5
Resolution
between ions
1.6 ± 0.7 1.3 ± 0.6 1.1 ± 0.3 1.7 ± 0.5 n.d. n.d. n.d. 1.1 ± 0.3 1.0 ± 0.3
Modification
level (%)
15 ± 8 % 71 ± 16 % 26 ± 12 % 20 ± 3 % 10 ± 4 % 9±4% 9±5% 5±5% 4±2%
Protocol B
Identification
repeatability
5/5 3/5 3/5 5/5 5/5 5/5 5/5 3/5 2/5
Resolution
between ions
1.3 ± 0.4 0.8 ± 0.4 0.8 ± 0.3 1.4 ± 0.5 n.d. n.d. n.d. 0.9 ± 0.2 1.4 ± 0.4
Modification
level (%)
8 ± 1 % 56 ± 2 % 14 ± 2 % 11 ± 2 % 4±2% 8±4% 7±3% 2±1% 3±2%
Protocol C
Identification
repeatability
5/5 5/5 5/5 5/5 5/5 5/5 5/5 5/5 5/5
Resolution
between ions
1.5 ± 0.4 1.1 ± 0.1 1.0 ± 0.1 1.4 ± 0.3 n.d. n.d. n.d. 1.0 ± 0.1 4.4 ± 0.4
The development and implementation of sample preparation of protocol A allowed for the
successful isolation and digestion of IFX from serum samples. Consequently, CE-MS/MS
experiments demonstrated the possibility, using the sample preparation, of achieving IFX absolute
quantification in this type of biological matrix over a concentration range corresponding to the
levels commonly observed in treated patients. From an experimental point of view, performing
proteolytic digestion directly on the ferromagnetic beads represented an interesting alternative to
- 99 -
reduce the number of consecutive steps required to perform the protocol and limit analyte loss.
However, on-beads digestion proved to generate peptide mixtures composed of high
concentrations of interferent compounds and unstable ionic strength, which dramatically hindered
the characterization of PTMs. Therefore, to prevent this ion competition risk and the presence of
interference, one solution is to dissociate the analyte of interest from the beads and from all other
proteins that compose them. Acid dissociation is known to be effective for separating mAbs from
antigens [212]. The optimal pH for such an operation is around 3, which is not suitable for further
tryptic digestion due to irreversible inhibition of the digestion enzyme. Buffer exchange was
therefore mandatory prior to digestion. Two buffer exchange pathways were conducted and
compared to estimate the best pathway for the subsequent CE-MS/MS analysis. The first step
involved citrate dissociation and filtration (Protocol B, Figure 5.2). The second pathway tested
was an organic dissociation and evaporation step (Protocol C, Figure 5.2).
5.3.2.a. Citrate dissociation and filtration buffer exchange (Protocol B)
Citrate dissociation (pH~3-4) is widely used for mAb elution because of its efficiency [213,214].
Its low pH and ionic strength allow dissociation of the interaction of mAbs with their antigens but
may alter the conformation of biomolecules. Citrate is a low-volatile solvent, and a filtration
procedure was used for the buffer exchange step with ammonium bicarbonate. The filtration step
was optimized by changing specific parameters, such as the membrane cut-off size, first
considering their effect on the recovery yield of intact IFX in water. After filtration optimization,
an evaluation of its applicability and repeatability to intact IFX in citrate buffer was performed.
▪ Filtration optimization in water buffer

Four different filter cutoffs (100 kDa, 50 kDa, 10 kDa, and 3 kDa) were tested and the recovery
yield of each filtration was calculated. The results show that the average recovery yield ranged
from 0 % to 45 % depending on the filter used. The 100 kDa filter did not provide good recovery
of the mAb introduced into the filter, as illustrated in Figure 5.4. This observation may be due to
the relatively large porosity of the filter, which is not able to retain fully denatured mAbs. For the
following experiments, a 10 kDa filter size was used, as it enabled maximum recovery yield.
Centrifugation parameters, such as rotational speed and temperature, were also studied to obtain
the best yield (Figure 5.S3). No significant difference was observed for the rotational speed at 20
000 rcf or 14 000 rcf. Nonetheless, better repeatability between replicates was noted for the lower
speed, which may have limited the formation of aggregates. Two temperatures were used during
centrifugation: 4°C or 20°C. The results did not show any preferential conditions; therefore, 20°C
was chosen for subsequent measurements.
- 100 -
Figure 5.4. Filter size effect on the recovery yield of the filtration step. Error bars represent the standard deviation among triplicates.
▪ Filtration recovery in citrate buffer

The recovery yield of the filtration step is compared in Figure 5.5 for infliximab (IFX) initially
diluted in H2O MilliQ or in citrate buffer and shows a decrease in the second condition. The low
pH of the buffer can alter the conformation of the mAb, potentially leading to protein denaturation
and the formation of aggregates that are more susceptible to adsorption on the filter material [215].
Citrate has been described to induce greater aggregation than other acidic buffers [216].
Denaturation was studied using a DLS instrument. The size distribution by volume of IFX in water
was found at 9.4 ± 0.4 nm whereas in citrate buffer, its size distribution was of 11.4 ± 0.5 nm. This
shift is consistent with the aggregation theory.
SEC-UV-MALS-RI analysis was also performed for infliximab at 0.5 g·L-1 diluted in
citrate buffer or in water. For IFX injected in water, the MALS detector determined a molar mass
of 150 kDa, corresponding to the monomeric structure (Figure 5.S4). However, no elution was
observed after the injection of IFX in citrate buffer, probably because this buffer modifies its
structure, making it more susceptible to adsorption in the SEC column. These results suggest that
IFX aggregates as well as denatures in citrate buffer, leading to an overall charge prone to
adsorption on the filter walls during the concentration step.
Figure 5.5. Yield of the filtration when infliximab is introduced in the filter in H2O or in citrate buffer. Error bars represent
the standard deviation among triplicates.
- 101 -
To prevent such aggregation, we studied the effect of adding a surfactant to the citrate sample after
pH neutralization with PBS. The result presented in Figure 5.6 shows that the addition of a
surfactant (RapiGest®) prior to filtration increases the recovery yield. These results are consistent
with the hypothesis of mAb aggregation in citrate buffer. The recovery yield can be restored using
the RapiGest® surfactant.
Figure 5.6. Performance of the filtration of infliximab diluted in citrate buffer with or without addition of a surfactant
(RapiGest). Error bars represent the standard deviation among triplicates.
▪ Final results of protocol B

Protocol B with optimized conditions for the filtration step (filter cutoff, centrifugation speed,
temperature, and addition of 20 µL of RG 0.1%) was used, resulting in an overall process
efficiency of 19 ± 22 % (Table 5.1). This poor efficiency is due to the loss of mAbs during the
extraction step (recovery yield of ~ 80 % for 25 µg·mL-1 IFX-spiked serum), in addition to the loss
from the filtration step (recovery yield of ~ 25 %), resulting in a much higher LOD and LOQ than
for the other two protocols (Table 5.1). Because the calculated LOQ was found to be 2.8 ± 2.5
µg·mL-1, the sensitivity will be greatly impacted using this workflow.
In addition, several well-defined PTMs in the reference sample were not identified after
protocol B (Table 5.2). The low recovery yield made it difficult to detect PTMs at low levels and
resulted in a consistently higher percentage level than the reference. It is difficult to determine
whether this overestimation is due to artifactual PTM arising during acid dissociation or to low
signal intensity altering signal integration.
5.3.2.b. H2O/MeOH/FA dissociation and evaporation (Protocol C)
The filtration of the analyte solution had poor repeatability and recovery yield. An alternative is
the evaporation of the solvent. However, because citrate buffer is not volatile, an alternative acid
dissociation involving an organic solvent was tested.
The corresponding strategy is represented by “Protocol C” in Figure 5.2, with a process
efficiency of 58 ± 16%. Since this value is similar to that of protocol A, we can assume that the
- 102 -
loss of mAb is mainly due to the extraction step, and not to the acid dissociation or the evaporation
steps. Here, the LOQ of the strategy was evaluated to be at 0.2 ± 0.1 µg·mL-1, which is the lowest
of the three protocols. Therefore, the workflow proposed here would be suitable for mAbs
quantification from human serum in a concentration range comparable to that offered by ELISA.
In addition, the samples extracted using protocol C were successfully structurally
characterized. All monitored PTMs were observed in all five replicates, with levels similar to
those obtained for the reference, indicating that the purification protocol does not induce artifactual
PTMs (Table 5.2). The high characterization of PTM obtained with this protocol is also evidenced
by the similar EIE of the SINSATHYAESVK peptide with that of the reference (Figure 5.3.C),
the modified and unmodified peptides were distinct from the background. The results highlighted
that the resolution of deaN and isoD from their unmodified counterparts was always greater than
1, which is sufficient to correctly identify these PTM. As the resolution was similar to that obtained
for the reference sample, this shows that this protocol does not affect CE separation.
5.4. Conclusion
Sample preparation prior to the analysis of minor compounds in complex matrices remains a
challenge for analytical chemists. Often, compromises must be made between the straight-
forwardness and selectivity of the workflow. The follow-up of mAbs in patient serum is
particularly important for clinical treatment. Because they are surrounded by numerous other
proteins in the serum, specific extraction is required to achieve maximum sensitivity. This article
presents how this purification of mAbs in serum can be managed using a bottom-up strategy. The
process efficiency of the analytical procedure directly affects the LOQ of the method. In the study
of mAbs used for the treatment of various diseases, these administered biomolecules are usually
found at a concentration of a few µg·mL-1, surrounded by many other proteins. Therefore, the
lower the LOQ of the analytical workflow, the better is the study of infliximab in the serum.
Among the three protocols elaborated in this study, Protocol C appeared to be the most appropriate
for this purpose.
Particularly, PTM are interesting for the investigation of antibodies that have been
administered to patients in order to assess the structural changes that they undergo in the patients’
blood. Nevertheless, their characterization is difficult because PTM are present in low proportions.
Therefore, their identification relies on the selectivity and sensitivity of analytical methods.
Capillary electrophoresis is often chosen as a separation technique for PTM analysis of peptides,
as its high efficacy and separation principle lead to sufficient separation of PTM, such as deaN
and isoD. This article shows that sample preparation of the monoclonal antibody can greatly affect
this characterization and provides insight into the issues that can arise in the development of the
- 103 -
method. Because the process efficiency of sample preparation is directly correlated with
sensitivity, it must be closely monitored. Here, we highlight the losses encountered during mAb
membrane filtration. Although each compound may lead to a different recovery yield in this step,
the experimenter should evaluate the losses. As demonstrated, protocol B did not successfully
identify all PTM from all replicates, even though the experiments were initially performed at 25
µg·mL-1 of infliximab in serum, which is a high level for patients treated with this biomolecule.
Undoubtedly, the identification of PTM decreases with increasing concentration. Another
important parameter for PTM characterization is the sensitivity of the method. As illustrated by
protocol A of our study, which showed the highest process efficiency, poor characterization of
PTM was obtained because of the remaining interfering compounds in the sample, which altered
the ITP duration and induced ion competition in the ESI source. This resulted in a decrease in
resolution and sensitivity, respectively.
- 104 -
5.5. Supporting Information

Table 5.S1. Major information of the two peptides observed
Peptide Charge Collision y-ion fragments
Sequence m/z
mass (Da) state Energy (eV) observed
361.18 731.36
458.23 844.45
DILLTQSPAILSVSPGER 1895.03 2+ 948.52 10 545.26 957.53
644.33 1125.62
371.18 741.36
468.23 854.45
DILLTQSPAILSVSPGER 1905.03 2+ 953.52 10 555.26 967.53
654.33 1135.62
Figure 5.S1: Yield calculated for the extraction step of infliximab with the beads.
Figure 5.S2. Apparent mobility of the leading electrolyte (LE) observed from CE-MS/MS experiments for the different sample
preparation procedure developed in capillary electrophoresis separation. Injection volume = 68nL, Voltage applied on the
capillary = 23kV, capillary length = 100 cm
- 105 -
Figure 5.S3. A : Yield for centrifugation temperature at 20°C or 4°C. B : Yield for centrifugation speed at 20000rcf or
Molar Mass vs. time
14000rcf.
IFX+H2O[Sequence14]
LS UV
7
1.0x10
6
1.0x10
Molar Mass (g/mol)
5
1.0x10
4
1.0x10
1000.000
100.00
10.0
1.0
0.1
0.01
10.0 15.0 20.0
time (min)
Figure 5.S4. Left : MALS and UV detection of infliximab at 25µg·mL-1 in water buffer analyzed by SEC. Right:
Chromatogram of infliximab at 0.5g/L in citrate buffer (black line) or in water (blue dotted line).
- 106 -
Chapitre 6 – Optimisation de l’analyse -MS/MS
C HAPITRE 6.
A NALYSE CESI-MS/MS DES PEPTIDES
Préambule
Le chapitre 5 précédent a donc permis d’établir une stratégie de purification de l’infliximab (IFX)
et du SIL-IFX de sérum, qui, suivie d’une digestion tryptique et d’une analyse CE-MS/MS, permet
de suivre tous les peptides sélectionnés dans le chapitre 4. Parmi eux, on retrouve les peptides
signatures de la concentration du mAb, et d’autres peptides porteurs d’acides aminés hotspots,
susceptibles de subir des PTM. Afin de renforcer la performance de l’analyse, la séparation
électrophorétique a également été optimisée. Cette optimisation s’est consacrée à l’obtention des
deux objectifs majeurs. Puis, sont décrits les paramètres de MS utilisés dans le cadre de ce
manuscrit.
6.1. Optimisation de la séparation électrophorétique

Les séparations peptidiques du digest d'infliximab ont été réalisées sur un système d'électrophorèse
capillaire CESI8000® (Sciex separations, Darmstadt, Allemagne), couplé à un spectromètre de
masse par une interface sheathless. Les peptides obtenus après purification et digestion de
l’infliximab issu de sérum modèle, suivant le protocole décrit précédemment (protocole C, Figure
5.1) sont repris dans 5 µL d’une solution d’acétate d’ammonium à 100 mM, pH 4. Puis, cette
solution est injectée hydro-dynamiquement dans le capillaire de séparation, préalablement rempli
d’acide acétique à 10 % (pH 2,2) en tant qu’électrolyte support. Afin de garantir une sensibilité
optimale, l’étape de préconcentration par isotachophorèse transitoire (t-ITP) est effectuée.
L’ITP préconcentre les analytes avant leur séparation CZE qui se produit seulement quand
l’électrolyte meneur est sorti du capillaire. Il est donc nécessaire de moduler la durée de l’ITP,
pour que les peptides aient le temps de se séparer avant leur arrivée en sortie de capillaire. Cette
durée, affectant la résolution et l’efficacité des pics, dépend de la longueur et du diamètre du
capillaire, de la conductivité des électrolytes choisis, mais aussi du volume d’injection (Vinj) et de
la tension appliquée de part et d’autre du capillaire. Dans le cadre de ce projet, la longueur du
capillaire fut fixée à 1 m, et le diamètre interne à 30 µm. Ce faible diamètre est nécessaire afin de
maintenir un nano-débit, augmentant la sensibilité de l’analyse par MS, et permet, de plus, de
limiter l’effet Joule pouvant se produire après application de la tension. Comme décrit
précédemment, la purification a été optimisée afin de limiter les sels résiduels, pouvant augmenter
- 107 -
la conductivité de l’électrolyte meneur, de manière incontrôlée. Après reprise des peptides dans la
solution d’acétate d’ammonium 100 mM, la conductivité de la solution est d’environ 310 mS·m-1,
tandis que celle de l’électrolyte support (BGE) est de 160 mS·m-1.
Les deux autres paramètres optimisés pour assurer une bonne efficacité de séparation furent
la tension du champ électrique et le volume d’injection. Pour cela, un plan d’expériences complet
de deux paramètres à trois et quatre niveaux respectivement a été effectué (Table 6.1). De
l’infliximab, dopé à 25 µg·mL-1 dans du sérum modèle sain, a été analysé en CE-ESI-MS/MS
suivant les différents essais décrits par la Table 6.1 :
Table 6.1. Plan d’expériences utilisé pour l’optimisation de la tension appliquée (62 nL, 68 nL, 82 nL) et du volume d’injection
(15 kV, 20 kV, 23 kV, 25 kV)
Essais Volum d’ nj c on (nL) Tension appliquée (kV)
1 62 15
2 62 20
3 62 23
4 62 25
5 68 15
6 68 20
7 68 23
8 68 25
9 82 15
10 82 20
11 82 23
12 82 25
Les deux paramètres étudiés ont tous deux un impact sur l’efficacité et la résolution de la séparation
électrophorétique. Ainsi, il faut établir l’influence de ces interactions, plutôt que d’étudier leurs
effets individuellement. Le plan d’expériences permet de visualiser ces interactions, afin de
facilement sélectionner les conditions optimales selon nos critères. La première réponse que nous
avons considérée est l’efficacité du pic correspondant au peptide Quantifier LC01 (IFXLC01). Plus
cette efficacité sera élevée, plus le sera également la sensibilité de la méthode CE-MS/MS pour la
quantification. Les autres réponses considérées de ce plan d’expérience furent les résolutions des
6 résidus sélectionnés présentant une deaN ou isoD, avec leur homologue non modifié. La Figure
6.1 représente l’évolution de l’efficacité de IFXLC01, de la durée de l’ITP et de la résolution des 6
PTM suivies en fonction du Vinj et de la tension appliquée au capillaire. Pour chaque essai,
l’efficacité (N) du peptide IFXLC01 a été évaluée suivant :
µapp 𝑉 𝑀𝑇LC01
𝑁= = 16( )² (6.1)
2𝐷m 𝜔LC01
µapp : mobilité apparente de l’analyte (cm²·V-1·s-1)
V : potentiel appliqué au capillaire (V)
Dm : coefficient de diffusion (m²·s-1)
𝑀𝑇LC01 : temps de migration du peptide LC01 (min)
𝜔LC01 : largeur de son signal (min)
- 108 -
La Figure 6.1.a. présente l’évolution de N en fonction des deux facteurs. Tout d’abord, une
augmentation significative de l'efficacité du pic IFXLC01 est observée avec l’incrémentation de
Vinj. Plus celui-ci sera grand, plus il y aura une grande quantité d’électrolyte meneur dans le
capillaire, permettant aux peptides de se concentrer davantage, ce qui se traduit par une meilleure
efficacité de pic. On observe d’ailleurs que le temps total de l’ITP augmente avec le volume injecté
(Figure 6.1.b).
La tension appliquée au capillaire de séparation lors de l’analyse affecte également
l’efficacité du peptide IFXLC01 de l’infliximab (Table 4.1). Comme présenté Figure 6.1.a, pour
des tensions appliquées de 15 kV à 23 kV, on observe une augmentation graduelle de N. Cela peut
s’expliquer par l’équation (6.1), qui relie l'efficacité du pic à la tension de manière proportionnelle.
Néanmoins, au-delà d’une tension de 23 kV, un effet antagoniste perturbe le système : l’effet Joule.
En effet, l’augmentation de la tension produit un gradient de température sur la section radiale du
capillaire. Or, la température est inversement proportionnelle à la viscosité du BGE, ce qui affecte
le front d’écoulement plat caractéristique de la CZE. Une viscosité plus faible implique également
une conductivité plus grande du BGE. Les analytes ne sont alors plus soumis à la même mobilité
osmotique au sein d’une même section de capillaire. Les expériences ont permis d’établir qu’une
tension de 20 kV et un Vinj de 82 nL permettent une efficacité de IFXLC01 maximale.
En parallèle, l’objectif étant de caractériser des déamidations d’asparagines (deaN) et
isomérisations d’aspartates (isoD), les résolutions des 4 deaN et 2 isoD avec leurs homologues
intacts furent elles aussi calculées. On peut établir la résolution entre deux pics (1 et 2) après
séparation par CE suivant l’équation
𝑀𝑇2 −𝑀𝑇1 √𝑁 𝜇𝑒𝑝2 −𝜇𝑒𝑝1
𝑅1−2 = 2 = . (6.2)
𝜔1 +𝜔2 4 (𝜇𝑒𝑜 +𝜇𝑒𝑝
̅̅̅̅ )
𝑀𝑇1 𝑜𝑢2 Temps de migration des peptides 1 ou 2 (min)

𝜔1 𝑜𝑢 2 Largeur du pic 1 ou 2 (min)
Les figures 6.1.c-h. illustrent l’évolution de la résolution entre les peptides présentant les PTM
suivies. Le pic n°1 correspond au peptide non modifié, et le n°2 celui présentant une déamidation
ou une isomérisation. La résolution semble être quasi systématiquement meilleure dans le cas d’un
Vinj de 68 nL. Là encore, des effets opposés vont avoir lieu quant au volume d’injection sur la
résolution entre les peptides. D’un côté, plus celui-ci est grand, meilleure sera l’efficacité. La
résolution entre deux pics étant proportionnelle à cette efficacité N d’après l’équation (6.2), elle
sera donc améliorée. D’un autre côté, plus le volume injecté est important, plus la durée de l’ITP
est longue (Figure 6.1.b), et donc le volume de capillaire disponible pour la séparation CZE est
réduit, ce qui diminue la résolution. Ainsi, un compromis est nécessaire par rapport au volume
d’injection. Il a été possible d’observer des résolutions au moins supérieures à 1 pour un Vinj 68
- 109 -
nL et des tensions de 20 à 23 kV (Figure 6.1). En conséquence, afin de combiner une bonne

efficacité de pic de IFXLC01 et une bonne résolution des peptides, les conditions choisies pour la
méthode analytique furent un Vinj de 68 nL, correspondant à 9.6 % du volume total du capillaire,
et une tension de 23 kV appliquée au capillaire pour la séparation.
fficacité de C 1 Temps de l TP ésolution entre les peptides /d
/
/
Ef icacite de
Resolution
Resolution
ésolution entre les peptides D/ oD
/
/
Resolution
Resolution
Resolution
Resolution
Figure 6.1. Evolution de l’efficacité du signal de LC01, de la durée de l’ITP et de la résolution des 4 deaN et 2 isoD suivies, selon
le Vinj et la tension appliquée au capillaire. Vinj = 62 nL (points noirs), Vinj = 68 nL (carrés rouges) et Vinj = 82 nL (losanges bleus).
6.2. Analyse par spectrométrie de masse

L’objectif de la méthode CE-ESI-MS/MS est de pouvoir suivre de nombreux peptides issus du
digest d’infliximab et de SIL-IFX. Les acquisitions MS et MS/MS se sont basées sur une stratégie
DDA Top20, sur le TTOF 5600® de Sciex. Les paramètres du spectromètre pour la méthode
d’acquisition du digest peptidique des mAbs sont présentés dans la Table 6.2. Lors d’un cycle
d’acquisition, un balayage MS des ions entrants est réalisé dans le premier quadripôle du
spectromètre et le TOF permet de les analyser. Puis, s’ensuivent 20 acquisitions MS/MS des 20
ions les plus intenses obtenus dans le balayage MS. Pour cela, les ions précurseurs sont
sélectionnés dans le premier quadripôle Q1, fragmentés en CID dans la cellule de collision, et les
ions fragments sont analysés par le TOF. La méthode développée mène à l’obtention d’un
recouvrement de séquences de près de 80 % pour l’infliximab et le SIL-IFX.
- 110 -
Table 6.2. Paramètres de l’acquisition MS et MS/MS des peptides séparés en CE.

Paramètre Valeur
Potentiel à la source ESI (ISVF) 1500-1900 V
Température de la source (IHT) 100°C
Gaz Rideau (CUR) 2 psi
Scan MS 250 msec
Temps d’accumulation
Scan MS/MS 80 msec
Temps de cycle 1,9 sec
Energie de collision 10 eV
Gamme de masse (m/z) en MS 100 – 2000
Gamme de masse (m/z) en MS/MS < 1250
6.2.1. Quantification absolue par MS
La stratégie de quantification absolue par MS utilisée est celle nommée PSAQ, et repose sur l’ajout
du SIL-IFX intact au sérum de départ, contenant l’infliximab à quantifier. Lors de l’analyse CE-
MS/MS du digest peptidique de ces mAbs, il est possible de tracer un électrophérogramme,
sommant les ions acquis par le spectromètre de masse en fonction du temps. La Figure 6.2.a
présente un électrophérogramme issu de l’analyse CE-MS/MS de ce digest. À 43,4 min, le spectre
MS acquis indique la présence des peptides LC01 de l’infliximab (IFXLC01, léger) et du SIL-IFX
(IFX*LC01, lourd), comme représenté en Figure 6.2.b. On observe les ions m/z correspondant aux
deux peptides chargés 2 fois, ainsi que leur co-migration attendue. Il est alors possible d’extraire
de l’électrophérogramme les ions m/z caractéristiques de ces peptides en fonction du temps, pour
obtenir un EIE (Extracted Ion Electropherogram), comme représenté Figure 6.2.c. Dans le cadre
de ce doctorat, les EIE ont systématiquement été réalisés par extraction de l’ion précurseur mono-
isotopique et des deux premiers isotopes du massif isotopique, dont la moyenne des signaux a
permis d’établir l’aire sous le pic. Par intégration de l’aire sous ces pics, utilisant le logiciel
Skyline®, il est alors possible d’établir le rapport IFXLC01/ IFX*LC01 de ces aires de l’échantillon.
Parallèlement, une gamme d’étalonnage en matrice sérique modèle, dopée à des
concentrations fixes de SIL-IFX et croissantes d’infliximab, est effectuée. Cette gamme permet
l’établissement d’une relation linéaire entre le rapport IFXLC01/ IFX*LC01 de la réponse MS des
deux mAbs et la concentration en infliximab.
De plus, les peptides IFXLC01 et IFX*LC01, très intenses, sont systématiquement
sélectionnés dans le Top20 DDA lorsqu’ils sont présents dans le scan MS au vu de leur grande
efficacité de digestion et d’ionisation, et sont donc fragmentés. Aussi, une confirmation d’au moins
5 fragments y des spectres MS/MS issus de leur fragmentation CID a pu être effectuée avant
attribution d’un signal (Figure 6.2.d).
- 111 -
Peptide leger
(in liximab)
Peptide lourd
(SIL IF )
Spectre MS² du peptide (SIL IF )
Figure 6.2. Stratégie d’acquisition MS implémentée pour la quantification d’infliximab par bottom-up. Identification et
intégration des signaux des peptides LC01 de l’infliximab (peptide léger) et du SIL-IFX (peptide lourd). a. Electrophérogramme
entier issu de l’analyse CE-MS/MS d’infliximab et de SIL-IFX après digestion peptidique. b. Spectre MS contenant les ions m/z
des peptides LC01 (légers et lourds). c. Extraction des ions m/z de LC01 de l’électrophérogramme. d. Spectres MS/MS obtenus
après fragmentation CID des peptides LC01 (légers et lourds).
- 112 -
6.2.2. Quantification relative des PTM
À partir du même électrophérogramme CE-MS/MS obtenu après analyse du digest peptidique,

d’autres ions peuvent être extraits pour établir la quantification relative de PTM de certains sites
de l’infliximab. Pour cela, sont extraits de l’électrophérogramme les EIE des peptides chargés 2
fois, comportant un acide aminé hotspot non modifié et de leur homologue présentant une PTM.
Les aires de ces signaux sont intégrées, et la proportion relative du peptide modifié par rapport à
celui intact est déterminée. Cette quantification apporte une information relative, de la proportion
d’une espèce par rapport à une autre, au moment de l’analyse CE-MS/MS. Cette quantification
relative peut être réalisée pour chaque acide aminé, sous couvert d’avoir une sensibilité suffisante.
Néanmoins, il est possible que ces proportions relatives de PTM de l’infliximab évoluent lors de
son extraction du sérum, de sa digestion tryptique, ou bien même lors de son analyse CE-MS/MS.
Ce qui nous intéresse particulièrement dans le cadre de ce projet, c’est de déterminer les PTM
survenues sur l’infliximab lors de sa circulation dans l’organisme des patients. Il est donc
important de limiter ou supprimer les PTM dites endogènes, induites par notre stratégie analytique.
Ces travaux font l’objet du chapitre 7.
- 113 -
- 114 -
Chapitre 7 – Mise en place d’une stratégie de normalisation pour la caractérisation structurale
C HAPITRE 7.
EN M ISE DE PLACE D ’ UNE STRATEGIE
NORMALISATION POUR LA CARACTERISATION DES
PTM
7.1. Quantification relative brute des PTM après analyse CE-
MS/MS
7.1.1. Glycosylations
L’analyse CE-MS/MS de l’infliximab issu de sérum a permis d’extraire le peptide porteur de

l’asparagine N300, site de glycosylation de l’infliximab (peptide HC26). Les formes glycaniques
majoritaires des IgG sont connues, ainsi que leurs compositions en oligosaccharides et leurs
masses (Cf. Annexe 2). L’extraction des 6 glycopeptides majoritaires de l’infliximab (25 µg·mL-1)
mène à l’obtention de la Figure 7.1.a. On observe une séparation partielle des différents glycans,
avec une majorité de G0F. Ici, les autres glycopeptides, plus minoritaires, que présentent les IgG,
peuvent également être suivis, mais résultent systématiquement en un signal trop peu intense pour
être extrait du bruit de fond.
Les spectres MS/MS de la fragmentation CID de deux de ces glycopeptides, G0F et G2F,
sont présentés Figures 7.1.b et 7.1.c. Les fragments caractéristiques d’une fragmentation CID d’un
glycopeptide [156] ont été identifiés. Cette fragmentation ne mène pas à la dissociation du peptide
porteur mais à celle des oligosaccharides, dont les liaisons absorbent mieux l’énergie
communiquée que la chaîne peptidique [217].
Figure 7.1. Spectres MS (EIE) et MS/MS des glycopeptides de l’infliximab après analyse CE-MS/MS du digest peptidique. a.
EIE des principaux glycopeptides de l’infliximab ; G0F, G1F, G2F, G0FN, G0N et M5, dont les compositions oligo-sacchariques
sont représentées au-dessus des signaux MS. Les ions extraits correspondent aux glycopeptides chargés 2 fois. Les spectres
MS/MS des glycopeptides b. G0F et c. G2F sont présentés à droite.
- 115 -
7.1.2. Autres PTM
À partir des mêmes données CE-MS/MS que pour l’obtention des EIE des glycans, les EIE
correspondants aux autres peptides avec ou sans PTM peuvent également être extraits (Figure 7.2).
Figure 7.2. EIE des peptides avec ou sans PTM des acides aminés hotspots de l’infliximab après analyse CE-MS/MS du
digest peptidique.
Dans le cas des isomérisations et déamidations, une bonne séparation électrophorétique a pu être
observée avec une résolution systématiquement supérieure à 1 (Figure 7.2.a et b). La confirmation
des peptides avec et sans PTM est réalisée systématiquement par caractérisation des spectres
MS/MS (Annexe 3). Concernant les isomérisations, la modification ne présente pas de différence
de charge ou de masse sur le peptide, conduisant à des spectres MS et MS/MS identiques au peptide
- 116 -
de référence. Néanmoins, des travaux précédents ont démontré grâce à des peptides synthétiques
que les peptides présentant une isoD migrent systématiquement plus lentement en CZE que les
peptides non modifiés [21] comme le montre la Figure 7.2.a. Les oxydations, quant à elles, co-
migrent avec leur équivalent non modifié (Figure 7.2.c). Cette PTM induisant 16 Da de différence,
il n’y a aucun recouvrement isotopique des peptides en spectrométrie de masse, ce qui permet une
parfaite identification des deux formes peptidiques par l’intermédiaire des données MS/MS.
L’intégration des aires sous les pics permet d’établir la proportion relative de ces 9 PTM
par rapport à leurs homologues non modifiés. La Figure 7.3 présente les proportions moyennes
obtenues après analyse d’infliximab (IFX) dopé dans du sérum et extrait selon le protocole C établi
dans le chapitre 5 (digestion n°1, barres noires). Les barres hachurées correspondent à ces mêmes
proportions observées pour le SIL-IFX, introduit dans le même échantillon que l’infliximab. On
observe des proportions très similaires entre l’IFX et le SIL-IFX. Cependant, la méthionine M85
présente un niveau d’oxydation plus élevé pour l’infliximab que le SIL-IFX. Cette disparité n’a
pas été expliquée, mais les données MS² ont confirmé l’identification des peptides. Il est possible
de suggérer que les lots d’infliximab et de SIL-IFX utilisés lors de ces premières analyses aient
subi des conditions de stockage différentes, n’ayant impacté que cet acide aminé.
Par ailleurs, des niveaux de PTM très différents d’un acide aminé à un autre sont observés.
À titre d'exemple, suite à la digestion n°1, on constate que près de la moitié de l'asparagine N387 a
subi une déamidation, alors que seulement 10 % de l'asparagine N158 a subi cette modification.
Ceci souligne une prédisposition à la modification qui varie en fonction de la position spécifique
de l'acide aminé. En particulier, l’asparagine N387 précède une glycine, un acide aminé ne
possédant pas de chaîne latérale. Or, lors d’une réaction de déamidation, la formation de
l’intermédiaire de réaction succinimide nécessite une conformation particulière de l’asparagine.
L’acide aminé précédant cette asparagine peut, par sa chaîne latérale, limiter la formation du
succinimide par gène stérique [218].
Il est également possible de noter que les proportions de PTM obtenues par analyse CE-
MS/MS (Figure 7.3, barres noires) sont nettement plus élevées que celles de la littérature [193]
(Figure 7.3, barres mauves). Il a été identifié que notre étape de digestion induisait des PTM
endogènes sur certains acides aminés de l’infliximab. Cette étape de digestion, décrite au chapitre
5, comprend deux conditions expérimentales connues pour induire des oxiM et deaN: un pH 8
basique et une température élevée de 80°C [104].
- 117 -
Figure 7.3. Proportions relatives des 9 PTM observées par CE-MS/MS pour l’infliximab (barres pleines) ou le SIL-IFX (barres
hachurées) issus de sérums, selon deux protocoles de digestions peptidiques. Digestion pH 8 (barres noires) ou pH 6 (barres
rouges). Les barres d’erreurs représentent les écarts types associés aux triplicatas d’analyse. Proportions obtenues par Pisupati
et al. (2017) après analyse LC-MS d’infliximab pur (barres mauves).
Afin d’identifier l’origine de ces PTM artificielles, le même protocole a été réalisé sur
d’autres sérums dopés en infliximab et SIL-IFX, mais cette fois la digestion fut réalisée à pH 6, et
les étapes nécessitant une température de 80°C furent réalisées à 40°C. Les proportions de PTM
obtenues sont présentées sur la Figure 7.3, digestion n°2, barres rouges. On observe des niveaux
de PTM nettement plus faibles et répétables après cette digestion n°2 que ceux obtenus pour la
n°1. Ces résultats illustrent que la température et/ou le pH basique favorisent les deaN et oxiM,
mais ne semblent pas affecter la proportion d’isoD. En particulier, une étude a démontré qu’un pH
8 favorise la catalyse de la réaction de déamidation d’asparagine par le bicarbonate d’ammonium
[219]. Cependant, il est à noter que la digestion par la trypsine atteint une efficacité maximale à ce
même pH 8 [220], assurant une sensibilité de la méthode pour la quantification d’infliximab. En
effet, pour que la trypsine hydrolyse les liaisons N-C après les arginines et lysines, il faut que
l’acide aspartique se trouvant au fond de sa poche (région où s’effectue la triade catalytique) soit
chargé négativement (pKa 3,7). À partir du signal du LC01 de l’infliximab pour ces analyses, il a
été calculé des LOQ (S/N > 10) de 0,25 ± 0,07 µg·mL-1 pour la digestion à pH 8 (n°1) et de
1,04 ± 0,08 µg·mL-1 pour celle à pH 6 (n°2). Ainsi, la digestion n°1, bien qu’elle induise des PTM
artificielles, permet une meilleure sensibilité de la méthode, et a donc été gardée tout au long de
ce manuscrit.
Dans la littérature, différentes stratégies ont été employées ces dernières années afin de
limiter les PTM artificielles [126,221], ou pour les identifier [127,128,222], tout en conservant une
- 118 -
efficacité de digestion optimale. Ces méthodes sont coûteuses ou nécessitent des manipulations
supplémentaires de l’échantillon. C’est alors qu’il a été envisagé d’établir une méthode de
normalisation, utilisant le SIL-IFX introduit en début d’analyse, comme marqueur de ces
modifications artéfactuelles. Cette méthode de normalisation fait l’objet de la section suivante.
7.2. Mise en place d’une stratégie de normalisation

7.2.1. Principe de l’approche
L’objectif a été de mettre en place une approche pour déterminer les PTM de l’infliximab apparues
lors de sa résidence dans la circulation sanguine d’un patient, et uniquement lors de cette étape.
Les PTM endogènes peuvent être produites lors de la préparation d’échantillon, de l’analyse CE-
MS/MS des peptides, mais aussi lors de la production de l’infliximab. Ainsi, la proportion de PTM
endogènes de chaque site étudié doit être déduite et supprimée de la proportion relative finale
obtenue en CE-MS/MS. Le principe est similaire à celui d’une normalisation dans le cas d’une
quantification absolue d’un analyte, c’est-à-dire que l’on va comparer la réponse de l’étalon interne
(ici le SIL-IFX) à celle attendue, et ainsi établir l’erreur due à la préparation d’échantillon. Puis,
la réponse de l’analyte peut être corrigée selon ce même biais expérimental. Néanmoins, par
rapport à cette stratégie bien établie, nous sommes confrontés à plusieurs problématiques
supplémentaires.
Considérons un acide aminé de l’infliximab, dont notre objectif est de calculer la
proportion d’une PTM induite sur ce site lors de l’administration de l’infliximab à un patient.
Après collecte du sérum, ajout du SIL-IFX, préparation de l’échantillon et analyse CE-MS/MS, il
va être possible de déterminer la proportion relative 𝐿IFX
p de ce site de l’infliximab présentant cette
PTM. De manière similaire, 𝐿SIL

p , correspond à la proportion relative de cette PTM pour le SIL-
IFX (Figure 7.4).
▪ Le premier aspect à prendre en considération est que la production du SIL-IFX est

beaucoup moins contrôlée que celle de l’anticorps thérapeutique infliximab. Ainsi, comme
présenté Figure 7.4 aux étapes (1) et (3) il a été considéré que la proportion de PTM de l’acide
SIL
aminé étudié (représenté par les points rouges) peut être différente entre le SIL-IFX (𝑓prod ) et
IFX
l’infliximab (𝑓prod ) juste après leur production ;
- 119 -
de PTM produite a de PTM produite a

de PTM
de PTM produite a de PTM produite a
de PTM produite a
de PTM
Figure 7.4. Stratégie de normalisation implémentée pour la détermination des proportions de PTM apparues seulement lors
de l’administration de l’infliximab aux patients, 𝑓𝑏𝑙𝑜𝑜𝑑
𝐼𝐹𝑋
.
▪ Le deuxième aspect particulièrement important est que, contrairement à une analyse

quantitative absolue, nous cherchons à déterminer ici une proportion relative. Or, l’abondance
d’une modification induite lors d’une étape dépend forcément de la quantité de l’acide aminé non
modifié issu de l’étape précédente.
Par exemple : prenons deux patients A et B, auxquels est administrée une dose identique
d’infliximab. Puis, quelques jours après administration, leur sérum est collecté et analysé.
L’objectif est de définir à quelle proportion une PTM est survenue sur un acide aminé spécifique
IFX
durant l’administration. Supposons que l’organisme du patient A ait modifié 50 % (= 𝑓blood A) de
IFX
cet acide aminé de tout l’infliximab administré, et le patient B seulement 2 % (= 𝑓blood B). Les
sérums sont collectés et manipulés en même temps. Supposons maintenant que la préparation
d’échantillon induise 50 % (il s’agit d’un cas extrême) de PTM endogènes (𝑓prep,a ) sur ce même
acide aminé. Alors, 50 % de tous les sites non modifiés le seront après cette étape. Pour le patient
A, il s’agira de 25 % de nouveaux sites modifiés lors de la préparation d’échantillon. Pour le patient
B, ce sera 49 %. Ainsi, pour une même manipulation, un taux de PTM endogène différent aura été
produit. Tout cela explique pourquoi chaque étape induisant potentiellement des PTM est
dépendante des précédentes. Comme représenté dans la Figure 7.4, le pourcentage total de PTM
apparu sur l’acide aminé lors de chaque étape est présenté dans les cases grises. Ce pourcentage
dépend du facteur de modification f de l’étape, ainsi que de ce qui n’a pas été modifié (1-f) des
étapes précédentes ;
- 120 -
▪ Le troisième aspect que la stratégie de normalisation doit considérer est que pour
l’infliximab et le SIL-IFX présents dans un même échantillon, l’impact de la préparation
d’échantillon va être identique. Ainsi, le facteur de PTM induit par la préparation d’échantillon est
identique pour les deux mAbs d’un même échantillon (𝑓prep ).
L’objectif de cette normalisation est de déterminer le facteur de modification que l’organisme du

IFX
patient a eu sur un acide aminé spécifique de l’infliximab administré (𝑓blood ). Ce facteur apparaît
dans la Figure 7.4 en étape (2) lors de l’administration de l’infliximab au patient et réapparaît en
(4a). Après analyse CE-MS/MS, les proportions 𝐿IFX SIL
p et 𝐿p sont obtenues, et correspondent à la
somme des proportions de la PTM induites à chaque étape, ce pour l’infliximab et le SIL. On
obtient alors le système d’équations suivant
IFX IFX IFX IFX IFX

𝐿IFX IFX
p = 𝑓prod + 𝑓blood (1 − 𝑓prod ) + 𝑓prep,a (1 − 𝑓prod )(1 − 𝑓blood )
(7.1)
SIL SIL
𝐿SIL SIL
p = 𝑓prod + 𝑓prep,a (1 − 𝑓prod )
Avec 𝑓𝑦𝑥 le facteur de modification de l’acide aminé concerné appartenant à l’anticorps x (SIL-
IFX ou infliximab) à l’étape y (production, administration, manipulation, analyse).
Néanmoins, ce système de deux équations (7.1) possède trois, donc trop d’inconnues
IFX SIL IFX
(𝑓prod , 𝑓prod , et 𝑓prep,a ) pour être capable d’extraire 𝑓𝑏𝑙𝑜𝑜𝑑 . Pour cette raison, il a été nécessaire
d’introduire deux autres équations à ce système, issues d’un échantillon de référence (cf. « ref »
de la Figure 7.4). Cet échantillon est préparé en même temps que le sérum patient, et consiste en
du sérum sain, dopé avec du SIL et de l’infliximab, purifiés et analysés selon le même protocole.
SIL
Les analyses CE-MS/MS permettent d’obtenir 𝐿IFX
ref et 𝐿ref que l’on peut écrire selon le système
7.2. Afin de renforcer la justesse du calcul, il a été pris en compte que deux échantillons, bien que
préparés simultanément, pouvaient présenter un 𝑓𝑝rep différent (a et b).
𝐿IFX IFX IFX

ref = 𝑓prod + 𝑓prep,b (1 − 𝑓prod )
(7.2)
𝐿SIL SIL SIL
ref = 𝑓prod + 𝑓prep,b (1 − 𝑓prod )
IFX SIL
Ainsi, les systèmes d’équations (7.1) et (7.2) mènent à 4 inconnues (𝑓prod , 𝑓prod , 𝑓prep,a et 𝑓prep,b )
𝐼𝐹𝑋
pour 4 équations, permettant d’isoler 𝑓𝑏𝑙𝑜𝑜𝑑 en fonction des données connues par CE-MS/MS :
IFX SIL IFX SIL SIL IFX SIL
IFX 𝐿IFX
p −𝐿ref −𝐿p +𝐿ref 𝐿p +𝐿ref −𝐿p Lref
𝑓blood = (7.3)
1−𝐿IFX −𝐿SIL +𝐿IFX 𝐿SIL
ref p ref p
- 121 -
Cette méthode de normalisation permet donc de quantifier la fraction de PTM que l’organisme
d’un patient a entraînée sur un site de l’infliximab. L’équation (7.3) peut être appliquée à tous les
acides aminés et tous types de PTM de l’anticorps.
Une hypothèse amenée ici est que l’infliximab utilisé est toujours issu du même lot, ou du
moins qu’il présente la même proportion de PTM après sa production pour l’échantillon d’intérêt
patient comme pour la référence ref. Comme l’infliximab est utilisé en tant que traitement, sa
production reste contrôlée et les PTM faisant partie des critères d’attributs de qualité réglementés
par l’EMA ou FDA sont vérifiés. De plus, il s’agit à chaque fois du même produit d’infliximab, le
Remicade® qui a été utilisé pour ces analyses.
7.2.2. Application de la normalisation
Cette stratégie de normalisation peut donc être appliquée à tout sérum issu de patient traité avec
de l’infliximab (patient), si tant est qu’un sérum modèle dopé avec de l’infliximab et du SIL-IFX
SIL
soit lui aussi analysé par CE-MS/MS (ref). La moyenne des proportions 𝐿IFX
ref et 𝐿ref obtenues en
CE-MS/MS après analyse de 30 sérums références a été calculée pour chacune des PTM hotspot.
Ces valeurs sont présentées dans la Table 7.1, et montrent des niveaux de PTM 𝐿IFX IFX
ref et 𝐿ref
répétables pour deaN et isoD étudiées (écarts-types < 5 %). Par contre, une très grande dispersion
a été observée pour les oxiM. En effet, les écarts-types des 30 réplicas sont très élevés (écarts-
types > 20 %), soulignant que la préparation d’échantillons/analyse induit aléatoirement des
SIL
oxydations. Ces données moyennes de 𝐿IFX
ref et 𝐿ref ont été implémentées, par suite,
systématiquement dans l’équation (7.3) dans le reste du manuscrit, sauf indication contraire.
Table 7.1. Proportions relatives brutes après analyse CE-MS/MS (𝐿𝐼𝐹𝑋 𝑟𝑒𝑓 et 𝐿𝑟𝑒𝑓 )moyennes des PTM de l’infliximab et de SIL-
𝑆𝐼𝐿
infliximab dopés dans des sérums sains (n=30, réalisés sur des jours différents). Erreur calculée par l’écart-type des réplicas.
Isomérisations
Type de Dé m d on d’ p gn Oxydations de méthionines
d’ spartates
PTM (deaN) (oxiM)
(isoD)
Localisation deaN57 deaN387 deaN158 deaN137 oxiM255 oxiM18 oxiM85 isoD283 isoD404
Peptide
(HC07) (HC38) (LC13) (HC10) (HC22) (HC02) (HC11) (HC24) (HC27)
associé
𝐿IFX
ref 8 ± 4 % 49 ± 5 % 10 ± 3 % 16 ± 3 % 40 ± 29 % 22 ± 19 % 28 ± 25 % 4 ± 3 % 2±1%
𝐿SIL
ref 7 ± 3 % 48 ± 5 % 11 ± 2 % 16 ± 3 % 53 ± 28 % 30 ± 24 % 56 ± 27 % 3 ± 2 % 4±1%
- 122 -
Aux données de la Figure 7.3, présentant les proportions finales CE-MS/MS des PTM de
𝐼𝐹𝑋
l’infliximab et SIL-IFX après digestion n°1 ou celle n°2, ont été calculées les valeurs 𝑓𝑏𝑙𝑜𝑜𝑑 de
ces PTM. Pour chacun de ces sérums, les niveaux de PTM obtenus ont été définis en tant que 𝐿IFX
p
IFX SIL
et 𝐿SIL
p , comme présenté en Figure 7.5. Les valeurs 𝐿ref et 𝐿ref moyens de la Table 7.1 ont été
𝐼𝐹𝑋
incorporées dans l’équation (7.3). Cette équation doit mener à une valeur 𝑓𝑏𝑙𝑜𝑜𝑑 proche de zéro,
car l’infliximab analysé n’a jamais été administré à un patient (Figure 7.5, process du haut).
Serum modele sain
3
serums modeles sains
Figure 7.5. Stratégie de normalisation appliquée aux sérums modèles dopés avec de l’infliximab et du SIL.
Nous avions montré dans la Figure 7.3 que les proportions des données CE-MS/MS des 9
PTM étaient plus élevées après la digestion n°1 que la n°2. L’objectif ici est de confirmer que les
PTM artéfactuelles induites par la préparation d’échantillon et l’analyse peuvent être éliminées par
𝐼𝐹𝑋
l’équation (7.3). La Figure 7.6 montre les valeurs de 𝑓𝑏𝑙𝑜𝑜𝑑 obtenues pour chaque PTM, pour
l’infliximab dopé dans du sérum sain, purifié, et digéré selon la digestion n°1 ou n°2 avant analyse
𝐼𝐹𝑋
CE-MS/MS. Il est possible d’observer qu’en moyenne ces 𝑓𝑏𝑙𝑜𝑜𝑑 sont inférieures à ± 10 %, et très
similaires entre les deux digestions. Ainsi, bien que ces protocoles de digestion aient des impacts
distincts sur le niveau de PTM artificielles d’après les données CE-MS/MS brutes (Figure 7.3), on
observe que la normalisation a permis une correction satisfaisante. Étant donné que l’infliximab
𝐼𝐹𝑋
n’a pas été administré à un patient, on trouve des niveaux de 𝑓𝑏𝑙𝑜𝑜𝑑 proches de zéro.
- 123 -
Figure 7.6. Proportions normalisées 𝑓𝑏𝑙𝑜𝑜𝑑

𝐼𝐹𝑋
des 9 PTM pour l’infliximab ou le SIL-IFX issus de sérums dopés modèles, selon
deux protocoles de digestions peptidique. Digestion n°1 : pH 8 barres noires et digestion n°2 : pH 6 barres rouges. Les barres
d’erreurs correspondent aux écarts-types des triplicatas.
Le site M85 a résulté en une grande variabilité des réplicas (CV > 20%), probablement à cause de
la différence de proportion relative de son oxydation selon l’infliximab ou le SIL-IFX (Figure 7.3).
Ces problématiques ne se retrouvent pas dans le cas des autres sites. Malgré tout, les résultats
soulignent la capacité de la stratégie de normalisation pour opérer une correction des PTM
endogènes adaptée, quelle que soit la variabilité de ces modifications. Par ailleurs, il est possible
de l’implémenter également aux profils de glycosylations, ce qui a été réalisé dans le chapitre
suivant.
C ONCLUSION
La préparation d’échantillon et les paramètres d’analyse sont essentiels à l’obtention d’une
méthode sensible et performante. Les travaux de cette partie II du manuscrit se sont centrés sur
l’optimisation des conditions de purification, de séparation électrophorétique, d’acquisition MS et
de traitement de données menant à la quantification et la caractérisation de PTM de l’infliximab
issu de sérum. Le protocole mène à une LOQ de 0,22 µg·mL-1, adéquate à la quantification
d’infliximab dans du sérum.
Le développement de la méthode fut également optimisé pour permettre la caractérisation
et quantification de certaines PTM de l’infliximab. La purification du mAb de la matrice et la
séparation CE peuvent altérer cette caractérisation. Aussi, ces étapes ont été considérées avec
attention afin d’obtenir une méthode sensible, spécifique et sélective de la caractérisation
structurale d’infliximab. Le développement d’une stratégie innovante permet de s’affranchir des
PTM endogènes de l’analyse pour quantifier uniquement celles apparues lorsque l’infliximab est
en circulation dans l’organisme du patient.
- 124 -
Partie III – Application de la méthode CE-MS/MS
Chapitre 8 – Quantification et caractérisation de M de l’infliximab in vivo
PARTIE III : APPLICATION DE LA STRATEGIE CE-

MS/MS POUR LA QUANTIFICATION ET
CARACTERISATION STRUCTURALE DE
L’INFLIXIMAB APRES ADMINISTRATION
- 125 -
- 126 -
Cette partie III est divisée en deux chapitres, portant sur l’application de la méthode
analytique CE-MS/MS développée dans la partie II, à des sérums contenant de l’infliximab. Dans
le chapitre 8, est tout d’abord présentée l’évaluation et la validation de la méthode de quantification
de l’infliximab par CE-MS/MS dans des sérums modèles, suivant les réglementations décrites par
les autorités FDA et EMA. Puis, la procédure analytique a été appliquée à des sérums de patients
atteints de la maladie de Crohn et traités avec de l’infliximab. La concentration de l’anticorps ainsi
que les proportions de certaines de ses PTM, apparues lors du temps de résidence du traitement
dans le corps, ont alors pu être déterminées.
Le chapitre 9, quant à lui, est dédié à l’étude de l’évolution structurale de l’infliximab selon
sa formulation. Pour cela, une stratégie in vitro a été mise en place pour mimer l’évolution de
certaines PTM post-administration. Cette cinétique de dégradation a été comparée selon le produit
original et des biosimilaires de l’infliximab.
- 127 -
- 128 -
C HAPITRE 8.
Q UANTIFICATION
ET CARACTERISATION
STRUCTURALE SIMULTANEE D ’ INFLIXIMAB IN VIVO
Préambule
Depuis quelques années, l'étude des PTM in vivo des mAbs thérapeutiques après
administration fait l'objet d'une attention croissante. Cela est dû au fait que certaines PTM peuvent
diminuer l'activité biologique, impacter la pharmacocinétique ou augmenter l'immunogénicité du
médicament. Ainsi, récemment, des études se sont intéressées aux modifications post-
administration du trastuzumab [223], ou d’autres mAbs de type IgG1 [15,16]. Elles ont pu
identifier des PTM survenant lors de leur circulation sanguine.
L’objectif de ce chapitre fut d’identifier si l’infliximab est également soumis à des PTM post-
administration, notamment sur certains acides aminés hotspots de sa séquence. De plus, afin de
mieux comprendre les conséquences biologiques des PTM d’un mAb thérapeutique, il faut
également contrôler sa biodisponibilité, c’est-à-dire la fraction du traitement encore active et
dirigée contre l’antigène. En particulier ce double suivi, permettrait d’identifier si l’évolution de
certaines PTM post-administration est liée à la dégradation de l’anticorps ou bien à la clairance
(élimination du système) sélective du mAb non modifié. La caractérisation simultanée des PTM
et de la concentration d’infliximab actif à partir de sérum permettrait donc de mieux appréhender
le devenir de cette thérapie.
La méthode analytique CE-MS/MS développée a pu être appliquée pour des analyses in vivo
de sérums de patients atteints de la maladie de Crohn et traités par infliximab. Au préalable, la
quantification a été validée suivant les réglementations instaurées par l’EMA. Cette validation,
basée sur l’analyse de sérums modèles sains dopés par des concentrations connues d’infliximab et
du SIL-IFX, a permis de prouver l’exactitude des résultats quantitatifs, et la caractérisation
simultanée des PTM.
Ces travaux ont fait l’objet d’une publication dans la revue à comité de lecture Journal of
Pharmaceutical and Biomedical Analysis.
- 129 -
Publication: Simultaneous quantification and structural

characterization of monoclonal antibodies after administration using
capillary zone electrophoresis-tandem mass spectrometry
Tessa Reinert, Rabah Gahoual, Nathalie Mignet, Alexandre Kulus, Matthieu Allez, Pascal
Houzé, Yannis-Nicolas Francois
Journal of Pharmaceutical and Biomedical Analysis
2023, 233, 115446.

10.1016/j.jpba.2023.115446
Abstract:
Monoclonal antibodies (mAbs) are demonstrating major success in various therapeutic areas such as
oncology and the treatment of immune disorders. Over the past two decades, novel analytical
methodologies allowed to address the challenges of mAbs characterization in the context of their
production. However, after administration only their quantification is performed and insights regarding
their structural evolution remain limited. For instance, clinical practice has recently highlighted significant
inter-patient differences in mAb clearance and unexpected clinical responses, without providing alternative
interpretations. Here, we report the development of a novel analytical strategy based on capillary zone
electrophoresis coupled to tandem mass spectrometry (CE-MS/MS) for the simultaneous absolute
quantification and structural characterization of infliximab (IFX) in human serum. CE-MS/MS
quantification was validated over the range 0.4-25 µg·mL-1 corresponding to the IFX therapeutic window
and achieved a LOQ of 0.22 µg·mL-1 (1.5 nM) while demonstrating outstanding specificity compared to
the ELISA assay. CE-MS/MS allowed structural characterization and estimation of the relative abundance
of the six major N-glycosylations expressed by IFX. In addition, the results allowed characterization and
determination of the level of modification of post-translational modifications (PTMs) hotspots including
deamidation of 4 asparagine and isomerization of 2 aspartate. Concerning N-glycosylation and PTMs, a
new normalization strategy was developed to measure the variation of modification levels that occur strictly
during the residence time of IFX in the patient’s system, overcoming artefactual modifications induced by
sample treatment and/or storage. The CE-MS/MS methodology was applied to the analysis of samples from
patients with Crohn’s disease. The data identified a gradual deamidation of a particular asparagine residue
located in the complementary determining region that correlated with IFX residence time, while the
evolution of IFX concentration showed significant variability among patients.
8.1. Introduction
Monoclonal antibodies (mAbs) and their derivatives, such as fusion proteins or antibody-drug
conjugates, have been very successful as therapeutic treatments and have contributed significantly
to the emergence of the biopharmaceutical industry. Their field of application was initially focused
- 130 -
on oncology, but therapeutic mAbs have also proven to be particularly relevant for the treatment
of various types of immune disorders. For instance, Crohn’s disease is an inflammatory bowel
disease resulting from overexpression of the tumor necrosis factor (TNF-α), a pro-inflammatory
cytokine of the immune system [224–227]. In order to reduce inflammation and limit the
manifestation of clinical symptoms in patients, several mAbs have been successfully used as
therapeutic treatments [228,229], of which infliximab (IFX) is currently the most widely used
[207,230,231]. IFX is a chimeric immunoglobulin G (IgG1) containing a murine variable region,
with a molecular mass of 147 kDa [52]. IFX inhibits TNF-α activity by direct interaction, or by
triggering antibody-dependent cellular cytotoxicity and complement dependent cytotoxicity [3,6,232].
As the introduction of IFX for the treatment of Crohn’s disease is relatively recent, knowledge
about the evolution of mAbs after their administration to patients remains relatively limited. Thus,
clinical practice suggests that patients may respond differently to treatment in several aspects
[164,165]. After administration of an equivalent dose, some patients have shown significantly
higher clearance, resulting in IFX concentration < 1.2 µg·mL-1 after 14 days, while in a small
proportion of the treated population, the mAbs can be detected in the serum several months after
administration [233]. Similarly, approximately 1/3 of patients failed to show any clinical
improvement and some populations exhibited a loss of clinical response over time that remains
unexplained to date [165,234]. Previous in vitro studies have shown that post-translational
modifications (PTMs) can affect the biological activity of mAbs [12]. In the case of therapeutic
mAbs, asparagine deamidation [235], aspartate isomerization and N-glycosylation [236,237] have
been identified as hotspots with respect to their impact on mAb bioactivity. PTMs located in CDR
parts of mAbs may potentially affect their antigen binding affinity [18,238], whereas modifications
localized in Fc parts could affect their cytotoxic activity [28,147] or serum half-life time [26,29].
Therefore, it might be suggested that poor clinical response could potentially be triggered by
certain PTMs occurring in vivo. In vivo PTMs of mAbs was observed after administration to
monkeys [16], but it remained unclear whether they could be responsible for loss of response.
Currently, clinical follow-up of patients during treatment only includes monitoring of serum IFX
concentration which is performed exclusively using ELISA immunoassay [239]. ELISA assays
are fast and easy to use, however they may exhibit specificity issues, potentially leading to false
positive or negative results [240,241], and cannot provide information regarding the structure of
IFX [242]. In addition, mAb quantification, typically in the range of 0.5-14 µg·mL-1, achieved
using ELISA methods may potentially exhibit uncontrolled biases because of the absence of
internal standard to normalize eventual component loss during washing steps for example [197].
Mass spectrometry (MS) has gradually taken a leading role in the structural
characterization and quantification of proteins due to its optimal specificity, sensitivity and
- 131 -
structural information [243,244]. Liquid chromatography hyphenated to tandem mass

spectrometry (LC-MS/MS) represents the most commonly used technique for the analysis of
peptide mixtures [245]. The use of heavy-isotope labeled internal standards enabled the accurate
and robust quantification of proteins in biological matrices using MS through normalization of
experimental variabilities due to sample preparation and analysis [175]. Capillary zone
electrophoresis (CZE) has recently demonstrated to be particularly relevant for peptide separation.
Indeed, the electrophoretic migration generated in CZE enables the separation of analytes with
different charge states in solution and/or different hydrodynamic radii [154]. Thereby, CZE is
suitable for the separation of short or polar peptides, such as glycopeptides, in parallel with longer
and more apolar ones in the same analysis [110]. Therefore, the hyphenation of CZE to MS has
recently proven to be particularly relevant for the characterization of the primary structure of mAbs
[96,109,141], with the possibility to achieve 100 % sequence coverage using a single analysis [110].
In the present work, we have designed and implemented a novel CZE-MS/MS method for
the absolute quantification and simultaneous characterization of the primary structure of IFX in
serum samples from Crohn’s disease patients. A specific sample preparation protocol was
developed to extract IFX from biological samples while ensuring optimal compatibility with the
subsequent CZE-MS/MS analysis. A full method validation was performed to demonstrate the
characteristics of the developed CZE-MS/MS method. Furthermore, the CZE-MS/MS data were
used to characterize the N-glycosylation of IFX in biological samples by differentiating the
structure and relative abundance of glycans. The data could also be used to characterize different
PTMs for which an innovative normalization methodology was incorporated to avoid the
introduction of bias regarding the estimation of the modification levels. Finally, the CZE-MS/MS
analytical workflow was applied to a series of serums from patients treated with IFX for Crohn’s
disease, highlighting that the structural characterization of mAb after administration could be
essential to understand variations in clinical response. The aim of the study was to provide an
accurate analytical strategy delivering in biological samples, simultaneous quantification of IFX
and PTMs characterization post-administration. The CE-MS/MS strategy could be further applied
in a cohort study for instance to investigate if clinical loss of response might be associated with
specific PTMs.
▪ Chemicals. Chemicals used were of high purity grade and purchased from Merck Sigma-
Aldrich (Saint Louis, MO, USA) if not stated otherwise. IFX (IFX, Remicade®) samples are
EMA/FDA-approved formulation purchased from the manufacturer (Merck Sharp and Dohme).
RapiGest SF surfactant was purchased from Waters (Milford, MA). biotinylated TNF-α from R&D
- 132 -
System was obtained from Biotechne. Sequencing Grade Modified Trypsin was purchased from
Promega Corporation, (Madison, WI, USA). PBS solution (Phosphate buffer saline) was
purchased from Gibco ThermoFisher as tablets for reconstitution in water.
▪ Standards and QCs with blank serums. Blank serums were provided by the French
institute of blood (Paris, France) after extraction and purification from total blood. Calibration
samples and quality control (QC) samples were prepared by spiking known concentrations of IFX
to the blank serum for method evaluation.
▪ Serum from Crohn’s disease patients. Serum samples from 24 patients were obtained
from the gastro-enterology department of Saint-Louis hospital (Paris, France). The patients had
been diagnosed with Crohn’s disease for at least 3 months and were receiving regular IFX
injections. Gender, age and time since last IFX administration prior to serum collection were
indicated. 100 µL of serum per patient was collected, and the SIL-IFX internal standard (1 µg) was added.
▪ Sample preparation. Spiked serums used as calibrants, and patient serums were prepared
in exactly the same manner. For IFX affinity purification, 217 µL of Streptavidin M-280
DynabeadsTM (Fisher scientific Invitrogen, Carlsbad, CA) were washed with PBS solution. 148
µL of biotinylated TNF-α (10 µg·mL-1) was added and the mixture was left at RT for 1h. Excess
biotinylated TNF-α was removed by three consecutive washes with PBS. Afterward, a volume of
100 µL of serum was added to the functionalized magnetic beads and the mixture was left at RT
for 1 hour to ensure optimal capture of IFX and SIL-IFX by the immobilized TNF-α. After
incubation, the serum was removed and 50 µL of MeOH/H2O/FA mixture (48.5/48.5/3; v/v/v) was
added before incubation for 10min. The supernatant was collected, and this step was repeated.
Supernatants were pooled and dried for 2 hours using a miVac DNA concentrator systemTM
(Genevac), at 35°C. The sample was reconstituted in 70 µL of 50 mM ammonium bicarbonate (pH
8). The last step followed a denaturation-reduction-alkylation-digestion protocol commonly used
for protein digestion [119]. Extracted mAbs were denatured with 5 µL of RapiGest SFTM at 0.1%,
at 80°C for 10 min. Consequently, 10 µL of 50 mM dithiothreitol was added and the sample was
left at 80°C for 20 min to reduce disulfide bridges. The solution was cooled to room temperature,
and 10 µL of 50 mM iodoacetamide was added. The sample was incubated in the dark for 20 min
to perform cysteine alkylation. 1 µl of trypsin 0.25 g·L-1 was introduced to the sample and left at
20°C for 2 h. 1 µl of trypsin was again added prior incubation at 37°C overnight. Afterward, 1 µL
of formic acid 98% was added to quench the reaction. The peptide mixtures were finally
evaporated and reconstituted in 5 µL ammonium acetate 100 mM, pH 4.
- 133 -
▪ CZE-ESI-MS/MS. Experiments were performed using a CESI8000® Capillary

Electrophoresis system (Sciex separations, Darmstadt, Germany) coupled by mean of a sheathless
CE-ESI-MS interface to a Sciex 5600 TTOF mass spectrometer (Darmstadt, Germany) operated
by Analyst® software (Sciex, Darmstadt, Germany). A detailed description of this interface was
provided by Haselberg et al.(2010) [246]. Separation was performed using a homemade bare-fused
silica capillary (total length 100 cm; 30 μm i.d.), the outlet end of which was etched with
hydrofluoric acid [247], resulting in a 2-cm porous tip positioned inside the cannula of the
sheathless interface. The cannula was filled through a second capillary (total length 80 cm; 50 μm
i.d.) with background electrolyte (BGE) consisting of 10 % acetic acid to maintain electrical
contact between the CE inlet and outlet electrodes [84]. Concerning CZE-ESI-MS/MS conditions,
a preconcentration step by transient isotachophoresis was implemented by injecting the peptide
digest reconstituted in a leading electrolyte of ammonium acetate (pH 4), which is more conductive
than the BGE. The analytes were therefore first focused in the capillary and then separated by zone
electrophoresis. 68 nL of sample was injected hydrodynamically (5 psi, 100 sec) and a voltage of
23 kV was applied. The total analysis time is 60 min. The ESI source parameters were set as
follows: ESI voltage 1.5 kV, while gas supplies (GS1 and GS2) were turned off, source heating
temperature 100 °C, and curtain gas value 2. Experiments were performed in Top20 information-
dependent acquisition (IDA, Sciex), and the accumulation time was 250 ms for MS scans and 80
ms for MS/MS scans, leading to a total duty cycle of 1.9 s. Mass/charge (m/z) range was for
100−2000 in MS and 50−2000 for MS/MS. SIL-IFX with arginine and lysine residues labeled with
(13C; 15N) was used as an internal standard for quantification to correct for variability originating
from sample preparation. DILLTQSPAILSVSPGER (LC01) was selected as the peptide for
quantification because it is strictly specific to IFX, which was verified using a blast with a human
database [https://blast.ncbi.nlm.nih.gov/Blast.cgi], and the absence of known PTMs. LC01 was
therefore located in IFX variable part and was found to be specific to this mAb. Data were obtained
as .wiff and were analyzed through Skyline software. The peak ratio (IFX/SIL-IFX) were
calculated using this software.
▪ CE-MS/MS quantification method validation. The quantification method was validated

using blank serum spiked with known concentrations of IFX and stable-isotope labeled infliximab
(SIL-IFX) internal standard. Statistical validation of the method was performed in order to comply
with both European medicines agency (EMA) and food and drug administration (FDA) guidelines
[160,161]. Indeed, both guidelines are mainly similar, but there are minor differences regarding
the threshold of acceptance criteria or methodology [162]. Therefore, for each parameter, the most
stringent criteria and the largest number of replicates were systematically applied. For linearity
assessment, 5 calibration curves were carried out over 6 concentration points over a time span of
- 134 -
3 months. QC samples spiked with IFX at 4 different concentrations (QC1:0.5; QC2:1.5; QC3:12
and QC4:19 µg·mL-1) were analyzed, representing a total of 12 replicates for each QC level,
divided into 4 separate batches run on different days. The trueness and precision calculated from
the QC sample replicates were expressed as percent bias, and relative standard deviation (RSD%),
respectively. LOD and LOQ were estimated by signal-to-noise ratio (>3 for LOD and >10 for
LOQ). The selectivity of the method was determined using 6 blank human serum samples by
extraction of the m/z corresponding to the LC01 peptide and expressed as a percentage of the IFX’s
LOQ signal. Specificity was tested in triplicate using serum spiked with adalimumab, etanercept
and cetuximab at 5 µg·mL-1, alongside with IFX at 19 µg·mL-1 and compared to serum spiked
with IFX alone. Matrix effects were studied using the post-extraction addition protocol. MS signal
of IFX (1.5 µg·mL-1) in a standard solution of H2O, was compared to a post-extraction solution
spiked with the same concentration. The matrix factor of IFX (IFX peak area in the presence of
matrix divided by IFX peak area in the absence of matrix) was divided by that of SIL-IFX. The
stability of the peptide mixture was evaluated by 3 freeze and thaw cycles. After each freeze/thaw
cycle, samples were analyzed with CE-MS/MS. Stability was also determined for storage in the
autosampler (10°C). Three replicates were stored in the autosampler and injected into the CE-
MS/MS instrument every 2 hours. The effect of hemolysis, lipemia and icterus on IFX
quantification was evaluated. IFX-free serums with these characteristics were provided by the
Lariboisière hospital (Paris, France). IFX concentration back-calculation was evaluated after
spiking at 19 µg·mL-1 and the same samples were then analyzed by ELISA assay using a
Promonitor® IFX kit, following the supplier’s instructions. Correlation between ELISA and CE-
MS/MS quantification results was determined using linear regression analysis.
▪ Relative Quantification of PTMs. The m/z of ions corresponding to peptides containing

PTM hotspots were extracted from the MS and MS/MS data. Thus, 6 glycans (G0F, G1F, G2F,
G0FN and M5) were characterized in addition to 6 amino acid PTMs: 4 asparagine deamidations
(N57 (heavy chain: HC), N137 (light chain: LC), N158 (LC) and N387 (HC)) and 2 aspartate
isomerizations (D283 (HC) and D404 (HC)). The localization of the different PTMs on IFX amino
acid sequence was represented in Figure 8.S1. They were selected because they represented PTM
hotspots of the studied mAbs [17,18,193]. For a monitored amino acid (e.g. labeled “L”), its level
of modification, obtained by CE-MS/MS analysis, in IFX and SIL-IFX compounds, was
SIL
determined for spiked serums (𝐿IFX IFX 𝑆𝐼𝐿
ref and 𝐿ref ) and patient serums (𝐿p and 𝐿p ).
- 135 -
Table 8.1. Expression of the different steps potentially affecting the PTM levels of IFX and SIL-IFX
PTM level generated at each stage of mAbs life PTM level

Patient measured by CE-
Production Sample preparation MS/MS analysis
administration
IFX IFX
Spiked IFX 𝑓prod 𝑓prep A (1- 𝑓prod ) 𝐿IFX
ref = ∑ steps
serums
SIL SIL
(ref) SIL-IFX 𝑓prod 𝑓prep A (1-𝑓prod ) 𝐿SIL
ref = ∑ steps
IFX IFX IFX IFX IFX

Patient IFX 𝑓prod 𝑓blood (1- 𝑓prod ) 𝑓prep B (1- 𝑓prod )(1-𝑓blood ) 𝐿IFX
p = ∑ steps
serums
SIL SIL
(p) SIL-IFX 𝑓prod 𝑓prep B (1-𝑓prod ) 𝐿𝑆𝐼𝐿
p = ∑ steps
LXY: Level of modification of the PTM “L”, for the analyte “Y” (IF or SIL-IF ) that occurred in the step “ ”
frefY: Level of modification of the PTM “L”, for the analyte “Y” (IF or SIL-IFX) that is observed in CE-MS/MS analysis of a
healthy serum spiked with IFX and SIL-IFX
fpY: Level of modification of the PTM “L”, for the analyte “Y” (IF or SIL-IFX) that is observed in CE-MS/MS analysis of a
patient serum spiked with SIL-IFX
The normalization strategy was developed to remove possible endogenous structural changes due
to sample preparation and/or storage. The proportion of induced PTM is given in Table 8.1 for the
3 different steps that IFX and SIL-IFX undergo during their lifetime. Table 8.1 also includes (last
row) the final level of this PTM, measured by CE-MS/MS, which corresponds to the sum of each
step. It can be noted that the sample preparation affects similarly IFX and SIL-IFX in the same
sample but differently in two distinct samples (𝑓prep A and 𝑓prep B) to address errors associated with
IFX
pipette volumes or CE-MS/MS analysis. 𝑓blood represents the proportion of the studied amino acid
that underwent modification during the residence time in the patient's body. As only infliximab is
administrated to patients, the corresponding SIL-IFX case is grayed out. Normalization consists of
IFX
extracting 𝑓blood from data collected by CE-MS/MS (last row), which led to the equation (1), using
Mathematica® software (Wolfram).
Level of PTM of an amino acid “L” occurring in blood of patients (%) = (8.1)
IFX SIL IFX SIL SIL IFX SIL
𝐿IFX
p −𝐿ref −𝐿p +𝐿ref 𝐿p +𝐿ref −𝐿p Lref
𝑓blood =
1−𝐿IFX SIL IFX SIL
ref −𝐿p +𝐿ref 𝐿p
IFX
Bilateral statistical tests were performed to determine whether the 𝑓blood calculated for each
patient’s serum was significantly different from the 30 spiked serums used as controls. The p-value
corresponding to the probability that this hypothesis is true was calculated by applying a Welch's
two-tailed t-test. The critical value for the p-value to be considered unlikely was 0.05.
- 136 -

8.3.1. CE-MS/MS method development and validation
The designed analytical workflow, represented in Figure 8.1, consisted of the specific extraction
of IFX and the stable-isotope labeled infliximab (SIL-IFX) internal standard from serum. The
extraction was performed using recombinant TNF-α immobilized on in-house prepared
ferromagnetic beads. Accordingly, the extracted IFX and SIL-IFX underwent digestion, and the
resulting peptide mixture was then separated and analyzed by high sensitivity CE-MS/MS analysis.
Method development was performed using blank serums spiked with known concentrations of IFX
and SIL-IFX. The spiked serums were used to complete the validation of the CE-MS/MS
quantification method and to demonstrate the ability to characterize different types of PTMs,
including IFX N-glycosylation, Asn deamidation and Asp isomerization, from the same
experiment.
SIL In liximab
Extraction
CE MS/MS
separation analysis
Patient s SIL Digestion
serum addition
collection
Phosphate buffer Acidic buffer TNF
Ferromagnetic
beads
IF
SIL IF
Figure 8.1. Schematic representation of the analytical workflow developed for the absolute quantification and structural
characterization of infliximab in human serum using CE-MS/MS analysis.
Quantification of IFX was performed using a label-free method based on the MS signal
corresponding to the LC01 peptide, which was selected because it is proteotypic for IFX (Table
8.2). For each CE-MS/MS analysis, unambiguous peptide identification was provided by high-
resolution m/z ratio measurement in addition to the peptide fragment fingerprint (Figure 6.2,
chapter 6). Statistical validation of the CE-MS/MS quantification method was conducted to
determine the performance of the analysis. The linearity of the method was demonstrated over the
- 137 -
concentration range 0.4-25 µg·mL-1 (Figure 8.S2). This range corresponds to the concentrations
typically observed in IFX-treated patients [248].
In addition, the CE-MS/MS analysis allowed to achieve a LOD of 0.06 µg·mL-1 (0.4 nM)
and a LOQ of 0.22 µg·mL-1 (1.5 nM) respectively (Table 8.2). The method was found to be
selective as the interferences in blank serums remained less than 15% of the LOQ signal of IFX.
The CE-MS/MS method was applied to serums spiked with other biotherapeutics (adalimumab,
etanercept and cetuximab). The bias from the nominal IFX concentration for spiked serums was
2.1 ± 1.3 %. Thus, it was concluded that CE-MS/MS quantification was not significantly affected
by the presence of other biotherapeutics, although adalimumab and etanercept also target TNF-α.
They were most likely extracted concomitantly during sample preparation but could not further
interfere as the LC01 peptide was strictly specific to IFX. The results highlighted the outstanding
specificity of the IFX proteotypic peptide quantification delivered by the CE-MS/MS method.
Trueness and precision were estimated using quality control (QC) samples (Table 8.2) for
intra-day and inter-day replicates. RSD for replicates and biases from the nominal concentration
were systematically below 15% underscoring the appropriate accuracy of the method. The
experiments showed that matrix effects remained limited with values lower than 15 % (Table 8.2).
No carry-over could be observed when the analysis of the blank samples was performed
immediately after the QC4 samples.
Table 8.2. Compilation of the results obtained for the statistical validation of the CE-MS/MS method for the absolute
quantification of infliximab.
Sequence DILLTQSPAILSVSPGER (LC01)
Concentration range 0.4-25 µg·mL-1
Equation 0.1108 𝑥 − 0.027
R² 0.989
LOD 0.06 ± 0.02 µg·mL-1
LOQ 0.22 ± 0.08 µg·mL-1
Selectivity (n=6) blank signal ≤ 2 ± 2 % IFX LOQ
Specificity (%Bias) a 2.1 ± 1.3 %
Matrix effect b ≤ 11 ± 4 %
Level of QC QC1 (0.5 µg·mL-1) QC2 (1.5 µg·mL-1) QC3 (12 µg·mL-1) QC4 (19 µg·mL-1)
Intra-days statistics
Precision (RSD %)b 5.8 2.0 3.1 4.2
Trueness (% Bias) a - 4.9 - 11.1 0.8 - 2.6
Inter-days statistics
Precision (RSD %) 7.7 5.6 7.5 4.5
Trueness (% Bias) 7.0 - 6.4 9.6 - 0.9
a % bias: determined as : (measured conc. – nominal conc.)/nominal conc. *100%.
b RSD : determined as : standard deviation/ABS(mean). *100%.
- 138 -
Finally, the recovery was found to be above 85 % after three consecutive freeze-thaw
cycles, illustrating the stability of the sample. Similarly, storage of a sample for 15h in the
instrument autosampler did not influence the accuracy of the quantification with a bias from
nominal concentration below 2 % (Figure 8.S3). As a consequence, the characteristics of the CE-
MS/MS method determined from the statistical validation showed the validity of the absolute
quantification of IFX.
Additional experiments were conducted to complement the method validation to further

investigate the properties of the CE-MS/MS quantification method. CE-MS/MS quantification was
performed on IFX-spiked icteric, hemolyzed and lipemic serums to assess the impact of sample
type on the analysis. The different serum types considered represented common alterations that
affect the general aspect of the serum and may alter matrix effects due to the presence of
endogenous interfering compounds in the serum [249]. The results yielded an average bias from
the nominal concentration of 3.0 %, 0.3 % and 0.7 % for hemolyzed, icteric and lipemic serums,
respectively (Figure 8.2). Therefore, quantification by CE-MS/MS demonstrated excellent
accuracy that was not affected by the type of serum analyzed. The same samples were also
quantified using a commercial ELISA assay. As emphasized in Figure 8.2, the experiments
exhibited significantly higher biases of 9.7 %, 4.3 % and 15.6 % for hemolyzed, lipemic and icteric
serums respectively. It is noteworthy to mention that the ELISA quantification showed a
systematic underestimation of IFX even in normal serum.
Figure 8.2. Infliximab quantification accuracy and repeatability for different types of spiked serums (19 µg·mL-1) measured using
ELISA assay and CE-MS/MS analysis (n=3). Hemolyzed serum typically contained products of red blood cells lysis, lipemic serum
exhibited an important turbidity due to the accumulation of lipoproteins and icteric serum contained an excess of bilirubin.
Previous reports described the possibility of using CE-MS/MS to characterize mAbs amino
sequence, N-glycosylation and amino acid PTMs in a single analysis [154]. CE-MS/MS analysis
achieved a sequence coverage of 90 %. Only a single long peptide composed of 63 amino acids
could not be identified due to poor ionization, however it did not present any PTMs hotspots. From
this observation, we studied the possibility of characterizing IFX N-glycosylation in serum
- 139 -
samples simultaneously with quantification using CE-MS/MS data. Indeed, CE-MS/MS

quantification method is derived from a quantitative proteomics methodology, hence the collected
MS and MS/MS data also include IFX peptides exhibiting PTMs. IFX contains a single
N-glycosylation site located in the HC constant domain of the mAb. Characterization of the
N-glycosylation was achieved through the intermediate of the glycopeptide EEQYNSTYR [156].
CE-MS/MS data demonstrated robust characterization of the 6 major glycans for spiked serums
with IFX concentrations above 4 µg·mL-1 (Figure 7.1, chapter 7). The processing of the MS/MS
spectra allowed systematic characterization of the glycosylation structure. MS signals
corresponding to the glycopeptide bearing different glycans were considered in order to estimate
the relative abundance of the different glycans. The CE-MS/MS glycoprofiles were established for
IFX-spiked serum samples and compared to IFX commercial solution (Figure 8.3). CE-MS/MS
glycoprofiles showed no significant differences between the commercial IFX solution and the
spiked serum samples, demonstrating the reliability of the relative quantification of glycosylation
delivered by the analytical workflow. In addition, the IFX glycoprofile was similar to previous
reports performed on the commercial IFX product [156,250]. The level of performance achieved
in the characterization of N-glycosylation was explained by the ability to partially separate
glycopeptides bearing different glycosylation thanks to the electrokinetically driven separation of
CZE (Figure 7.1, chapiter 7). As a result, the glycopeptides are gradually transferred to the ESI
ionization source, resulting in optimal sensitivity. Finally, because the characterization was
performed at the glycopeptide level, independent localization and characterization could be
envisaged even in the case of mAbs incorporating multiple glycosylation sites.
Figure 8.3. Glycoprofile of IFX obtained using CE-MS/MS method developed for spiked serum (green bars, n=30) and for IFX
commercial product (white bars, n=15). The structure of the glycan linked to the Asn of the EEQYNSTYR peptide is presented
above each bar. Error bars presents the standard deviation among the replicates.
- 140 -
Similarly to N-glycosylation, the possibility of performing hotspot characterization of amino acid

PTMs simultaneously to IFX quantification was investigated. The study focused on 4 asparagine
deamidations (N158 LC, N137 LC, N387 HC and N57 HC) and 2 aspartate isomerizations (D283 HC
and D404 HC) mentioned in the literature to potentially affect mAb activity [251]. CE-MS/MS data
obtained from IFX-spiked serums demonstrated the successful characterization of the 6 PTMs of
interest in a reproducible manner, concomitantly to IFX quantification and N-glycosylation
characterization. The selectivity of CE allowed a systematic baseline separation of modified
peptides from their unmodified counterparts (Figure 8.S4), which enabled to perform the relative
quantification despite MS isotopic profiles overlap. Indeed, asparagine deamidation involved a
mass difference of only 0.98 Da whereas aspartate isomerization did not induce any mass
difference. As a consequence, it is essential to separate the two peptides before their transfer to the
MS instrument to provide optimal sensitivity and, in the case of isomerization, to distinguish
peptides carrying different aspartate isomers. The MS signals corresponding to the intact peptide
and its modified counterpart could be used to determine the levels of modification for each PTM
independently. The modification levels measured for the different PTMs by CE-MS/MS analysis
were compared for IFX-spiked serums and IFX commercial product. Results showed no significant
differences between the IFX commercial product and serum samples spiked with IFX,
demonstrating that serum purification did not introduce bias into the analysis (Figure 8.4).
Figure 8.4. Modification level determined using CE-MS/MS analysis for 4 asparagine deamidations and 2 aspartate
isomerization in the case of IFX spiked serums (green bars, n=30), or in IFX commercial product (white bars, n=15). Error bars
represent the standard deviation between replicates.
As a result, the developed CE-MS/MS analytical strategy demonstrated adequate accuracy and
repeatability for the quantification of IFX in biological samples through extensive method
validation. Especially, the analytical strategy delivered substantial specificity that resulted in the
absence of interferences, even for samples containing other types of biopharmaceuticals or in the
case of altered serum samples. Furthermore, the quantification of IFX by CE-MS/MS was found
to be as efficient as, if not better than, the ELISA quantification which is currently the reference
method for this type of analysis. To our knowledge, this is the first time that the CE-MS technique
- 141 -
has been described for the absolute quantification of a protein. Concomitantly, the structure of the
N-glycosylation could be unambiguously characterized, and their relative abundance estimated
from serum samples with IFX, using the same CE-MS/MS data. The major glycosylations
successfully detected by the CE-MS/MS method represented more than 90% of the IFX content
[156]. Since the characterization was performed at the glycopeptide level, independent localization
and characterization could be envisaged even in the case of mAbs incorporating multiple
glycosylation sites. Finally, the CE-MS/MS method has demonstrated the possibility of
simultaneously characterizing faint amino acid PTMs in a relevant and accurate manner. For every
quantitative and structural aspect considered, the performance of the CE-MS/MS method was fully
compatible with the characterization of IFX for serum samples from patients treated for Crohn’s
disease. The ability to quantify a protein in a complex biological sample together with an advanced
characterization of its primary structure has never been described before and represents a
significant advance from an analytical chemistry perspective. This level of performance was
achieved due to the excellent sample preparation protocol developed, which allowed optimal
compatibility with CE-MS/MS analysis, in addition to the relevant characteristics of the CE
separation mechanism and state-of-the-art CE-MS coupling. Quantification of IFX in patient
serums has been performed by ELISA assays [252] or by LC-MS/MS [175,196,253], but never in
conjunction with structural characterization. Structural assessment of IFX PTMs has mostly been
done for biosimilarity assessment and production control [250,254,255]. This is the first time that
such level of characterization is demonstrated under conditions consistent with analysis directly
after drug administration to patients.
8.3.2. CE-MS/MS analysis of patient serums treated using IFX
The CE-MS/MS analytical workflow was consequently applied to 24 IFX-treated serums from
patients diagnosed with Crohn’s disease. The CE-MS/MS analysis was performed to quantify free
IFX in patient serums in addition to the structural characterization in terms of N-glycosylation and
amino acid PTMs. The CE-MS/MS data allowed the successful quantification of IFX for all patient
samples (Table 8.S1). Among the 24 patient serums characterized, 7 were found at concentrations
above 25 µg·mL-1 and required prior dilution to fit within the calibration range. Patient samples
were also quantified using a commercially available ELISA assay to confirm the validity of the
CE-MS/MS results (Table 8.S1). The comparison of CE-MS/MS and ELISA analyses, shown in
Figure 8.5, exhibited a good correlation (R² = 0.963) between the two techniques. However, a
limited tendency towards lower quantification in the case of ELISA assay compared to CE-MS/MS
analysis could be observed. This difference was consistent with the systematic underestimation
provided by ELISA assay that could be observed during method development (Figure 8.2). El
- 142 -
Amrani et al.(2016) also described a similar trend when comparing LC-MS/MS analysis with the
ELISA assay [175]. They attributed this discrepancy to the ELISA assay, which requires two
distinct interactions of IFX, one with the plate, and the other with the detection reagent. Therefore,
the experimental procedure could lead to a biased quantification in case of suboptimal interactions
with either of the two required interactions. In contrast, the affinity extraction procedure designed
in our case for sample preparation required only a single high-affinity interaction, in addition to
the CE-MS/MS analysis which was systematically normalized with the SIL-IFX internal standard.
Figure 8.5. Comparison of the quantification of IFX achieved in patient serums using ELISA assay versus CE-MS/MS
analysis (n=24). Linear regression is presented.
For the characterization of IFX N-glycosylation and amino acid PTMs, only 3 out of the 24
available samples exhibited an IFX concentration lower than 4 µg·mL-1 and were therefore not
considered because the performance of the CE-MS/MS method could not be guaranteed, as
demonstrated during method development. In addition, IFX may experience artifactual
modifications, for example due to sample storage and/or preparation, which could potentially alter
the reliability of the structural characterization. For example, endogenous deamidation of
asparagine may be generated during proteolytic digestion due to the use of ammonium bicarbonate
at mildly alkaline pH [125,256]. The digestion protocol was not modified because the alkaline pH
provided the maximum enzymatic activity necessary to achieve an optimal LOQ. However, the
objective of the CE-MS/MS method was to characterize the structural changes and to determine
the levels of modifications occurring after administration to the patient. As a consequence, an
innovative normalization method was developed to systematically subtract artifactual
modifications and provide an accurate estimate of the levels of PTMs generated during the
residence time of IFX in the patient’s system. Figure 8.6 summarizes the implemented
normalization strategy. For each PTM, the level of endogenous modification was determined for
IFX and SIL-IFX internal standard using CE-MS/MS analysis on calibration samples. Afterward,
the modification level strictly due to IFX residence in the system of the patient could be calculated
by comparing the CE-MS/MS analysis of the calibrants and patient serums. The mathematical
- 143 -
expression of each parameter (Figure 8.6) enabled the establishment of equation 1, which provides
a systematic normalization the level of modification occurring during the residence time of IFX in
the patient’s organism (cf. material and methods).
Figure 8.6. Schematic representation of the procedure for the determination of the level of modification of an amino acid due
to IFX residence in a patient’s organism (𝑓𝑏𝑙𝑜𝑜𝑑
𝐼𝐹𝑋
). The strategy for normalization of PTM levels included CE-MS/MS analysis of
the peptide of interest in the case of IFX (Lp ) and SIL-IFX (LpSIL) in the patient’s serum (left-hand panel) and similarly for IFX
IFX
(LrefIFX) and SIL-IFX (LrefSIL) in spiked serums (right-hand panel) in order to obtain the parameters required to calculate (𝑓𝑏𝑙𝑜𝑜𝑑
𝐼𝐹𝑋
)
using Equation 8.1 (Cf. experimental section, and Figure 8.S5 and 8.S6 for SIL-IFX information).
Concerning IFX N-glycosylation, CE-MS/MS analysis characterized the 6 major glycosylations

for serum samples from IFX-treated patients, and the MS data could be used to perform their
relative quantification (Table 8.S2). Using the CE-MS/MS data, the variation of the abundance of
each glycosylation during the IFX residence time in the organism of patients was calculated by
applying equation 8.1 (Figure 8.7). Regarding patient samples, the overall dispersion between the
different samples was consistent with the dispersion of the IFX-spiked serums used as controls
- 144 -
and reflected the standard variation of the CE-MS/MS method observed previously (Figure 8.3).
For the different types of glycans, a Welch’s t-test was conducted to determine whether the relative
abundance was significantly different in the patient serums compared to the control samples,
without assuming equal variances [257]. The results, compiled in Table 8.3, demonstrated that the
hypothesis that the two groups were statistically similar was rejected for G1F, G0N, G0FN and
M5, indicating a statistical difference (p-value < 0.05). Especially, patient samples presented 6-12
% lower M5 abundance than the mean value of control samples. In the case of G0FN proportion,
patient serums were approximately 5 % lower than controls. Thus, the CE-MS/MS results indicate
that the glycodistribution of IFX was slightly altered after administration, independent of the
patient. This observation could potentially be due to several IFX glycoforms exhibiting faster
clearance, leading to more rapid elimination of the concerned glycans. Goetze et al. (2011) have
shown that high-mannose glycan have faster serum clearance than other glycan forms, which is in
agreement with the results observed Figure 8.7 [258].
Figure 8.7. Glycan relative abundance variations for IFX during residence in patient’s blood after normalization measured using
CE-MS/MS analysis. Green dots = patients’ serums (n=21). Black dots = controls (n=30) that did not incubated in a human’s blood.
Regarding asparagine deamidation and aspartate isomerization, CE-MS/MS analysis demonstrated

consistent characterization of the different PTM hotspots for the 21 patient serums considered
(Table 8.S3). As with N-glycosylation, equation 1 was applied for normalization to estimate the
level of modification occurring during the residence time of IFX in the patient’s system. The
results, represented in Figure 8.8, showed the absence of significant levels of modification for the
amino acids N137, N158, N387, D283 and D404. In addition, Welch’s t-tests yielded p-values > 0.05,
proving that the control samples and patient serums were not significantly different (Table 8.3).
Several studies have investigated the conditions affecting PTMs, such as pH, temperature or
humidity. Typically, harsh conditions were used to generate significant degradations in a short
amount of time, but did not necessarily reflected conditions after administration [245,250].
Therefore, environmental conditions of IFX consequently to administration did not affect some
hotspot PTMs that are nevertheless observed under extreme conditions.
- 145 -
In the case of N57 deamidation, the analysis of patient serums exhibited significantly higher levels
of modification and important dispersion compared to the spiked serums (Figure 8.8), which was
confirmed by a p-value indicating significant differences (Table 8.3). Thus, CE-MS/MS analysis
revealed that N57 deamidation was occurring during IFX residence time. The residue N57 is located
in the complement determining region (CDR) of IFX, which interacts directly with TNF-α [211].
Therefore, deamidation of this residue to aspartate could potentially alter the interaction of IFX
with the corresponding antigen. Concerning Crohn’s disease patients, the anteriority since the last
IFX administration at the time of blood sampling was provided. To further understand the
evolution of IFX, the concentration measured in the patient serums and the level of N57
modification were plotted against the anteriority of the administration. As illustrated in Figure
8.9.a, the remaining IFX concentration was not influenced by the anteriority of the injection.
However, CE-MS/MS analysis demonstrated a gradual deamidation of the N57 residue to aspartate
as the IFX residence time was increased (Figure 8.9.b). This effect could not be observed for the
other asparagine residues suggesting a specific sensitivity of the amino acid N57. Also, the amount
of N57 deamidation was not related to the concentration of IFX in the characterized sample.
Figure 8.8. Proportion of PTMs induced to IFX during residence in patient’s blood 𝑳𝒃𝒍𝒐𝒐𝒅 , (n=21) (green dots) compared to the
values found in spiked serum taken as controls (black dots). For asparagine (N), the modification monitored was deamidation,
and for aspartate residues (D) the modification was isomerization.
Currently, the clinical follow-up of IFX-treated patients is performed by ELISA assay, which
strictly focuses on the evolution of mAb concentration after administration. The CE-MS/MS
analytical workflow demonstrated accurate quantification of IFX in patient serums, in addition to
characterizing N-glycosylation and amino acid PTMs hotspots. The advanced clinical follow-up
provided by CE-MS/MS demonstrated that monitoring IFX concentration may not be sufficient to
fully understand the complex dynamics regarding IFX evolution post-administration. Indeed, even
if the IFX concentration is successfully maintained within the therapeutic range over an extended
period of time, PTMs potentially affecting the potency of the biomolecule could occur, especially
since mAbs have a significantly prolonged serum half-life. Therefore, the CE-MS/MS
- 146 -
methodology, which provides simultaneous absolute quantification and advanced characterization

of PTMs, represents a relevant analytical methodology to study the outcome of mAbs at an
unprecedented level.
Table 8.3. P-values calculated from Welch’s t-test applied on patient serums compared to IFX spiked samples used as controls
(degree of freedom = 22, α = 0.05). Data of the two groups were compared for each PTMs monitored in this study, with p-value
< 0.05 indicating a significant difference between the two groups.
p-value
N-glycosylation
G0F 1.0E-01
G1F 5.0E-04
G2F 1.4E-01
G0FN 1.8E-07
G0N 2.0E-03
M5 6.3E-08
Amino acid PTMs
N57 1.5E-07
N158 2.4E-01
N137 3.9E-01
N387 2.3E-01
D283 3.7E-01
D404 7.9E-01
Figure 8.9. a. Evolution of the concentration of Infliximab in patient serums with anteriority of the administration to patient
(n=23). b. Evolution of the deamidated level of N57 with anteriority of the administration to patient (n=21).
- 147 -
8.4. Conclusion
In the present work, we developed a novel analytical strategy based on CE-MS/MS analysis in
order to simultaneously perform absolute quantification of IFX, characterization of the 6 major N-
glycosylations and 6 hotspots amino acid PTMs in serum samples in a single analysis. The
validation of the CE-MS/MS method demonstrated relevant analytical performances for the
analysis of serum samples from IFX-treated patients, especially regarding specificity and
sensitivity. The results obtained proved the feasibility of absolute protein quantification using CE-
MS/MS analysis. Thus, the developed analytical workflow provided an accurate quantification
while avoiding matrix effects, that may potentially interfere in the case of ELISA assay.
Consequently, the CE-MS/MS workflow was applied to the analysis of serum samples collected
from patients treated for Crohn’s disease using IFX. The experimental results provided a reliable
quantification of IFX. Concerning the structural characterization, an original data treatment
methodology was developed to confidently estimate the level of PTMs that occurred exclusively
during IFX residence time in the organism of patients. Thus, CE-MS/MS data allowed the
identification of structural modifications of IFX occurring following its administration to the
patient. In particular, the analysis of patient serums using the CE-MS/MS method developed
identified a correlation showing progressive deamidation of the residue N57 which had the
particularity of being located in the CDR of IFX. However, the evolution of the IFX concentration
exhibited an important variability from patient-to-patient and could not be correlated with the
residence time of the protein in the system of the patient.
CE-MS/MS analytical strategy demonstrated the possibility to reach an additional dimension of

characterization regarding the evolution of therapeutic proteins after administration. In addition, it
is the first time that protein absolute quantification in biological samples could be realized
concomitantly to structural characterization regarding PTMs. The analytical strategy described
could represent a promising alternative in order to realize an advanced follow-up of patients treated
with therapeutic mAbs. Nevertheless, the elaborated multi-characterization offered by this method
would be particularly relevant for research, especially for a cohort study in order to better
understand the outcome of mAbs after administration. Disparities in clinical response among
patients are not yet fully understood and could be elucidated by a method that simultaneously links
PTM levels of hotspots and infliximab levels. The opportunity to obtain such comprehensive
information in a single analysis could significantly reduce the biases and errors associated with the
need for multiple workflows to independently obtain quantification, N-glycosylation and amino
acid PTMs characterization.
- 148 -
Finally, further research could enable to investigate the impact of the PTMs on the bioactivity of
therapeutic mAbs in order to potentially interpreting the complex behavior of this type of treatment
and attributing the occurrence of unusual clinical responses. The CE-MS/MS analysis can also be
transposed in a straightforward manner to other types of mAbs which in this case also illustrates
the potential of mAbs comprehensive follow-up using this methodology.
ACKNOWLEDGMENT
The authors would like to thank every person that contributed to the achievement of this article, especially the Professor M. Allez (Chief of Service
Gastro-enterology, Inserm U1160, Hospital Saint Louis, France) that provided serum samples of the cohort and Victor Chardiny for his help. They
thank Armand Leclerc for his helpful discussions, and his help for the normalization strategy. They also thank Antony Lechner for his great
contribution in the beginning of this project. This research work was supported by the Agence National de la Recherche as part of the project
MethAmAbs (project no. ANR-19-CE29-0009).
8.5. Supporting Information

Heavy Chain
EVKLEESGGG LVQPGGSMKL SCVASGFIFS NHWMNWVRQS PEKGLEWVAE IRSKSIN57SAT HYAESVKGRF TISRDDSKSA
VYLQMTDLRT EDTGVYYCSR NYYGSTYDYW GQGTTLTVSS ASTKGPSVFP LAPSSKSTSG GTAALGCLVK DYFPEPVTVS
WNSGALTSGV HTFPAVLQSS GLYSLSSVVT VPSSSLGTQT YICNVNHKPS NTKVDKKVEP KSCDKTHTCP PCPAPELLGG
PSVFLFPPKP KDTLMISRTP EVTCVVVDVS HEDPEVKFNW YVD283GVEVHNA KTKPREEQYN STYRVVSVLT VLHQDWLNGK
EYKCKVSNKA LPAPIEKTIS KAKGQPREPQ VYTLPPSRDE LTKNQVSLTC LVKGFYPSDI AVEWESN387GQP ENNYKTTPPV
LDSD404GSFFLY SKLTVDKSRW QQGNVFSCSV MHEALHNHYT QKSLSLSPG
Light Chain
DILLTQSPAI LSVSPGERVS FSCRASQFVG SSIHWYQQRT NGSPRLLIKY ASESMSGIPS RFSGSGSGTD FTLSINTVES EDIADYYCQQ
SHSWPFTFGS GTNLEVKRTV AAPSVFIFPP SDEQLKSGTA SVVCLLN137NFY PREAKVQWKV DN158ALQSGNSQ ESVTEQDSKD
STYSLSSTLT LSKADYEKHK VYACEVTHQG LSSPVTKSFN RGECK
Figure 8.S1. Amino acid sequence of infliximab. In red are presented the 6 amino acids PTMs sites studied and glycan site
N300. The sequence observed by the CE-MS/MS method is underlined.
Figure 8.S2. Linearity of the quantification’s method. a. Calibration curve obtained for Infliximab over the range 0.4-
25µg·mL-1, for 5 replicates per concentrations. Logarithm of both axes was applied. R²=0.989, standard error (SE)= 0.01, slope
1.07. b. Trueness of the back calculated concentrations of the calibration curves. Green dotted lines: acceptability limit defined by EMA
guideline. Error bars present the standard deviation among the replicates. Workflow of the Infliximab’s analysis in serum.
- 149 -
Figure 8.S3. Stability of the peptide’s mixture (after total workflow Figure 5.1) at high QC (19µg·mL-1) in different conditions:
a. Freeze and thaw cycles b. Short-term stability in auto sampler at 10°C. Error bars present the standard deviation among the
3 replicates.
Figure 8.S4. Separation of modified peptide from unmodified one for a. deamidation of N137 (LC) and b. isomerization of D283
(HC) using Capillary Electrophoresis. Red amino acid is the one going through modification.
Figure 8.S5. Level of 4 asparagine deamidations and 2

Figure 8.S6. Glycoprofile of SIL-IFX in spiked blank serum
aspartate isomerization obtained in SIL-IFX in spiked
(green bars, n=30, 𝑳𝒓𝒆𝒇 𝑺𝑰𝑳 ), or in pure product digested (white
blank serum (green bars, n=30, 𝑳𝒓𝒆𝒇 𝑺𝑰𝑳 ), or in pure product
bars, n=15). The structure of the glycan linked to the N of the
digested (white bars, n=15). Error bars presents the
EEQYNSTYR peptide is presented above each bar. Error bars
standard deviation among the replicates.
presents the standard deviation among the replicates.
- 150 -
Table 8.S1. Concentration of IFX in the 24 serums of patients measured by CE-MS/MS or ELISA assays.
Concentration of IFX found with Concentration of IFX found with
CE-MS/MS method (µg·mL-1) ELISA assay (µg·mL-1)
Patient n°1 4.8 1.9
Patient n°2 37.9 36.4
Patient n°3 39.7 30.2
Patient n°4 34.6 25.4
Patient n°5 30 22.6
Patient n°6 19.2 18.1
Patient n°10 17.1 12
Patient n°14 35.9 24.7
Patient n°16 15 9.6
Patient n°17 40.9 37.4
Patient n°18 12.2 6.7
Patient n°19 16.1 15.9
Patient n°20 13.5 12.0
Patient n°21 35.4 31.2
Patient n°24 0.2 0
Table 8.S2. Relative abundance of the 6 glycan of Infliximab of the 21 patients. This level corresponds to the measured one in
CE-MS/MS analysis (𝐿𝑝 𝐼𝐹𝑋 )
G0F G1F G2F G0FN G0N M5
Patient n°1 56% 16% 3% 10% 12% 3%
Patient n°2 57% 31% 3% 3% 2% 5%
Patient n°3 63% 20% 3% 4% 8% 2%
Patient n°4 67% 18% 1% 6% 7% 1%
Patient n°5 58% 33% 2% 1% 5% 2%
Patient n°6 59% 19% 1% 5% 11% 4%
Patient n°7 68% 18% 0% 5% 9% 0%
Patient n°8 53% 33% 2% 3% 4% 5%
Patient n°9 61% 29% 4% 2% 3% 2%
Patient n°10 62% 15% 1% 6% 12% 5%
Patient n°11 50% 27% 4% 3% 17% 0%
Patient n°12 54% 19% 2% 7% 13% 5%
Patient n°13 59% 17% 1% 10% 9% 3%
Patient n°14 54% 31% 1% 5% 5% 4%
Patient n°15 63% 22% 6% 0% 9% 0%
Patient n°16 61% 26% 5% 3% 5% 0%
Patient n°17 58% 31% 3% 3% 2% 2%
Patient n°18 59% 20% 3% 6% 12% 0%
Patient n°19 67% 16% 2% 4% 11% 0%
Patient n°20 59% 20% 2% 7% 12% 1%
Patient n°21 61% 28% 1% 2% 5% 3%
- 151 -
Table 8.S3. Relative abundance of the 6 other PTMs of Infliximab of the 21 patients. This level corresponds to the measured
one in CE-MS/MS analysis (𝐿𝑝 𝐼𝐹𝑋 )
N158 (LC) N137 (LC) N387 (HC) N57 (HC) D283 (HC) D404 (HC)
Patient n°1 11% 13% 62% 65% 4% 3%
Patient n°2 12% 13% 60% 14% 5% 3%
Patient n°3 12% 16% 57% 36% 7% 1%
Patient n°4 11% 15% 48% 37% 4% 3%
Patient n°5 11% 17% 56% 17% 6% 0%
Patient n°6 17% 24% 56% 23% 3% 1%
Patient n°7 13% 14% 56% 36% 12% 3%
Patient n°8 17% 18% 65% 17% 4% 1%
Patient n°9 13% 10% 54% 34% 6% 1%
Patient n°10 16% 17% 61% 17% 4% 0%
Patient n°11 17% 20% 67% 26% 7% 2%
Patient n°12 15% 19% 64% 27% 6% 0%
Patient n°13 13% 14% 59% 38% 11% 1%
Patient n°14 11% 10% 54% 10% 3% 1%
Patient n°15 16% 14% 58% 21% 16% 2%
Patient n°16 17% 13% 59% 46% 3% 0%
Patient n°17 12% 13% 55% 22% 8% 0%
Patient n°18 15% 14% 56% 37% 5% 1%
Patient n°19 16% 17% 58% 41% 7% 2%
Patient n°20 13% 11% 53% 46% 5% 3%
Patient n°21 12% 16% 50% 26% 4% 1%
- 152 -
Chapitre 9 – Caractérisation des PTM in vitro de l’infliximab original et des biosimilaires
C HAPITRE 9.
P REDICTION DES PTM POST - ADMINISTRATION DU
PRODUIT ORIGINAL DE L ’ INFLIXIMAB ET DE SES
BIOSIMILAIRES
Préambule
En 2022, parmi les 10 produits pharmaceutiques les plus vendus, 5 sont des anticorps
monoclonaux (adalimumab, dupilumab, nivolumab, ustekinumab et pembrolizumab). Cette
prédominance des anticorps thérapeutiques rend donc cruciale leur protection par brevet. Le
nombre de dépôts de brevets relatifs aux mAbs à l’Office Européen des Brevets (OEB) a
pratiquement doublé entre 2010 et 2017 [259]. Ces anticorps constituent une source de revenu
importante pour les entreprises pharmaceutiques les produisant. En 2016, l’infliximab
(Remicade®, MSD) a atteint la 7ème place du médicament le plus onéreux pour l’assurance maladie
en France, avec plus de 260 millions d’euros remboursés par la Sécurité sociale cette année-ci. Ces
chiffres mettent en évidence la raison pour laquelle les sociétés pharmaceutiques déposent des
brevets pour ces produits. Or, les brevets ont une durée de validité de près de 20 ans, et sont donc
passés dans le domaine public pour la première génération d’anticorps monoclonaux
thérapeutiques. Il est alors possible pour les entreprises tierces de produire des biosimilaires à ces
anticorps originaux de référence à moindre coût, permettant de réduire les frais des traitements
pour les patients [260]. Afin d’assurer la sécurité et l’efficacité du traitement, les biosimilaires
doivent néanmoins être soumis à une étude de biosimilarité particulièrement rigoureuse. En effet,
les autorités européennes et américaines ont établi des réglementations en termes de CQA pour
assurer de la similitude des biosimilaires envers le produit original de référence [142,261]. La
biosimilarité de produits peut s’avérer compliquée à établir pour des mAbs de grande complexité
structurale, comme dans le cas de l’Ertibux®, dont aucun biosimilaire n’est commercialisé [262].
L’infliximab (Remicade®, Janssen Biologics) fut le premier mAb à se voir obtenir
l’autorisation de mise sur le marché (AMM) de biosimilaires en Europe en 2013, avec Remsima®
ou Inflectra®, développé par Celltrion (Incheon, South Korea). En 2016, un nouveau biosimilaire
de l’infliximab, Flixabi® (Samsung Bioepis), fait son apparition et très récemment Zessly®
(Sandoz GmbH) est commercialisé en France aussi. La structure de ces anticorps biosimilaires est
très proche de celle du produit original. Pour commencer, tous doivent avoir exactement la même
séquence d’acides aminés, et présenter des niveaux similaires de PTM après production. Le
Remsima® et l’Inflectra® étant les premiers biosimilaires mis sur le marché, de nombreuses
études ont permis leur comparaison rigoureuse avec le Remicade® [250,263]. Après évaluation de
- 153 -
la biosimilarité des produits purs, des dégradations forcées sont généralement mises en œuvre, par
stress thermiques, mécaniques ou encore chimiques, afin d’étudier la stabilité du produit au cours
du temps [264,265]. Ces conditions de stress sont beaucoup plus extrêmes que celles rencontrées
par le produit thérapeutique lors de sa manufacture, son transport, son stockage ou encore sa
manipulation par le médecin, mais permettent, par l’exagération des dégradations, de déterminer
les conditions d’utilisation et de conservation du produit.
Dans la partie précédente, nous avons pu mettre en évidence que l’infliximab subit des
PTM in vivo, après administration dans l’organisme des patients. Nous avons notamment pu
démontrer qu’une asparagine localisée sur une zone CDR de cet anticorps présente une
déamidation progressive en fonction du temps passé de la biomolécule dans la circulation sanguine
du patient. La quantification de la concentration d’infliximab biodisponible dans l’organisme des
patients semble indiquer que la proportion de cette déamidation progressive n’est pas due à une
pharmacocinétique différente du mAb non modifié, mais bien à une PTM in vivo.
Ces résultats ont montré la nécessité d’aller au-delà de la simple quantification, mais
également de suivre l’évolution structurelle des biosimilaires et du produit original de référence,
afin de s’assurer d’une dégradation post-administration similaire. L’étude de biomolécules in vivo
est particulièrement difficile à mettre en place, notamment au vu de la disponibilité d’échantillons,
et de la complexité à engager une analyse de cohorte. Il est donc apparu essentiel de développer
des méthodologies in vitro, c’est-à-dire en dehors du système vivant, capables de prédire les
dégradations structurelles des mAbs thérapeutiques après leur administration [223]. Des études
ont démontré que l’incubation in vitro de mAbs thérapeutiques dans des sérums modèles sains à
37°C entraîne des proportions et cinétiques d’apparition de PTM (deaN, oxiM, isoD…etc.)
similaires aux données in vivo [266]. De façon analogue à l'évaluation de la stabilité des produits
lors de leur stockage en simulant les contraintes de stress, cette approche vise à recréer au mieux
les conditions environnementales du corps du patient pour évaluer la stabilité du mAb après son
administration. Ainsi, ce chapitre vise à présenter les travaux suivants ;
▪ Une approche permettant la simulation des conditions environnementales de l’organisme
des patients a été mise en place. Cette approche permet le suivi cinétique des PTM sur l'infliximab
suite à son incubation dans ces conditions spécifiques. Les PTM induites au cours de cette
incubation ont été quantifiées, après adaptation de la stratégie de normalisation établie au chapitre 7 ;
▪ L’approche a alors permis de comparer la stabilité post-administration des biosimilaires de
l’infliximab ;
• Puis, les données in vitro ont été confrontées à celles issues de l’analyse des patients pour
démontrer la validité de l’approche.
Ces travaux ont fait l’objet d’une publication dans la revue à comité de lecture Journal of
Pharmaceutical and Biomedical Analysis.
- 154 -
Publication: Post-translational modifications comparative identification

and kinetic study of infliximab innovator and biosimilars in serum using
capillary electrophoresis-tandem mass spectrometry
Tessa Reinert, Pascal Houzé, Nathalie Mignet, Yannis-Nicolas Francois, Rabah Gahoual
Journal of Pharmaceutical and Biomedical Analysis
2023, 234, 115541

10.1016/j.jpba.2023.115541
Abstract:
Despite reports indicating the potential impact of post translational modifications on the activity of a
monoclonal antibody, their prediction or monitoring post administration remains a challenge. In addition,
with the expiration of patents concerning the early generation of mAbs, the production of biosimilars is
constantly increasing. Structural differences of biosimilars compared to the innovator product are
commonly evaluated for the formulated product in the context of biosimilarity assessment. However,
estimating their structural outcome after administration is particularly difficult. Due to the complexity of in
vivo studies, there is a need to develop analytical strategies to predict PTMs consequently to their
administration and their impact on mAbs potency.
Here, we identified and evaluated the modification kinetics of 4 asparagine deamidations and 2
aspartate isomerizations of infliximab innovator product (Remicade®) and two biosimilars (Inflectra® and
Remsima®) in vitro using serum incubation at 37°C. The methodology was based on a bottom up approach
with capillary electrophoresis hyphenated with mass spectrometry analysis for an unequivocal assignment
of modified and unmodified forms. 2 asparagines demonstrated a gradual deamidation correlated with
incubation time. The specific extraction efficiency was evaluated to determine possible changes in the
antigen binding affinity of infliximab with the incubation. Results showed the possibility to achieve an
additional aspect concerning biosimilarity assessment, oriented on the study of the structural stability after
administration.
9.1. Introduction
Monoclonal antibodies (mAbs) and their related formats, including bispecific antibodies and
antibody-drug conjugates, are showing a tremendous interest as therapeutic treatments. As a result,
mAbs represent the fastest growing category of pharmaceutical products. More than 100
therapeutic mAbs are currently approved, and 12 have been approved for the first time in 2022
[195]. In addition, several patents for the first generation of mAbs have recently entered the public
domain. Therefore, the production of biosimilar mAbs, defined by regulatory authorities as an
- 155 -
equivalent product containing the active substance of an original biopharmaceutical product, is of

growing interest [142].
Based on immunoglobulin G (IgG), mAbs are tetrameric glycoproteins that exhibit a wide range
of microheterogeneity, due to their inherent structure, resulting in a significant number of variants.
Indeed, mAbs can undergo different types of post-translational modifications (PTMs) during
protein expression or storage, including asparagine deamidation (deaN), aspartate isomerization
(isoD), or N-glycosylation. Some PTMs, defined as hotspots, can potentially impact the
physicochemical properties, the structure and the conformation of mAbs. As a consequence, their
occurrence can alter the biological activity and the pharmacological properties of mAbs. For
instance, in the case of glycosylation, different studies have shown reduced receptor binding for
mAbs glycoforms exhibiting core-fucose N-glycans [258,267]. Similarly, a decrease in the
antigen-binding affinity of IgG1 mAbs due to the deamidation of an asparagine residue located in
the complement determining region (CDR) of the light chain (LC), has been described [16,18]. In
addition, changes in antibody-dependent cell-mediated cytotoxicity (ADCC) have been observed
in the case of a specific deaN occurring in the constant domain (Fc) of a mAb [13,19,147]. Thus,
the impact of PTMs on the biological activity of mAbs appears to depend on the localization and
the nature of the modification. Therefore, PTMs require extensive characterization to identify their
occurrence and to estimate their abundance, in order to ensure optimal efficacy and safety of the
product. Regarding the development and approval of biosimilar candidates, the assessment of
biosimilarity is achieved through detailed structural characterization and comparison to the
innovator mAb. Especially, the comparison of the two products should emphasize the absence of
differences concerning PTMs. In case of minor differences, further investigations are required to
demonstrate the absence of significant impact on biological activity and toxicity in order for the
product to be approved as a biosimilar [268].
Due to their structural complexity, significant research activities have been conducted in order to
establish analytical methods that deliver a comprehensive characterization of mAbs structure,
including PTMs. However, the described methods are strictly focused on production assessment
or product stability studies [106,109]. Recent studies have shown that mAbs may undergo PTMs
in vivo after administration of the product, which could potentially alter the efficacy of the
therapeutic protein [15,16]. Thus, it appears crucial to characterize structural modifications of
innovator mAbs, but also biosimilars, that will occur after injection of the product. Also, it is
important to determine whether the modifications generated have an impact on the efficacy of the
drug.
Infliximab (IFX) is a chimeric mAb targeting the tumor necrosis factor (TNF-α). In addition to the
innovator product, several biosimilars have recently been approved. Previous studies have
- 156 -
evaluated the structural similarity between the formulation product of the innovator infliximab and
the corresponding biosimilars [143,250], and after forced degradation of the mAbs [193,269].
However, studies predicting PTMs occurring after product administration are not yet described,
mainly because they require structural analysis of mAbs present in serum, which contains
important quantities of natural IgGs. Recently, we developed an analytical strategy based on
capillary electrophoresis hyphenated to tandem mass spectrometry (CE-MS/MS), which allowed
the absolute quantification and the characterization of mAbs PTMs extracted from serum using a
specific purification protocol [270].
In the present work, the innovator product corresponding to infliximab (Remicade®) was
characterized and compared to two biosimilar products (Inflectra® and Remsima®) concerning
the occurrence of PTMs, after incubation in human serum at 37°C. After affinity extraction from
serum samples, infliximab was characterized using CE-MS/MS to identify PTM hotspots and
determine their modification levels. Four distinctive asparagine deamidations and two aspartate
isomerizations, conventionally referred to as hotspots due to their potential impact on mAb
properties, located on both the light chain (LC) and heavy chain (HC), were investigated. The
study was designed to independently determine the modification kinetics for the different PTMs
over time, using conditions that mimic the post-administration environment of infliximab. To
prevent the introduction of any bias and/or artifactual PTMs due to sample treatment or analysis,
an innovative normalization strategy adapted to the determination of PTM modification levels,
was applied. CE-MS/MS experiments allowed to achieve a comparative study of the different
infliximab products regarding their stability after administration, demonstrating the need for this
type of study to further extend biosimilarity assessment. Results obtained in vitro using model
serum samples incubated under conditions that mimic the mAb environment were compared to
samples collected from treated patients to demonstrate the relevance of the analytical approach in
predicting the stability of the primary structure of mAbs after administration. Finally, the effect of
a deamidation identified in the CDR region on the infliximab/TNF-α interaction was studied by
means of specific extraction from serum.

▪ Chemicals. Chemical used were of high purity grade and purchased from Merck Sigma-
Aldrich (Saint-Louis, MO, USA) if not stated otherwise. Ultrapure water used to prepare buffers
and sample solutions was obtained using an ELGA Purelab UHQ PS water purification system
(Bucks, UK). Infliximab innovator Remicade® (Merck Sharp and Dohme), biosimilar Inflectra®
and Remsima® (Celltrion Healthcare) samples were EMA/FDA-approved formulations purchased
from the manufacturer. Stable-isotope labeled infliximab (SIL-IFX) internal standard was
- 157 -
purchased from Sigma-Aldrich (Saint-Louis, MO, USA). RapiGest SF surfactant was purchased
from Waters (Milford, MA). Streptavidin M-280 DynabeadsTM and biotinylated TNF-α were
obtained from Fisher Scientific Invitrogen (Carlsbad, CA). Sequencing grade modified trypsin was
purchased from Promega Corporation, (Madison, WI, USA). PBS (phosphate buffer saline)
solution was purchased from Gibco ThermoFisher as tablets for reconstitution in water. Blank
serums were provided by the French Institute of Blood (Paris, France). IFX stock solution at 1 g·L-1 was
prepared after reconstitution in H2O milliQ and stored at -20°C.
▪ Infliximab structural stability study in serum. A volume of 1 mL of human serum was spiked
with Remicade®, Remsima® or Inflectra® at a final concentration of 10 µg·mL-1 and incubated at 37°C.
Each sample was prepared in triplicate. A volume of 100 µL of each serum sample was collected after
2, 6, 30, 50 and 90 days of incubation. Consequently, 4 µL of SIL-IFX internal standard solution at 0.25
g·L-1 were added before proceeding immediately with sample preparation.
▪ Sample preparation. Serum sample preparation was based on a protocol recently

developed in our group [270]. Briefly, 217 µL of Streptavidin M-280 DynabeadsTM ferromagnetic
beads were preincubated with 148 µL biotinylated TNF-α (10 µg·mL-1 in PBS) for 1 hour at 20°C.
Then, the serums, previously spiked with SIL-infliximab were added to the beads and left for 1
hour at room temperature to allow any TNF-α antibody inhibitors to bind to the beads. A magnet
was used to remove serum from the beads. Acidic dissociation of the mAbs from TNF-α was then
performed by two consecutive washing steps using 50 µL MeOH/H2O/FA: 48.5/48.5/3% solution.
Supernatants were pooled and dried for 2 hours at 35°C using a miVac DNA Concentrator
SystemTM. The sample was reconstituted with 70 µL of ammonium bicarbonate buffer (50 mM,
pH 8) and digested. A denaturation-reduction-alkylation-digestion workflow, commonly used for
the digestion of mAbs into peptides, was performed [119]. Finally, the peptide digests were
evaporated at 30°C for 2 hours, and then resuspended in 5 µL ammonium acetate 100 mM, pH 4.
▪ Capillary electrophoresis-tandem mass spectrometry analysis. Peptide mixtures

obtained from sample preparation were analyzed using a CESI8000® capillary electrophoresis
system (Sciex separations, Darmstadt, Germany) coupled to a Sciex 5600 TOF mass spectrometer
(Darmstadt, Germany) operated by Analyst® software (Sciex, Darmstadt, Germany). The
hyphenation of CE with ESI-MS was made through a sheathless interface, consisting of two
capillaries in the CE system. The separation is performed in a bare fused silica capillary (total
length 100 cm; 30 μm i.d.), the outlet end of which was etched to make it porous using a home-
made protocol [247]. A second capillary (total length 80 cm; 50 μm i.d.) is used to maintain
electrical contact at the porous interface with the background electrolyte (BGE) composed of 10
- 158 -
% acetic acid. During the analysis, a transient isotachophoresis preconcentration step (t-ITP) was
performed by injecting the peptide digest solubilized in a leading electrolyte of 100 mM
ammonium acetate (pH 4), which is more conductive than the BGE. 68 nL of the peptide digest
was injected hydrodynamically (5 psi, 100 sec) and a voltage of 23 kV was applied to the
separation capillary. For the ESI source parameters, the applied ESI voltage was 1.5 kV, the source
heating temperature was 100 °C, and the curtain gas was set to 2. Experiments were performed in
Top20 information-dependent acquisition (IDA, Sciex) with a total duty cycle of 1.9 s during 60 min of analysis.
The mass/charge (m/z) range was 100−2000 for MS and 50−2000 for MS/MS. The data were
analyzed using Skyline software.
▪ Post-translational modifications characterization and extraction yield determination.

The presence of PTMs was systematically identified based on high-resolution m/z measurements
provided by MS spectra and fragment characterization observed in MS/MS data collected from
CE-MS/MS experiments. 6 distinct PTM hotspots were investigated: 4 asparagine deamidations
(N57 (heavy chain: HC), N137 (light chain: LC), N158 (LC) and N387 (HC)) and 2 aspartate
isomerizations (D283 (HC) and D404 (HC)). The proportion of each PTM was determined by
integration of MS signals corresponding to unmodified peptides and their modified counterparts.
To suppress any eventual artifactual modifications occurring during sample preparation, a PTM-
specific normalization strategy previously implemented by our group was used [270]. Briefly, the
SIL-infliximab internal standard added to the sample at the beginning of the workflow acted as a
marker for endogenous modifications occurring during sample preparation and analysis (Figure
9.1). For an amino acid (here denoted “L”) of infliximab, which incubated at 37°C in serum (here
denoted “sample”), its level of modification that occurred strictly during the in vitro incubation
IFX
(𝑓incubation ) is expressed by equation (9.1). The references values (ref) are necessary as the initial
structure of SIL might differ from infliximab.
𝐼𝐹𝑋 𝐿𝐼𝐹𝑋 𝐼𝐹𝑋 𝑆𝐼𝐿 𝐼𝐹𝑋 𝑆𝐼𝐿 𝑆𝐼𝐿 𝐼𝐹𝑋 𝑆𝐼𝐿

𝑠𝑎𝑚𝑝𝑙𝑒 −𝐿𝑟𝑒𝑓 −𝐿𝑠𝑎𝑚𝑝𝑙𝑒 +𝐿𝑟𝑒𝑓 𝐿𝑠𝑎𝑚𝑝𝑙𝑒 +𝐿𝑟𝑒𝑓 −𝐿𝑠𝑎𝑚𝑝𝑙𝑒 𝐿𝑟𝑒𝑓
𝑓𝑖𝑛𝑐𝑢𝑏𝑎𝑡𝑖𝑜𝑛 = 1−𝐿𝐼𝐹𝑋 𝑆𝐼𝐿 𝐼𝐹𝑋 𝑆𝐼𝐿 (9.1)
𝑟𝑒𝑓 −𝐿𝑠𝑎𝑚𝑝𝑙𝑒 +𝐿𝑟𝑒𝑓 𝐿𝑠𝑎𝑚𝑝𝑙𝑒
𝐿IFX
𝑠𝑎𝑚𝑝𝑙𝑒 : Abundance of the modification of “L” found in CE-MS for the infliximab compound, in spiked serum incubated at 37°C.
SIL
𝐿𝑠𝑎𝑚𝑝𝑙𝑒 : Abundance of the modification of “L” found in CE-MS for the SIL-infliximab compound, in spiked serum incubated at 37°C.
𝐿IFX
ref : Abundance of the modification of “L” found in CE-MS for the infliximab compound, in spiked serum immediately analyzed.
𝐿IFX
ref : Abundance of the modification of “L” found in CE-MS for the SIL-infliximab compound, in spiked serum immediately analyzed.
- 159 -
Figure 9.1. Schematic representation of the normalization approach for the relative quantification of PTM levels occurring
during incubation.
The determination of the extraction efficiency was based on the monitoring of a dedicated tryptic
peptide of infliximab and SIL-IFX, which possessed the particularity to be proteotypic for both
compounds. The selected peptide was DILLTQSPAILSVSPGER (LC01), located in the variable
domain of infliximab, and its specificity to this antibody was verified by a blast search using a
human database [https://blast.ncbi.nlm.nih.gov/Blast.cgi]. The signal used for SIL-IFX monitoring
corresponds to the same LC01 peptide, incorporating 13C and 15N isotope labeling for the arginine
(R) amino acid (+10 Da). The extraction efficiency was estimated by comparing the infliximab/
SIL-IFX signal ratio of the sample of interest (here infliximab-spiked serums that incubated at
37°C) of the reference sample (immediately analyzed infliximab spiked serum) and was expressed
by the equation (9.2):
𝐴IFX
( LC01
SIL )
𝐴LC01
sample
Extraction efficiency (%) = 100 𝐴IFX
(9.2)
( LC01 )
𝐴SIL
LC01 reference
𝐴IFX 𝐴IFX
( LC01
) the infliximab/SIL-infliximab signal ratio found in the spiked serum incubated at 37°C. And ( LC01
) :
𝐴SIL
LC01 𝐴SIL
LC01
sample reference
infliximab/SIL-infliximab signal ratio found in the spiked serum immediately analyzed.

To investigate the possibility of studying in vitro the structural modification of infliximab after
administration, the stability study was performed using blank serums spiked with either
Remicade®, Inflectra® or Remsima®, incubated at 37°C to mimic physiological conditions. After
incubation, as shown in Figure 9.2, SIL-infliximab internal standard was added to the sample.
Consequently, a specific extraction of both infliximab and SIL-infliximab was performed using
- 160 -
TNF-α immobilized on ferromagnetic beads, followed by proteolytic digestion. Finally, the

generated peptide mixture was characterized by CE-MS/MS analysis (see Materials and methods
section). Spiked serums analyzed immediately without incubation were used as references to
compare the extraction yield and the level of PTMs of incubated samples. Concerning the relative
quantification of PTM levels, the normalization strategy (equation (9.1)) using the SIL-infliximab
as a marker was applied to account for possible artifactual reactions that could occur during sample
preparation (Figure 9.S1).
Figure 9.2. Schematic representation of the CE-MS/MS strategy used to identify post-translational modifications (PTMs) of
infliximab after incubation at 37°C in serum.
9.3.1. Capillary electrophoresis separation
CE-MS/MS data showed that the analytical workflow enabled the systematic identification of
peptides presenting PTMs hotspots [141,143,198]. Thus, the selectivity of CE separation, based
on the electrokinetic mobility of the analytes, delivered a baseline separation of modified peptides
from their unmodified counterparts. Therefore, CE-MS/MS analysis allowed reliable characterization
of PTMs and relative quantification of modification levels for asparagine deamidation (deaN) as
emphasized in Figure 9.3.a, which involved a mass difference of (+ 0.98 Da). In addition, aspartate
isomerization (isoD), which did not involve a mass shift of the peptide could be identified after
CE separation (Figure 9.3.b). Previous work in our group showed a lower electrophoretic mobility
of the peptide with isoD than with D, due to the hydrodynamic radius change [21]. Without the
implementation of CE separation prior to the MS analysis, the identification of the PTMs could be
hindered or impossible due to isotopic profile overlapping on MS spectra between the modified
peptide and the unmodified homologue.
- 161 -
Figure 9.3. Examples of CE-MS/MS electropherograms exhibiting: a. Separation of a peptide presenting an asparagine
deamidation (deaN57) from the unmodified homologue (N57). b. Separation of a peptide demonstrating an aspartate
isomerization (isoD404) from the corresponding intact peptide (D404).
9.3.2. Quantification of induced PTMs during in vitro storage
For infliximab innovator and the corresponding biosimilars, the modification levels of 4 asparagine
deamidations (N158 (LC), N137 (LC), N387 (HC) and N57 (HC)) and 2 aspartate isomerizations (D283
(HC) and D404 (HC)) were measured using CE-MS/MS analysis at different incubation time (Table
9.S1). The median half-life of infliximab is approximately 14 days. However, the concentration of
this mAb in patients with Crohn's disease was found to be highly variable between individuals,
with some patients still presenting serum infliximab levels > 2.8 µg·mL-1 after 14 weeks of
treatment [164]. Therefore, the present study sought to evaluate the structural outcome of the mAb
up to 90 days of incubation. Fig. 4 presents the evolution of PTMs abundance with incubation
time. The results showed an absence of significant modification for the two aspartates studied, and
in the case of the residues N158 and N137. Indeed, their level of modification induced during
incubation, calculated from CE-MS/MS data, remained systematically below 10 % for the different
infliximab products, even after 90 days. Concerning deamidation of the residue N387, the results
showed a gradual increase of the residue deamidation over time up to 16.6 % after 50 days of
incubation in serum for Remsima®, followed by a stabilization afterward (Figure 9.4). The
modification of this particular residue was attributed to the presence of an adjacent glycine in the
amino acid sequence, which made the residue highly prone to deamidation at neutral to alkaline
pH due to the possible formation of the cyclic imide [18,218]. Plus, the 3D structure of infliximab
Fc part indicated that N387 is located on an external helix exposed to the external environment,
close to the area of binding with FcγRIII. Lu et al. (2020) have shown that deamidation of N325
reduces antibody-dependent cell-mediated cytotoxicity after 4 months of incubation at 40°C [147].
- 162 -
In the case of the residue N57, CE-MS/MS data demonstrated a gradually increasing level of
deamidation, reaching 43.6 % for the Remsima® product after 90 days of incubation. The residue
N57 is located in the CDR part of infliximab, so the modification of this residue could potentially
hinder the affinity of the mAbs with the antigen due to its proximity during the interaction. Various
studies have investigated the implication of this hotspot on the antigen-antibody interaction. For
instance, Huang et al.(2005) observed a similar deamidation of the residue N55 for another IgG
over time after administration to monkeys [16]. They noted a decrease in antigen binding affinity
with this N55 deamidation.
Regarding the assessment of biosimilarity, CE-MS/MS data obtained for the biosimilars showed a
gradual modification of residues N57 and N387 in nearly equivalent proportions compared to the
infliximab innovator product after 6 days when incubated in serum. However, it could be noted
that Inflectra® showed lower modification levels for N57 than the other compounds after this time
point (Figure 9.4). Although the kinetics of this deamidation should be confirmed with other
batches of Inflectra®, the method has demonstrated its suitability for structural assessment of
mAbs after administration. Therefore, the study allowed to point that both biosimilar products
exhibited a similar structural evolution in comparison to the innovator product during incubation
in the biological sample. In this case, the CE-MS/MS analysis allowed to demonstrate in the
perspective of the outcome after administration, the structural equivalence of the studied
biosimilars of infliximab compared to the innovator product in term of amino acids subjected to
post-translational modification. Plus, the determination of the rate of these degradations is possible
with this method but would require multiple batch experiments for biosimilarity assessment. CE-
MS/MS analysis performed for the different products showed the occurrence of specific PTMs
during the incubation of infliximab under conditions that mimic in vitro the environment of mAbs
after administration. Thus, the strategy developed enabled to anticipate the occurrence of PTMs
potentially affecting the mAbs after their injection, during their residence time, which is
particularly long due to the extended serum half-life of IgG. In addition, the CE-MS/MS results
highlighted the relevance of characterizing PTMs hotspots post-administration in order to attribute
changes in the efficacy of the mAbs over time.
- 163 -
Figure 9.4. Modification levels of 6 amino acids generated after incubation of infliximab in serum at 37°C. Black bars:
Remicade®, blue bars: Inflectra® and pink bars: Remsima®. Error bars correspond to standard deviation of triplicates.
9.3.3. Evaluation of TNF-α binding
The presence of the identified PTMs may potentially affect the affinity of the mAbs for the
corresponding antigen or receptors responsible for effector functions (e.g. FcRn, FcγRI), especially
in the case of the residue N57 which is located in the CDR of infliximab. The sample preparation
developed for the CE-MS/MS analytical workflow was based on an affinity extraction step
performed by the intermediate of recombinant TNF-α immobilized on ferromagnetic beads.
Therefore, to further investigate the impact of the gradual deamidation of the amino acid N57 on the
infliximab/TNF-α interaction, the efficiency of the bead extraction was evaluated (equation 9.2).
As emphasized in Figure 9.5, the CE-MS/MS analysis demonstrated an extraction efficiency

systematically higher than 75%. The incubation time did not show a significant influence on the
extraction efficiency over a period of 50 days. By extension, experiments showed that the
infliximab/TNF-α binding could be maintained. Therefore, CE-MS/MS analysis allowed to
correlate that these significant levels of N57 deamidation, resulting from prolonged incubation in
serum, did not compromise the binding interaction of infliximab to its antigen. The experiment
carried out during the study was based on the estimation of the relative amount of infliximab bound
using the SIL-IFX, with a fixed amount of TNF-α, in order to avoid variations possibly due to the
- 164 -
repeatability of the extraction. Thus, this approach allowed only the estimation of the actual
occurrence of the infliximab/TNF-α interaction. As a consequence, although the infliximab/TNF-
α interaction was maintained, the affinity of the interaction, represented by the dissociation
constant, could still potentially be affected by the occurrence of PTMs in the CDR regions without
completely abolishing the interaction. Concerning biosimilarity assessment, the infliximab
innovator and the corresponding biosimilar demonstrated a similar evolution of the extraction
efficiency over the studied period of time (Figure 9.5). Data generated during the study showed that
the different infliximab products underwent equivalent evolution when placed in conditions
mimicking the environment of the mAbs after administration, further supporting their
bioequivalence. As a result, the analytical workflow developed in this case allowed for an additional
dimension of comparison in the context of biosimilarity assessment, with a reduced number of
experiments.
Figure 9.5. Achieved extraction efficiency of infliximab innovator product (Remicade®) or biosimilars (Inflectra® and
Remsima®) for different incubation duration in blank serums at 37°C. Error bars represent the standard deviation among
triplicates. Dotted lines: bias of +/- 20% of the extraction efficiency compared to a sample without incubation (reference).
9.3.4. Comparison with in vivo values
The relevance regarding the implementation of conditions mimicking the environment of the
mAbs after administration to predict mAb stability was further investigated. Thereby, hotspots
PTMs levels obtained for spiked serums incubated at 37°C were compared with those values
observed in vivo for the characterization of serums originating from treated patients, as previously
reported [270]. The analysis of serums of patients after their administration with infliximab
exhibited the absence of modifications at the residues D283, D404, N158 and N137, which is in full
agreement with the CE-MS/MS results obtained under conditions simulating the environment of
the mAbs (Figure 9.4). In addition, the progressive deamidation of the residue N57 characterized
- 165 -
by CE-MS/MS analysis in the case of incubated serum samples, was consistent with its evolution
reported in vivo consequently to administration. In particular, a comparison of the deamidation
kinetic of the residue N57 measured in vitro by the intermediate of incubated serums and in vivo in
the case of samples originating from treated patients was performed It allowed to demonstrate a
significantly similar rate of modification of the protein (Figure 9.S2) which validated the relevance
of the conditions mimicking the environment of infliximab after administration. The gradual
deamidation of the residue N57 was partially attributed to the effect of temperature, which is in
agreement with previous reports [193]. A study recently investigated by Kato et al. (2020) has
suggested that H2PO4− and HCO3− ions are the principal catalysts for Asn deamidation in vivo
[219].Concerning the residue N387, comparison between in vitro and in vivo deamidation rate was
less clear, as the maximum level of modification observed was 20 % (Figure 9.S3). Despite a higher
dispersion among patients, it is possible to observe a similar tendency between the two studies.
The CE-MS/MS method demonstrated the possibility to independently characterize faint PTMs
occurring on infliximab present in complex biological samples, in a precise and robust manner.
The characteristics of the CE-MS/MS methods, supported by a specifically tailored sample
preparation procedure, enabled to achieve an optimal sensitivity and to prevent any interference
from natural IgGs or serum proteins. A novel analytical approach was developed in order to predict
the occurrence of PTMs consequently to the administration, in the case of infliximab innovator
and the corresponding biosimilars. The characterization of infliximab-spiked serums incubated at
37°C allowed to identify stable residues alongside to the gradual deamidation of two distinctive
asparagine residues over time. Without the necessity to perform additional experiments, the
determination of the TNF-α affinity extraction efficiency showed that the N57 deamidation, located
in the CDR of mAbs, did not involve significant alterations of the infliximab/TNF-α interaction.
Finally, comparison of N57 deamidation kinetics obtained from the analysis of model samples and
serum samples demonstrated a relevant correlation between the two sets of experiments. Thus, the
results allowed to emphasize the validity of using conditions mimicking the environment of mAbs
in order to anticipate the evolution of their primary structure after administration, in a detailed
manner.
9.4. Conclusion
In the present work, we developed an analytical strategy implementing conditions that mimic the
environment of mAbs after their administration over an extended period of time in order to predict
in vitro the potential occurrence of primary structure degradation of mAbs. CE-MS/MS analysis
enabled the simultaneous characterization of six PTM hotspots including deaN and isoD, for
infliximab innovator and two corresponding biosimilar products in biological samples.
- 166 -
Biosimilarity assessment usually performed on formulated products, the study allowed to

investigate the different infliximab products from the perspective of their stability after
administration, in order to further demonstrate their biological equivalence. Results allowed the
identification of two distinct PTM hotspots presenting significant modification due to the
environment, including deaN57 located in the CDR part of infliximab. CE-MS/MS data showed a
similar evolution regarding modification levels between the infliximab innovator and the two
biosimilars. Nonetheless, the excellent sensitivity of the method provided the possibility to
distinguish faint differences in terms of modification levels. The comparison of the results obtained
from the analysis of in vitro model samples and in vivo serum samples, originating from treated
patients, proved to be in agreement regarding the affected residues and their respective
modification kinetics. As a consequence, the comparison demonstrated the relevance of the in vitro
analytical strategy developed, to predict the occurrence of PTMs and anticipate the primary
structure stability of mAbs after administration. Concomitantly, the analytical strategy enabled to
evaluate the influence of the N57 deamidation on the infliximab/TNF-α binding, which allowed to
determine that the modification of the residue does not prevent the interaction within a 50-day
incubation.
The study illustrated the importance of characterizing the evolution of the primary structure of a
biosimilar candidate also in the context of its administration. Indeed, like in the case of infliximab,
the evolution of the primary structure after administration to patients could be drastically different
from the formulated product, which is usually used to perform stability studies using forced
degradation. The in vitro analytical strategy developed provided a suitable approach in order to
facilitate and anticipate this type of experiment, alleviating the effective administration of the
product. It could also potentially be adapted to other mAbs in a straightforward manner, with the
only requirement that the adequate antigen is used for the specific extraction. Further studies
evaluating the impact of structural degradation on other functional aspects of an antibody could
help to better understand their outcome after administration. For instance, studies have showed that
PTMs occurring near the Fc receptor region could impact the binding of the antibody to essential receptors
such as FcRn or FcγRs, thereby affecting its serum half-life, or cytotoxicity [26,28,147,267].
ACKNOWLEDGMENTS
The authors would like to thank every person that contributed to the achievement of this article, especially the Professor M. Allez (Chief of Service
Gastro-enterology, Inserm U1160, Hospital Saint Louis, France) that provided serum samples of the cohort and Victor Chardiny for his help. They
thank Armand Leclerc for his helpful discussions, and his help for the normalization strategy. They also thank Antony Lechner for his great
contribution in the beginning of this project. This research work was supported by the Agence National de la Recherche as part of the project
MethAmAbs (project no. ANR-19-CE29-0009).
- 167 -
9.5. Supporting information

Table 9.S1. Level of modification obtained by MS integration of peptides for Remicade®, Inflectra® and Remsima® over
incubation time. Standard deviation was calculated for replicates of 3. These are the row data, before normalization (equation 9.1).
Level of modification (𝐿𝑠𝑎𝑚𝑝𝑙𝑒 𝐼𝐹𝑋 )
Time of incubation (days)
0 2 6 30 50 90
PTM Location Analyte
Remicade® 3±1% 2±1% 1±1% 3±2% 2 ± 1% 8 ± 6%
Isomerization
283
D Remsima® 4±2% 3±1% 3±3% 3±1% 2 ± 1% 5 ± 6%
Inflectra® 4±3% 2±1% 3±0% 2±1% 7 ± 4% 3 ± 3%
Remicade® 1±1% 2±0% 2±2% 5±4% 1 ± 1% 2 ± 0%
404
D Remsima® 4±4% 4±4% 2±2% 2±2% 3 ± 3% 1 ± 1%
Inflectra® 2±2% 5±5% 1±1% 1±1% 1 ± 1% 1 ± 1%
Remicade® 4±2% 12 ± 5 % 12 ± 6 % 44 ± 25 % 31 ± 9% 40 ± 9%
57
N Remsima® 23 ± 1 % 13 ± 8 % 31 ± 3 % 29 ± 8 % 44 ± 11% 53 ± 5%
Inflectra® 17 ± 8 % 19 ± 10 % 15 ± 1 % 23 ± 11 % 25 ± 13% 22 ± 17%
Remicade® 31 ± 3 % 48 ± 2 % 51 ± 9 % 40 ± 4 % 42 ± 12% 54 ± 13%
Deamidation
387
N Remsima® 58 ± 10 % 48 ± 1 % 50 ± 15 % 48 ± 8 % 51 ± 5% 51 ± 7%
Inflectra® 55 ± 8 % 44 ± 5 % 46 ± 8 % 63 ± 11 % 46 ± 3% 54 ± 8%
Remicade® 12 ± 3 % 9±3% 25 ± 6 % 9±7% 8 ± 2% 13 ± 3%
N137 Remsima® 13 ± 5 % 7±2% 14 ± 6 % 13 ± 5 % 10 ± 1% 16 ± 6%
Inflectra® 16 ± 9 % 22 ± 7 % 19 ± 12 % 12 ± 3 % 9 ± 3% 11 ± 4%
Remicade® 4±0% 10 ± 1 % 12 ± 1 % 9±1% 9 ± 3% 11 ± 2%
158
N Remsima® 12 ± 3 % 5±4% 9±2% 9±1% 9 ± 0% 13 ± 1%
Inflectra® 11 ± 3 % 8±4% 11 ± 3 % 9±1% 8 ± 1% 10 ± 2%
Figure 9.S1. Level of modification obtained by MS integration of peptides for SIL-infliximab. Mean and standard deviation
were obtained with of all SIL-infliximab samples analysis (at each time of incubation), since SIL-infliximab is added to the
serum after incubation time (see Figure 9.1) (n=61).
- 168 -
Figure 9.S3. Evolution of the level of deamidated N387 of

Figure 9.S2. Evolution of the level of deamidated N57 of
infliximab (Remicade®) with the time spend in during
infliximab (Remicade®) with the time spend in during
incubation. In vitro study: incubation in normal serum at
incubation. In vitro study: incubation in normal serum at
37°C (gray bars). In vivo study: incubation in patient’s
37°C (gray bars). In vivo study: incubation in patient’s
organism (black crosses).
organism (black crosses).
9.6. Discussions additionnelles

9.6.1. Prédiction de PTM post-administration de sites additionnels de
l’infliximab
Afin d’élargir la caractérisation structurale, cette section propose d’identifier d’autres sites de PTM
à partir des mêmes données MS utilisées dans la publication du chapitre 9. Ces résultats n’ont pas
été inclus dans l’article pour conserver une clarté dans la présentation des capacités de l'approche
développée. Dans la première partie de ces discussions additionnelles, le suivi cinétique du profil
de glycosylation après chaque incubation a été évalué. Puis, sont présentés les suivis cinétiques de
certaines oxydations de méthionines et d’autres déamidations d’asparagines.
▪ Glycoprofils.
Les analyses CE-MS/MS de l’infliximab (commercialisé sous les noms de Remicade®, Inflectra®
et Remsima®) après incubation en présence de sérum pendant une période de 0 à 90 jours,
permettent les extractions EIE des 6 glycopeptides majoritaires. À partir des aires des signaux
extraits, les profils de glycosylation ont été établis sur la Figure 9.6.a.
Les résultats obtenus sont similaires à ceux présentés par Pisupati et al. (2017), ayant
comparé les proportions glycaniques de l’infliximab original et de son biosimilaire Remsima®, à
partir des produits formulés [250]. Dans cet article, il était déjà souligné que le Remsima® présente
une proportion plus élevée de G1F au détriment de G0F et G0FN par rapport à son homologue
- 169 -
original. Remsima® est produit à partir d’un clone de cellules Sp2/0 avec des excipients différents
de celui du Remicade®, ce qui peut expliquer cette différence [193]. L’Inflectra® étant produit
dans les mêmes conditions que le Remsima®, il présente un profil de glycosylation similaire.
Les profils de glycosylations des produits de l’infliximab présentés Figure 9.6.a. semblent
rester stables au cours du temps d’incubation. En utilisant l’équation (9.1) de normalisation établie
IFX
dans l’article de ce chapitre pour quantifier 𝑓incubation , la proportion de modification apparue lors
de chaque incubation, il a été possible de normaliser les glycoprofils, sur Figure 9.6.b. Les niveaux
IFX
de 𝑓incubation obtenus étant très faibles (< 20 %), appuient la théorie selon laquelle aucune variation
significative de l’abondance de chaque glycan n’a lieu durant l’incubation in vitro. Comme
observé dans le chapitre 8, la normalisation de l’abondance du glycopeptide G0F est plus variable
que les autres glycans, à cause de sa forte proportion. En comparant les résultats de ces sérums
incubés aux échantillons contrôles, on ne remarque pas de variation significative.
Dans le chapitre 8 (Figure 8.7), de légères variations dans les proportions de M5 et G0FN
de l'infliximab Remicade® avaient été observées suite à son administration aux patients, ce qui
n’est pas retrouvé après incubation in vitro. Ces modifications post-administration ont été
attribuées aux différences de cinétique d'élimination de ces glycoformes, c’est-à-dire leur
clairance. Des études antérieures ont démontré que certains glycans ont une faible interaction avec
le récepteur FcRn. Cela affecte le temps de demi-vie des mAbs qui portent ces glycans [258]. Dans
le cadre des travaux réalisés sur la Figure 9.6, étant donné que l’infliximab est simplement incubé
dans du sérum modèle, ce recyclage biologique n’a pas lieu.
Figure 9.6.a. Profils de glycosylation de l’infliximab produit original (Remicade®) ou biosimilaires (Remsima® et Inflectra®)
après incubation dans du sérum sain à 37°C (0-90 jours). b. Niveau de glycan ayant été modifié lors de l’incubation in vitro de
l’infliximab dans du sérum. Les barres d’erreurs représentent les écarts type pour n = 3.
- 170 -
▪ Oxydations de méthionines.
Ces mêmes données CE-MS/MS permettent d’extraire les EIE des ions correspondants aux 3
oxydations de méthionines hotspots M18, M85 et M255. Les niveaux d’oxydations produits durant
IFX
l’incubation (= 𝑓incubation ) ont été déterminés pour ces analyses in vitro sur la Figure 9.7. Dans le
cas des 3 méthionines considérées, la méthode souligne là encore que la cinétique des oxydations
de ces sites semble être similaire entre le produit Remicade® et ses biosimilaires.
Pour chacun des trois produits de l’infliximab, les résultats indiquent une oxydation
progressive du site M255 avec le temps de l’incubation. Plusieurs études ont remarqué une relation
entre l’oxydation de M255 et l’affinité de l’IgG avec le récepteur néonatal FcRn, modulant le
recyclage et donc le temps de demi-vie de l’anticorps dans l’organisme. Néanmoins, des
recherches complémentaires ont permis d’établir que le niveau d’oxydation de M255 doit excéder
les ~ 40-50 % pour que la pharmacocinétique de l’anticorps soit affectée [27,29]. D’après nos
études in vitro, ce niveau n’est atteint qu’après 90 jours d’incubation. Or, l’infliximab est
généralement éliminé de l’organisme des patients avant 90 jours.
Le principal défi rencontré lors de l’étude des oxiM de ce projet doctoral a été l'absence de
reproductibilité inter-journées des oxydations endogènes induites par la préparation
d’échantillon/analyse. En effet, bien que l’analyse CE-MS/MS des sérums dopés avec de
l’infliximab résulte en une reproductibilité des oxiM intra-journée acceptable (CV < 30 %, n = 3),
la reproductibilité inter-journées s'est avérée bien moins satisfaisante (CV > 50 %, n = 3). Pendant
certaines manipulations, il a été constaté que le niveau d'oxiM, mesuré par analyse CE-MS/MS sur
un infliximab provenant de sérum, atteignait 100 %. La raison de cette variabilité d'oxydation
artificielle induite par la stratégie n'est pas encore pleinement comprise. Il est possible de suggérer
que la canule métallisée à l'extrémité du capillaire de séparation, située dans l'interface ESI, induit
de manière non-systématique des oxydations artificielles importantes sur les méthionines. De telles
observations ont été décrites avec la corrosion de l’émetteur ESI en LC-MS, qui peut provoquer
jusqu’à 80 % d’oxiM de certains peptides [271].
Or, si la quantification relative brute obtenue par CE-MS/MS d’une PTM est à 100 %, la stratégie
de normalisation n’est plus applicable, car elle ne permet pas de distinguer les PTM inhérentes au
stress ou à l'administration de celles qui proviennent de la préparation de l'échantillon. Ce
phénomène a été constaté dans certaines analyses de sérums de patients ainsi que pour les sérums
dopés du 2ème jour d'incubation. Par conséquent, ces points ne sont pas inclus dans la Figure 9.7.
- 171 -
Figure 9.7. Proportions d’oxydations de méthionines de l’infliximab (original Remicade® et biosimilaires Remsima® et
Inflectra®) selon le temps d’incubation in vitro dans du sérum modèle à 37°C (6-90 jours) Les barres d’erreurs représentent les
écarts-types pour n = 3.
▪ Déamidations d’asparagines
Afin d’avoir une perspective plus élargie des déamidations de l’infliximab post-administration,
d’autres sites d’asparagine ont été extraits des données CE-MS/MS. Toujours par application de
l’équation (9.1), les proportions de déamidations induites lors de l’incubation de l’infliximab (=
IFX
𝑓incubation ) ont été calculées. La Figure 9.8 présente ces proportions pour 8 nouveaux sites
d’asparagines suivis (en plus des 4 issus de la publication de ce chapitre 9) de l’infliximab produit
original Remicade®. Ces résultats mettent en évidence qu’aucune des huit asparagines, dont l’une
est située sur une zone CDR (N101), ne se déamident avec le temps d’incubation. Comme présenté
dans l’article, on retrouve les dégradations progressives de N57 et N387.
Figure 9.8. Proportions de déamidations d’asparagines de l’infliximab (original Remicade®) selon le temps d’incubation in
vitro dans du sérum modèle à 37°C (0-90 jours) Les barres d’erreurs représentent les écarts-types pour n = 3.
Les mêmes asparagines ont été caractérisées pour les biosimilaires de l’infliximab (Remsima® et
Inflectra®) et sont présentées sur la Figure 9.9. Une fois encore, seules les asparagines N57 et N387
IFX
se déamident in vitro de manière non négligeable (𝑓incubation > 20 %). Les autres asparagines
étudiées ne montrent aucune altération suite à cette période d’incubation. Ces résultats appuient la
- 172 -
biosimilarité des dégradations structurales du Remsima® et de l’Inflectra® par rapport au

Remicade®.
Figure 9.9. Proportions de déamidations d’asparagines de l’infliximab (biosimilaires a. Inflectra® et b. Remsima®) selon le
temps d’incubation in vitro dans du sérum modèle à 37°C (0-90 jours) Les barres d’erreurs représentent les écarts type ( n=3).
Ainsi, que ce soit pour l’évolution des proportions glycaniques ou d’autres PTM, la
stratégie in vitro implémentée a permis d’apporter des informations sur le devenir post-
administration de l’infliximab. En particulier, cette approche a ouvert la voie à une nouvelle
perspective peu explorée jusqu'ici, en évaluant la biosimilarité structurelle de produits mAbs après
administration. En ce qui concerne les résultats présentés dans ce chapitre, les biosimilaires
Remsima® et Inflectra® ont pu démonter une évolution structurelle très similaire à leur produit
original Remicade®.
9.6.2. Discussion sur l’origine des déamidations spontanées de N57 et N387
9.6.2.a. Quels facteurs responsables de la déamidation ?

Parmi les 12 asparagines étudiées in vitro, deux sont sujettes à une déamidation significative dès
6 jours d’incubation, et ce pour l’infliximab original et ses deux biosimilaires. L’objectif a alors
- 173 -
été d’essayer d’identifier et de comprendre l’origine de ces déamidations. Plusieurs études ont mis
en évidence que la température et le pH peuvent entraîner des déamidations [14]. La caractérisation
des dégradations in vivo (chapitre 8) et in vitro (chapitre 9) de l’infliximab a mené à des proportions
de deaN57 extrêmement élevées (~ 20 % après 30 jours d’incubation). En 2023, Legrand et al. ont
évalué la déamidation de l’acide aminé N57 de l’infliximab conservé à 40°C dans de l’eau, par
analyse LC-MS/MS bottom-up [54]. Ils ont démontré que ce site se déamide à environ 12 % après
30 jours d’incubation. Bien que cela reste dans le même ordre de grandeur que nos résultats, cette
différence pourrait être attribuée à la présence de composants dans le sérum pouvant catalyser cette
réaction. Des études ont récemment indiqué qu’une augmentation de la concentration d’ions
carbonates et phosphates, naturellement présents dans le sang, accélère la déamidation de
protéines. Ces ions catalysent la réaction en stabilisant la position de certains atomes de
l’asparagine [219,272,273].
Pour étudier ces effets, nous avons réalisé des incubations d'infliximab dans des tampons contenant
des ions phosphates ou carbonates, afin de voir si d’identiques observations de deaN pouvaient
être observées. De l’infliximab Remicade® a été ajouté à des solutions de bicarbonate
IFX
d’ammonium ou de PBS, alors stockées à 37°C. Les déamidations ayant émergé (𝑓incubation ) après
ces incubations de 6 ou 30 jours in vitro ont été évaluées pour les 12 asparagines. Parallèlement,
d’autres expériences préliminaires ont été menées afin de comparer l’évolution des PTM de
l’infliximab Remicade®, dans différents types de sérum. Comme présenté sur la Figure 9.10, les
sérums de patients ont généralement un aspect jaune pâle. Il arrive, dans certains cas, que le sérum
ait un aspect plus orangé et turbide, que l’on appelle « lipémique », dû à une concentration élevée
de lipides. Cette surconcentration peut être observée si le prélèvement sanguin s’effectue après un
repas, ou peut provenir de maladies de défaillance du métabolisme des graisses comme le diabète.
Les sérums « ictériques », ont un aspect jaune ocre provenant essentiellement d’une grande
concentration de bilirubine, généralement associée à des maladies du foie. La lipémie et l’ictère
sont deux conditions sanguines dans lesquelles l’infliximab peut se trouver après administration
(contrairement à l’hémolyse qui provient essentiellement d’un mauvais prélèvement). Il a été
intéressant de voir l’effet d’une incubation dans ces sérums sur les 12 sites d’asparagine étudiés.
Figure 9.10. Différents aspects du sérum après prélèvement du sang aux patients.
- 174 -
Matériel et méthode. Trois échantillons ont été réalisés, contenant du Remicade® à 25 µg·mL-1
dilué dans du sérum sain, ictérique ou lipémique fourni par l’hôpital Lariboisière, pour un volume
final de 250 µL. Deux autres échantillons ont été réalisés, contenant du Remicade® à 25 µg·mL-1
dilué dans du PBS (pH 8) ou du bicarbonate d’ammonium (50 mM pH 8), pour un volume final
de 250 µL. Ces échantillons ont été incubés 6 ou 30 jours à 37°C, puis, 100 µL ont été prélevés
avant l’ajout de 4 µL de SIL-IFX. Puis, les échantillons sont préparés selon la procédure décrite à
la section 9.2 de ce chapitre 9 et analysés en CE-MS/MS.
Résultats. Les résultats des niveaux de deaN apparus durant l’incubation de ces échantillons sont
présentés sur la Figure 9.11. Là encore, des proportions importantes de déamidation des sites N57
et N387 après 30 jours d’incubation ont été observées, tandis qu'aucune déamidation significative
n'a été constatée pour le reste des asparagines examinées. L’incubation dans le sérum ictérique
semble mener à des dégradations similaires au sérum normal. En revanche, le niveau de
modification de N57 atteint après 30 jours d’incubation dans du sérum lipémique est près de 30 %
supérieur à celui des autres conditions. Ces résultats sont néanmoins à considérer comme
préliminaires car ils n’ont pas été réalisés en triplicatas, et nécessitent des investigations
supplémentaires pour parvenir à des conclusions définitives.
Ces résultats révèlent un autre aspect intéressant : l'incubation du Remicade® dans des
tampons PBS ou bicarbonate d'ammonium, entraîne des modifications similaires du mAb à celles
observées lorsqu’il est incubé dans du sérum. Les concentrations d'ions phosphates ou
bicarbonates dans les tampons PBS et bicarbonate d'ammonium sont respectivement de 10 mM et
50 mM, ce qui est supérieur aux concentrations présentes dans la circulation sanguine d'un adulte
(généralement de 0,8 à 1,4 mM pour les ions phosphates et de 20 à 30 mM pour les ions
bicarbonates). Ces premières observations suggèrent que la combinaison d'un pH physiologique,
d'une température de 37°C et peut-être la présence d'ions phosphates/bicarbonates induit deaN57
et deaN387. Pour affiner cette hypothèse, des manipulations supplémentaires devraient être
effectuées. Il serait essentiel de s'assurer de la répétabilité des résultats présentés dans la Figure
9.11. Ensuite, il serait intéressant, à titre de comparaison, de mesurer les niveaux de deaN après
incubation dans de l'eau ultra-pure, ne contenant pas d’ions carbonates ou phosphates.
- 175 -
Figure 9.11. Proportions de déamidations d’asparagines de l’infliximab (original Remicade®) selon le temps d’incubation dans
du sérum sain, lipémique ou ictérique, ou dans du PBS ou du bicarbonate d’ammonium à 37°C (6 ou 30 jours) Les barres
d’erreurs représentent les écarts type pour n = 3.
Les résultats de cette section, bien que préliminaires, mettent en évidence la capacité de
cette stratégie in vitro à comparer le devenir structurel de mAbs selon différentes conditions. Ainsi,
l’approche pourrait être explorée en vue d’identifier d’éventuels facteurs responsables de
modification PTM d’anticorps thérapeutiques.
9.6.2.b. D’où vient la spécificité de deaN57 et deaN387 ?
▪ ffet de l’environnement spatial.

Les résultats présentés dans ce manuscrit montrent que deux asparagines spécifiques se
déamident : N57 et N387. Les autres asparagines étudiées ne semblent pas être modifiées de manière
significative. Afin d’identifier l’origine de cette sélectivité, la localisation spatiale de ces
asparagines sur l’infliximab a été étudiée par l’intermédiaire des structures cristallines des régions
Fab et Fc décrites dans la littérature [211,274]. Les modèles 3D de ces structures de l’infliximab
peuvent être consultés dans la base de données Protein Data Bank (PDB), et permettent de
visualiser les interactions et la surface accessible de tous les acides aminés de la protéine. Ces
surfaces ont été répertoriées dans la Table 9.1, pour les 12 asparagines sélectionnées de
l’infliximab. On peut alors observer une assez grande disparité de cette surface accessible entre les
acides aminés considérés.
Concernant les asparagines, on observe que N57 et N387 présentent les plus grandes
accessibilités (surfaces > 100 Å²), ce qui peut expliquer leur propension à la déamidation. Ainsi,
il est possible de suggérer qu’une surface d’accessibilité importante facilite la catalyse par les ions
phosphates ou carbonates du sérum conduisant ainsi à la déamidation. Cependant, cette explication
ne suffit pas à elle seule, car d’autres asparagines possédant une grande surface accessible telles
que N41 et N158 ne présentent pas de déamidations in vitro.
- 176 -
Table 9.1. Valeurs de surfaces accessibles des 12 asparagines étudiées de l’infliximab selon les structures 3D établies dans
PDB, aux références 5VH5 et 4G3Y
Localisation de Surface
l’ p g n accessible (Å²)
N41 (LC04) 150,4
N137 (LC10) 5,1
N138 (LC10) 47,3
N158 (LC13) 114,6
N210 (LC18) 48,5
N57 (HC07) 115,9
N101 (HC13) 2,7
N279 (HC24) 30,6
N318 (HC27) 55,5
N387 (HC38) 123,0
N392 (HC38) 108,0
▪ ffet de l’environnement local.

En 1990, Patel et Brochardt ont étudié comment la séquence d'acides aminés environnant une
asparagine peut influencer son processus de déamidation [218]. Le mécanisme de déamidation, à
pH alcalin ou neutre, passe par un intermédiaire de réaction, le succinimide (voir Figure 1.2,
chapitre 1). Ils ont démontré que l’acide aminé positionné en C-terminal de l’asparagine affecte
son taux de déamidation. Cet effet s’explique par la gêne stérique qui peut être amenée par la
chaîne latérale de l’acide aminé en question, limitant la formation du succinimide. Plus cette chaîne
latérale sera petite, plus le mécanisme de déamidation sera favorisé. Or, l’asparagine N387 est
adjacente en C-terminal à une glycine (Table 9.2), ne possédant pas de chaîne latérale, ce qui rend
extrêmement propice la formation de l’intermédiaire réactionnel. L’asparagine N57, quant à elle,
précède une sérine dont la chaîne latérale est relativement courte (57.5 Å) par rapport à d’autres
acides aminés. Là encore, ces informations ne suffisent pas à cerner toutes les complexités
biologiques des déamidations de protéines. On retrouve en effet une glycine sur le C-terminal de
l’asparagine N41, qui pourtant ne montre pas de déamidation importante lors des incubations.
Table 9.2. Valeurs de surfaces accessibles des chaînes latérales des acides aminés en C-terminal des asparagines considérées.
Aire de surface accessible de la
Asparagine considérée Acide aminé sur le C-terminal
chaîne latérale, Å, issu de [275]
N41 (LC04) Glycine 0
N137 (LC10) Asparagine 80,8
N138 (LC10) Phenylalanine 107,4
N158 (LC13) Sérine 57,5
N210 (LC18) Arginine 152,9
N57 (HC07) Sérine 57,5
N101 (HC13) Tyrosine 119,1
N279 (HC24) Tryptophan 143,4
N318 (HC27) Glycine 0
N387 (HC38) Glycine 0
N392 (HC38) Asparagine 80,8
- 177 -
C ONCLUSION
La quantification d’infliximab a pu être validée dans le chapitre 8, sur une gamme de
concentration de 0,22 à 25 µg·mL-1, couvrant les concentrations usuelles chez les patients.
L’identification de certains sites hotspots de PTM, suivie de la normalisation des proportions
obtenues par CE-MS/MS, a permis de quantifier le niveau de certaines modifications apparues
dans l’organisme de patients. Les analyses de 24 sérums de patients ont identifié les asparagines
N57 et N387, sujettes aux déamidations in vivo.
Le chapitre 9 a présenté la mise en place et la pertinence d’une méthodologie permettant
la dégradation in vitro de l’infliximab, qui imite fidèlement les conditions in vivo. Cette approche
a été appliquée pour suivre les PTM du produit original de l’infliximab et de ses biosimilaires. Elle
apporte des informations complémentaires sur la biosimilarité d’anticorps, et notamment sur leur
évolution post-administration.
Cette partie III du manuscrit a donc mené à l’identification de certaines PTM in vivo. Dans
la littérature, certaines de ces PTM ont été associées à des effets sur des interactions spécifiques,
comme celle avec l'antigène (pour N57) ou avec les récepteurs Fc (pour M255). Néanmoins, il n’a
pas été prouvé dans ce manuscrit que les proportions obtenues de ces PTM, même après 30 jours
d’incubation, sont susceptibles d’entraîner une baisse d’efficacité thérapeutique. En particulier, les
résultats de l’extraction, basée sur l’interaction infliximab/TNF-α, n’ont pas montré de perte de
rendement d’infliximab, même à 30 % de deaN57 après 50 jours d’incubation. Ces résultats
indiquent que l’infliximab peut toujours se lier au TNF-α avec ce niveau de déamidation, mais
l’affinité de cette interaction n’a pas été étudiée.
Enfin, un aspect important à prendre en compte est l’existence d’autres PTM
potentiellement responsables d’un changement de l’activité thérapeutique de l’infliximab après
administration. Dans le cadre de ce projet doctoral, nous nous sommes particulièrement intéressés
aux deaN, isoD, oxiM et à la glycosylation, définis en tant que hotspots, qui représentaient un défi
analytique en termes de séparation et détection en une seule analyse. Il serait particulièrement
intéressant d’adopter une approche de suivi non ciblée de l’évolution des PTM, sur l’ensemble
des acides aminés de l’infliximab. Dans cette optique, le couplage CE-MS/MS pourrait être utilisé
pour suivre plusieurs PTM in vivo du mAb et les corréler avec les réponses cliniques des patients.
Pour cela, une étude de cohorte serait nécessaire pour établir des liens statistiquement significatifs
entre certaines PTM et la réponse clinique. Une telle approche permettrait de mieux comprendre
l'impact des PTM sur l'efficacité thérapeutique de l'infliximab et d'ouvrir de nouvelles perspectives
dans le domaine des thérapies par anticorps.
- 178 -
Partie IV – Implémentation de la quantification de l’immunogénicité par -MS/MS
Chapitre 10 – Développement d’une stratégie pour la détermination d’un Kd entre deux mAbs
PARTIE IV : IDENTIFICATION ET
QUANTIFICATION D’ANTICORPS IMMUNOGENES
PAR CE-MS/MS
- 179 -
- 180 -
Les résultats de l’analyse des 24 sérums de patients de la partie III ont montré que la concentration
d’infliximab varie d’un patient à un autre, et ce, de manière non corrélée avec le temps de résidence
de l’anticorps. Cela indique donc une pharmacocinétique patient-dépendante du traitement
thérapeutique. Ces disparités pourraient être partiellement expliquées par des réactions auto-
immunes que certains patients développent contre le traitement. Il s’agit d’anticorps produits par
le système immunitaire, dirigés contre le mAb thérapeutique, qui peuvent mener à la perte à son
élimination précipitée de l’organisme [276]. En particulier, l’infliximab, possède 25 % de sa
séquence issue d’un anticorps murin qui peut être reconnu par l’organisme comme corps étranger.
Ces anticorps anti-médicament (ADA) sont plus spécifiquement appelés ATI (Antibodies-to-
infliximab) dans le cas de l’infliximab. Si ces ATI sont dirigés contre les zones CDR de
l’infliximab, l’empêchant de se lier au TNF-α, ils sont nommés « neutralisants » : NATI. Dans le
cadre d’un suivi clinique d’un traitement par infliximab, l’identification et la quantification de
NATI s’effectuent généralement lorsque la concentration d’infliximab mesurée dans le sérum des
patients est anormalement faible.
Les travaux réalisés dans le cadre de cette partie IV portent sur l’implémentation de la
quantification de NATI à la méthode préalablement développée. L’intérêt fut qu’à partir d’une
seule analyse en CE-MS/MS d’un sérum, trois quantifications majeures d’un suivi clinique soient
possibles :
1) La quantification de l’infliximab ;
2) La détermination des niveaux des PTM post-administration ;
3) La quantification de NATI.
Cette partie IV est divisée en deux chapitres. Le chapitre 10 décrit le développement d’une
nouvelle méthode basée sur l’analyse CE-MS/MS pour la détermination de la constante de
dissociation de l’interaction NATI/infliximab.
Le chapitre 11 présente la mise en place de la méthode par CE-MS/MS pour quantifier

simultanément les NATI et l’infliximab. Puis, la stratégie a été appliquée à l’analyse de 13 sérums
de patients suivant une thérapie d’infliximab. Ces mêmes données ont été utilisées pour recueillir
des informations sur les PTM de l'infliximab, dans la discussion additionnelle.
- 181 -
- 182 -
C HAPITRE 10.
S TRATEGIE CE-MS/MS POUR LA DETERMINATION DE
CONSTANTE DE DISSOCIATION ENTRE DEUX
ANTICORPS
Préambule
Les mAbs, en raison de leur spécificité ciblée, présentent un intérêt considérable car ils sont dirigés
contre un récepteur spécifique. Cependant, dans certaines situations, le patient peut développer des
anticorps anti-médicament (ADA) qui ciblent le mAb thérapeutique, entraînant ainsi une réduction
de son activité biologique [277]. L'étude des interactions entre le mAb et les ADA permet de mieux
comprendre les mécanismes des réponses immunitaires, et peut aider à identifier les traitements
thérapeutiques vulnérables à une perte d’efficacité, entraînant une réponse clinique défavorable
[60,278]. Plus un mAb thérapeutique induira la production d’ADA ayant une forte affinité avec
lui, moins le traitement sera efficace. L'EMA a élaboré des directives pour l'évaluation de
l'immunogénicité, qui peut être requise au cas par cas [279]. Ces directives portent principalement
sur l'analyse des données immunologiques, pharmacocinétiques, pharmacodynamiques,
d'efficacité clinique et de sécurité.
L’affinité intrinsèque entre un paratope d’un anticorps et un épitope d’un antigène peut être
exprimée comme étant inversement proportionnelle à la constante de dissociation, qui reflète les
forces chimiques qui les séparent. Selon la loi d'action de masse, et considérant la liaison d’un
paratope mono-liganté, la constante de dissociation (Kd) entre ces deux espèces peut être liée à
leurs activités, comme indiqué dans l’équation (10.1).
paratope + épitope ↔ complexe [paratope/épitope]

𝑎𝑝𝑎𝑟𝑎𝑡𝑜𝑝𝑒 𝑎é𝑝𝑖𝑡𝑜𝑝𝑒
𝐾𝑑 = (10.1)
𝑎complexe[paratope/épitope]
aX : Activité du composé x
Kd : Constante de dissociation
Pour tout soluté, on peut définir l’activité comme égale à γ*concentration, avec γ le coefficient
d’activité.
De multiples méthodes analytiques permettent de déterminer le Kd de l’affinité intrinsèque

entre un anticorps et l’antigène associé. On cite notamment l'analyse radio-immunologique (RIA),
- 183 -
la méthode de résonance plasmonique de surface (SPR), ou encore les immunodosages tels que
ELISA. Ces approches consistent à suivre l’interaction antigène/anticorps. Pour beaucoup de ces
méthodes, ce suivi se base sur la quantification ou bien des espèces non liées ou bien des complexes
formés, après état d’équilibre. Puis, ces concentrations sont implémentées dans la loi d’action de
masse (10.1) pour déterminer la constante de dissociation Kd. Généralement, le coefficient
d’activité γ est égal à 1 pour les gammes de concentration étudiées. La caractérisation de l’affinité
entre des anticorps anti-médicaments et les médicaments est encore peu établie, bien qu’elle
permette de mieux comprendre le devenir des traitements [280]. Ainsi, ce chapitre propose une
nouvelle approche, basée sur une analyse CE-MS/MS, pour déterminer l’affinité entre un paratope
d’un anticorps monoclonal et celui d’un ADA neutralisant. Ces travaux décrivent une nouvelle
méthodologie cherchant à s’affranchir de problématiques rencontrées dans certaines stratégies :
▪ Configuration de l’interaction. Pour déterminer la constante de dissociation entre deux

espèces, il faut dans un premier temps réaliser leur interaction. Dans certaines approches, l’affinité
intrinsèque monovalente se détermine après fixation sur phase solide, ou encore marquage de l’un
des composés. Or, il a été décrit que ces étapes peuvent altérer les paratopes impliqués dans
l’interaction [170,281]. Ces altérations modifient alors les interactions non covalentes mises en jeu
et impactent la valeur de Kd. Ainsi, la stratégie mise en place ici réalise la complexation en phase
liquide, dans la matrice biologique, sans marquage préalable des anticorps, afin de reproduire les
interactions biologiques in vivo.
Cette configuration, en plus de ne pas altérer structurellement les anticorps avant leur interaction,
va prendre en compte la bivalence des anticorps. En effet, ces protéines possèdent deux bras de
liaison et peuvent mener à des stœchiométries diverses. Certaines méthodologies de détermination
de Kd impliquent la fixation du mAb par l’un de ses bras pour suivre l’interaction d’un antigène
sur le deuxième. Or, il est possible que les forces d’une liaison paratope/épitope soient différentes
si le mAb est lié à un autre composé sur son deuxième paratope ou non. Ici, nous avons donc
cherché à calculer le Kd apparent de toutes les interactions formées.
▪ Méthode de quantification. Comme décrit dans le paragraphe précédent, la détermination

d’un Kd d’une interaction entre deux composés se base, pour beaucoup de méthodes, sur un suivi
quantitatif d’au moins une des espèces (libre ou complexée). Ainsi, cette quantification doit être
la plus juste possible afin d’obtenir une constante de dissociation fiable. Les pertes associées aux
lavages, à la préparation d’échantillon et à l’analyse doivent donc être contrôlées. Nous avons donc
cherché à normaliser ces biais par l’utilisation d’un étalon interne, afin d’obtenir la quantification
absolue d’une des espèces.
- 184 -
Ces travaux font état de preuve de concept, et ont été appliqués sur l’infliximab et son NATI
(Neutralyzing antibody to Infliximab). Le NATI choisi est un commercial de type IgG1, l’isotype
majoritaire des ATI de l’infliximab. L’objectif a été de déterminer la constante de dissociation de
leur interaction paratope/épitope. Ici, le Kd déterminé correspond à celui dit apparent, c’est-à-dire
moyen de toutes les interactions paratope/épitope formées.
L’infliximab et le NATI étant bivalents, ils peuvent résulter en des complexes de stœchiométries
variées. Afin de caractériser ces formes complexées, l’interaction NATI/infliximab a été dans un
premier temps étudiée par photométrie de masse (MP). Ces analyses font l’objet d’une
collaboration et ont été réalisées dans le Laboratoire de Spectrométrie de Masse BioOrganique
(LSMBO) de Strasbourg, dirigé par Sarah Cianférani.
Photométrie de Masse
Le principe de la photométrie de masse repose sur la mesure optique de la diffusion d’un
faisceau lumineux généré par une particule à l’interface verre-eau. Ainsi, la molécule à analyser
est disposée dans un tampon aqueux, qui forme une goutte sur une plaque en verre. La mesure
du signal de diffusion d’un faisceau incident est linéairement proportionnelle à la polarisabilité
de la molécule. Le contraste radiométrique (différence entre la lumière diffusée et celle
réfléchie) obtenu peut alors être converti à la masse de la particule. Cette technique permet donc
de remonter aux masses de biomolécules et à leurs abondances. Il s’agit d’une mesure en
solution, avec une grande gamme de masse, ne nécessitant que quelques microlitres et nM
d’échantillon, générant des résultats en quelques minutes, mais peu résolutive (FWHM : 25
kDa).
Les travaux présentés dans le chapitre qui suit sont en cours de finalisation et sont rédigés
en anglais dans une démarche de diffusion scientifique. La méthodologie de détermination d’une
constante de dissociation entre deux anticorps est présentée, et appliquée sur de l’infliximab en
tant que preuve de concept. L’objectif fut de développer une approche capable de déterminer
l’affinité apparente moyenne entre toutes les interactions infliximab/NATI formées en matrice
biologique. La stratégie s’affranchit de plusieurs problématiques rencontrées dans la littérature,
mais repose sur des hypothèses, dont de futures recherches permettront d’assurer la validité. Après
finalisation, ces résultats seront soumis à une revue scientifique à comité de lecture.
- 185 -
Monoclonal antibody – Anti-drug antibody affinity constant

determination using Capillary Electrophoresis – tandem mass
spectrometry
Tessa Reinert, Pascal Houzé, Nathalie Mignet, Aynur Naghizade, Lola Alez-Martin, Sarah
Cianferani, Oscar Hernandez-Alba, Armand Leclerc, Yannis-Nicolas Francois, Rabah Gahoual
Abstract:
Measurements of antigen antibody interactions are critical to understanding the outcome of biotherapeutics
after administration. In particular, the affinity between an antibody and its immune response, an anti drug
antibody, is of growing interest for medical applications. Immobilization and label free techniques are the
current methods widely used for such applications, due to their simplicity, but they struggle to measure tight
interactions and can lead to non native environments or configurations of the protein.
In this study, we propose a novel approach to determine the affinity dissociation constant between an
antibody and an anti-drug antibody by promoting immobilization-free complexation under physiological
conditions. The key advantage of this method is that it mimics in vivo interactions by avoiding the
application of physical forces like washing steps and diffusion, which can cause denaturation or dissociation
of the complexes, leading to erroneous measurements. The interaction of the two IgGs was first studied by
mass photometry to determine equilibrium conditions and was then performed in a biological matrix. The
method employs a competitive screening assay that allows absolute quantification of the residual amount
of active drug by CE-MS/MS analysis.
To demonstrate the effectiveness of the approach, we applied it to investigate the interaction between infliximab,
an anti-inflammatory treatment, and its neutralizing anti-infliximab antibody. The results revealed a dissociation
constant of 14.8 ± 1.2 nM. The strategy's sensitivity, accuracy, and efficiency make it highly suitable for the
determination of dissociation constants (Kd), especially when dealing with immunogenic reactions.
10.1. Introduction
Protein-protein interactions are essential for biological processes such as receptor recognition or
cell migration. The strength of these interactions can determine the outcome of these processes.
Therefore, it is extremely important to evaluate the interaction affinities. In particular, during
monoclonal antibody treatment, the organism can develop neutralizing anti-drug antibodies (n-
ADAs) that bind to the active site of the drug and inhibit its interaction with the corresponding
antigen.
ELISA-based methods for assessing the affinity of an antibody for an antigen are extremely
attractive because they require a small amount of antibody and are relatively fast and
- 186 -
straightforward. An appropriate approach is based on the measurement of the concentration of

unbound antibodies in an antibody-antigen mixture after equilibrium using an ELISA assay. Then,
it is possible to relate this measurement to the affinity of both compounds using the law of mass
action. In 1985, Friguet et al. suggested a mathematical solution for this application [282], which
was further investigated to achieve a more precise affinity measurement [283,284]. Joyce et al.
(2022) applied this method to determine the affinity of an antidrug antibody in clinical samples
[280]. Nonetheless, although the mathematical aspect has been extensively investigated to limit
errors in affinity assessment, the analytical method relies on the quantification of residual free
antibodies by immunoassay, which is known to be highly affected by interferences, especially
when the ligand-binding assay is designed for anti-drug antibody quantification [172,285–288]. In
addition, the surface functionalization of mAbs in an ELISA plate, which can lead to epitope
alteration, along with the multiple washing steps that can dissociate low-affinity complexes,
induces false positive and negative results in the quantification, affecting the affinity measurement
[170,281].
The present paper is devoted to the constant dissociation Kd of the therapeutic mAb
infliximab (IFX) and a neutralizing anti-drug antibody referred to as neutralizing antibody-to-
infliximab (NATI). Stable isotope-labeled infliximab (SIL-IFX) was used for infliximab/NATI
complexation as it was considered to have the same bioactivity as unlabeled infliximab. The
approach is similar to that of Bobrovnik et al. (2003) but is implemented using capillary
electrophoresis hyphenated to mass spectrometry (CE-MS/MS) for the quantification of remaining
active infliximab after controlled complexation. The aim was to provide accurate and absolute
quantification of this compound based on the high selectivity of MS, and the use of an isotope-
labeled internal standard of adalimumab (SIL-ADM) to account for any losses.
The developed method consisted of immobilization-free infliximab/NATI complexation
performed directly in the serum matrix. Thus, the aim of the method was to mimic the in vivo
interactions and avoid denaturation or dissociation of the complexes. The stoichiometry of
infliximab/NATI complexation was investigated using mass photometry (MP) analysis.
Subsequently, the fraction of infliximab not neutralized by NATI, was extracted from the serum
sample by affinity purification. Finally, purified mAbs were submitted to proteolytic digestion,
and the peptide mixture obtained was characterized using capillary zone electrophoresis
hyphenated to tandem mass spectrometry (CE-MS/MS). Thereby, the methodology consists of a
competitive screening assay aimed at accurately quantifying the amount of infliximab neutralized
by NATI using indirect absolute quantification. CE-MS/MS analysis performed at different
concentrations of NATI was used to determine the dissociation constant Kd.
- 187 -

▪ Chemicals. Stable isotope labeled infliximab (SIL-IFX) and adalimumab (SIL-ADM)
were labeled on all arginines and lysines (13C6; 15N4) and supplied by Sigma-Aldrich (Saint-
Quentin Fallavier, France). A full-length human anti-idiotypic antibody against IFX (clone
AbD17841_hIgG1) used as a standard NATI was obtained from BioRad Laboratories (California,
U.S.A). Streptavidin M-280 DynabeadsTM and biotinylated TNF-α were obtained from Fisher
Scientific Invitrogen (Illkirch, France). Sequencing-grade modified trypsin was purchased from
Promega Corporation (Madison, WI, USA).
▪ SIL-IFX quantification calibration sample preparation. Blank serums, free from IFX
and NATI, were obtained from the French Institute of Blood (Paris, France). Standard solutions
used to determine SIL-IFX calibration curves were prepared from blank serum spiked with
increasing SIL-IFX concentrations ranging from 1 to 25 µg·mL-1 and SIL-ADM a constant
concentration of 10 µg·mL-1.
▪ Kd determination samples preparation. Samples used for Kd determination using CE-

MS/MS analysis were prepared from blank serum spiked with a constant concentration of SIL-
ADM and SIL-IFX (10 µg·mL-1 each) and increasing concentrations of NATI ranging from 1 to
30 µg·mL-1. Afterward, samples were incubated for 1 h at 20°C prior to further treatment.
▪ CE-MS/MS sample preparation. The preparation of serum samples was identical to the
protocol recently published by our group [270]. Briefly, ferromagnetic beads (DynabeadsTM) and
TNF-α were mixed and incubated for 1 h at 20°C. The serum solution was then added to the beads
and left for 1h at room temperature to allow any TNF-α inhibitor to bind to the beads. After
elimination of the serum solution, acidic dissociation of the mAbs from TNF-α was performed by
addition of MeOH/H2O/FA (48.5/48.5/3; v/v/v) solution. The supernatant was dried. 70 µL of
ammonium bicarbonate buffer (50 mM, pH 8) was used to reconstitute the sample prior to the
denaturation-reduction-alkylation-digestion workflow, which is commonly used for the bottom-
up strategy of monoclonal antibodies [119]. Finally, the peptide digests were dried and diluted in
5 µL ammonium acetate, 100 mM, pH 4.
▪ Capillary electrophoresis-tandem mass spectrometry analysis. The CESI8000®

capillary electrophoresis system (Sciex separations, Darmstadt, Germany) coupled to a Sciex 5600
TTOF mass spectrometer (Darmstadt, Germany) operated by the Analyst® software (Sciex,
Darmstadt, Germany) was used to analyze the peptide mixture. The conditions for CE-MS/MS
- 188 -
analysis are identical to a previous article in our group [270]. Hyphenation of CE with ESI-MS
was performed using a sheathless interface. The separation capillary, filled with the background
electrolyte (BGE, 10 % acetic acid), was made of bare fused silica (total length 100 cm; 30 μm
i.d.), and its outlet end was etched. During each separation run, 68 nL of the peptide digest was
injected (5 psi, 100 s). A voltage of 23 kV was applied for the separation. The applied ESI voltage
was 1.5 kV, source heating temperature was 100 °C, and curtain gas was set to 2. Experiments
were performed in Top20 information-dependent acquisition (IDA, Sciex) with a total duty cycle
of 1.9 s during 60 min of analysis.
▪ Quantification of free SIL-IFX. The quantification of purified SIL-IFX was based on the
monitoring of the area of the peak corresponding to the proteospecific peptide IFX*LC01, first
peptide of the light chain (Table 10.1). In order to provide robust infliximab absolute
quantification, SIL-ADA, which is another mAb targeting TNF-α, was used as an internal standard
and monitored by the intermediate of the peptide ADM*HC01 (Table 10.1). The MS and MS/MS
spectra were studied to ensure unambiguous identification of the two compounds. The SIL-IFX
peptide IFX*LC01 is located on the variable part of infliximab and its specificity was verified by a
blast search against a human proteome database. Because ADM is a humanized antibody, the
selected peptide is not strictly specific to the mAb. However, the SIL-ADM internal standard
incorporated arginine, which contains heavy isotopes for carbon and nitrogen that allowed specific
detection in MS.
Table 10.1. Ions of surrogate’s peptides for SIL-IFX and SIL-ADM
Peptide sequence Name Analyte Role Precursor Product ions
(m/z) (m/z)
DILLTQSPAILSVSPGER* y9-967.54;
y6-654.34;
IFX*LC01 SIL-IFX Quantifier 953.53 y8-854.34;
(13C,15N) y7-741.37;
y5-555.27
EVQLVESGGGLVQPGR* y8-909.45;
y5-498.27;
ADM*HC01 SIL-ADM Internal standard 817.94 y7-746.39;
(13C,15N) y6-645.34;
y4-441.25
▪ Mass photometry. MP experiments were carried out on a OneMP instrument (Refeyn, UK)
at room temperature (approximately 20 °C). Microscope coverslips (24×50 mm, Fisher Scientific
and 24×24 mm, Globe Scientific) were prepared by rinsing them consecutively with isopropanol and
H2O and drying them under a stream of clean nitrogen. High-concentration protein stocks were
diluted in PBS (Phosphate buffer solution). Solutions containing NATI (3 µg·mL-1) and SIL-IFX
(3 µg·mL-1) were incubated for different times (1-60 min) before being loaded into the flow
chambers formed by stacked coverslips. For the dynamic study, NATI was fixed at 3 µg·mL-1 and SIL-
IFX (0-24 µg·mL-1) was added to the samples and incubated for 10 min before analysis. Images were
processed using the LabView software provided by the manufacturer (Reofeyn, UK).
- 189 -
10.3. Results and discussions

10.3.1. IFX/NATI complexation study using mass photometry
The assessment of the dissociation constant (Kd) for the interaction between infliximab and its
neutralizing anti-infliximab antibody (NATI) was carried out using a multi-step approach. The
first step involved utilizing mass photometry (MP), a cutting-edge single-molecule technique, to
evaluate various aspects of the complexation process, including the stoichiometry and kinetics of
the infliximab/NATI neutralization. MP is a recent and powerful method used for studying
biomolecular interactions. It has been extensively used in previous studies to investigate various
biological processes [289–292].
10.3.1.a. Stoichiometry of the infliximab/NATI interaction

Equimolar solutions of infliximab and NATI at 3 µg·mL-1 in PBS were incubated for 1 hour at
20°C and analyzed in MP (Figure 10.1.a). Since both antibodies have two Fab in the active variable
domain for binding, the stoichiometry of the resulting complex can vary. As shown in Figure
10.1.a, the majority of the complex formed has an approximate molecular weight of 290 kDa,
corresponding to a complex formed by one NATI and one infliximab (each having a molecular
weight of ~150 kDa). In addition, MP spectra exhibited a weak signal at mass 433 kDa, which
could be attributed to the formation of complexes presenting 1:2 and 2:1 stoichiometries. Finally,
the MP data showed the identification of macromolecular complexes with a mass of 577 kDa
potentially corresponding to 2:2 stoichiometry. However, MP signal intensities showed that the
1:1 stoichiometry represented the near entirety of the complex formed compared to higher
stoichiometries.
14 Da
1 4 Da 1 9 Da
29 1 counts 1 Da
93 counts 13 counts 123 counts
29 Da
2 counts
Da Da
1 9 counts 433 Da 44 counts
212 counts
Figure 10.1. Mass photometry data for a. SIL-IFX and NATI mixture at 3 µg·mL-1, b. NATI and c. SIL-IFX at 3 µg·mL-1
individually. d. Incubation of NATI and SIL-ADM both at 3 µg·mL-1.
To ensure that the peak at 290 kDa did not contain NATI or infliximab dimers, both
proteins were analyzed individually and did not show dimeric forms (Figure 10.1.b-c). Plus, the
adalimumab antibody was shown to be inert in the presence of NATI in Figure 10.1.d. After
- 190 -
incubation of NATI and SIL-ADM, the MP data resulted in a single signal at 170 kDa. Therefore,
the results highlight that NATI targets the infliximab Fab but not the adalimumab Fab, although
both antibodies are anti-TNF-α. This could be explained by the differences in the amino acid
sequence of the two mAbs in the Fab region, with infliximab having a murine sequence and
adalimumab being a humanized antibody.
The MP data indicated that the interaction between NATI and infliximab resulted mainly
in a 1:1 stoichiometry. One crucial consideration is the bivalence of both compounds due to their
IgG1 nature. Hence, in the presence of NATI, infliximab can exist in either an unliganded, singly
liganded, or doubly liganded form, as represented in Figure 10.2. In its singly liganded form,
infliximab can be bound to a NATI on one Fab and still be active, meaning that it can still bind its
other arm to TNF-α.
Figure 10.2. Forms of binding of the mAbs for a 1:1 stoichiometry.
10.3.1.b. Equilibrium assessment
A kinetic study of the complexation process was performed by incubating NATI and
infliximab in PBS for different incubation times up to 60 min (Figure 10.3.a). The relative
proportion of each of the 4 monitored peaks showed that the equilibrium state seemed to be reached
after 3 min of incubation. Beyond this time, we can assume that the system is stable and will not
reorganize. The results also highlight that the other forms of complexes remained systematically
below 4 % regardless of the incubation time. Plus, the evolution of the proportions of each species
was evaluated with different initial molar proportions of NATI and infliximab. These data support
the fact that NATI and infliximab will interact with their Fab regions, leading mostly to 1:1
complexes, which can include singly liganded and doubly liganded mAbs.
- 191 -
Proportion ( )
Proportion ( )
Incubation time (min) NATI: in liximab molar

proportion
Figure 10.3.a. Kinetic study of SIL-IFX/NATI complexation. SIL-IFX and NATI fixed at 3 µg·mL-1 in PBS, acquisition by
mass photometry after different incubation times (n=3, error bars represent the standard deviation). b. Evolution of species’
proportion with different initial molar proportions (n=3, error bars represent the standard deviation).
10.3.2. CE-MS/MS for Kd determination of infliximab/NATI interaction
The affinity between neutralizing-antibody-to-infliximab (NATI) and infliximab was assessed

using the workflow depicted in Figure 10.4. The approach was derived from a competitive
screening assay. Infliximab and NATI were added to the model serum and incubated at 37°C for
1 hour. The MP experiments had shown that equilibrium was reached before this time.
Then, the amount of active infliximab (i) that did not form complexes with NATI is
quantified. An internal standard, consisting of stable-isotope labeled adalimumab (SIL-ADM),
was also added to the serum in order to account for possible losses during sample preparation
and/or analysis. Adalimumab is also an anti-TNF-α mAb that was not affected by NATI
neutralization; thus, it could be extracted simultaneously with the active infliximab. After
extraction and digestion of the purified infliximab and adalimumab antibodies, capillary
electrophoresis hyphenated by mass spectrometry (CE-MS/MS) was used to monitor the surrogate
peptides of Table 10.1, using analytical conditions recently developed by our group [270].
The objective was to link the MS signal of active infliximab to accurately assess the
dissociation constant of the infliximab/NATI interaction. The first step was therefore to establish
the absolute quantification of active SIL-IFX (in purple) using SIL-ADM (in orange). This was
verified by determining the concentration range where the MS response of the surrogate peptides
achieves linearity. Next, the relationship between active SIL-IFX concentration and the Kd was
determined. Finally, the workflow was applied to the IgG-enriched serum for Kd determination.
- 192 -
Serum model xtraction of active cid dissociation

Incubation
DM and I uffer exchange
ADM C 1
C 1
separation MS/MS analysis elationship f

Digestion to determine
Figure 10.4. Workflow for the Kd determination of infliximab/NATI complex, using CE-MS/MS analysis.
10.3.2.a Quantification of active infliximab

The characteristics of the absolute quantification of infliximab were first evaluated without the
presence of NATI. The selectivity of the method was verified by analyzing serum samples spiked
with SIL-IFX and SIL-ADM only. After CE-MS/MS analysis, the two surrogate peptides IFX*LC01
and ADM*HC01 exhibited significant different mobilities, leading to their consistent separation in
CZE (Figure 10.S1). In addition, no interference was observed in the extracted ion
electropherograms of the two peptides.
Consequently, the linearity between the ratio (r) of the surrogate peptides measured by CE-
MS/MS, and the concentration of active SIL-IFX was investigated in Figure 10.5. Good
repeatability and linearity (r²=0.982) were achieved over the range of 1-25 µg·mL-1. Therefore,
the results highlight that the quantification of active infliximab is possible in these concentration
ranges. The intercept is very close to zero and can be neglected.
For the following experiments, as described in the Figure 10.4, the SIL-IFX and SIL-ADM
were added systematically at 10 µg·mL-1 (i0). We define r0 = 1 as the ratio when no NATI is present
in the serum. Thus, in the subsequent experiments, depending on the initial concentration of NATI
(a0) in serum, the concentration of remaining active infliximab (i) will vary in the range 0 - 10
µg·mL-1 and can be quantified using this linear relationship.
- 193 -
Figure 10.5. Linearity of the IFX*LC01 / ADM*HC01 peptide ratio with the concentration of SIL-IFX (0-25 µg·mL-1).
Concentration of SIL-ADM fixed at 10 µg·mL-1. r² = 0.982, n = 3.
10.3.2.b. Interaction between infliximab and NATI paratopes
The affinity assessed in this work corresponds to the interaction of the paratopes on the Fab
region of infliximab and NATI. Table 10.2 presents the concentrations of active (free) and bound
Fab paratopes when infliximab and NATI are introduced into the same serum. Bobrovnik et al. (2003)
described a similar paratope interaction study after measuring the absorbance of an antibody in an
ELISA plate after complexation with its antigen [283]. As their study was based on an antigen-
antibody interaction, they took into account the bivalency of the antibody, but not the antigen. It was
possible to adapt their mathematical model to ours (antigen being the bivalent NATI).
Table 10.2. Complexation reaction of infliximab and NATI paratopes when introduced in a solution.
State Paratope (SIL-IFX) + Paratope (NATI) ↔ Liganded paratopes
Initial 2𝑖0 2𝑎0 0
Equilibrium 2𝑖0 − 𝑥 2𝑎0 − 𝑥 𝑥
a0 the initial concentration of NATI (µg·mL-1)
i0 the initial concentration of SIL-IFX (µg·mL-1)
x the concentration of liganded paratopes (µg·mL-1)
The term “x” defines the concentration of total bound infliximab/NATI paratopes at equilibrium.
Consequently, “p” represents the probability that a paratope of infliximab is neutralized:
𝑥
𝑝= (10.2)
2𝑖0
Thus, the probability of active infliximab paratope is (1 – p). For an entire infliximab to be fully
neutralized, both of Fab paratopes must be bound to NATI, resulting in the product of the two “p”
probabilities, assuming independent events. The probability that infliximab is fully neutralized is
𝑥
𝑝² = ( )² (10.3)
2𝑖0
- 194 -
The probability of having active infliximab with at least one paratope free (unliganded or singly
liganded) is also equal to the probability of extracting active infliximab during the affinity
purification step described in Figure 10.4.
𝑖
1 − 𝑝2 = (10.4)
𝑖0
Using equation (10.3) and the linearity between r and i established in Figure 10.5, we can conclude
that:
𝑥 2 𝑟
1−( ) = (10.5)
2𝑖0 𝑟0
Solving for x, and using numerical values for i0 (= 10 µg·mL-1) and r0 (= 1), one establishes
𝑟
𝑥 = 2𝑖0 √1 − = 20√1 − 𝑟 (10.6)
𝑟0
10.3.2.c Determination of Kd using CE-MS/MS analysis
Based on the law of mass action, the dissociation constant of infliximab/NATI paratope
interactions can be defined as:
(2𝑎0 −𝑥)(2𝑖0 −𝑥)
𝐾𝑑 = (10.7)
𝑥
Equation (10.6) has been further transposed into equation (10.7), still using the numerical value 1
for r0, resulting in the establishment of the following expression:
𝑎0 √1−𝑟
= (10.8)
𝐾𝑑 2(1 √1−𝑟)
Detailed calculations are given in the supporting information. Note that the equation (10.8)
was established with the hypothesis that 2a0 >> x, which means that the initial concentration of
NATI must be higher than the concentration of the formed complexes. Bobrovnik et al. (2003)
have suggested that this equation is valid even if the condition 2a0 >> i0 is difficult to observe,
especially because the plot of equation (10.8) will minimize the associated errors. The small values
of a0 will have little effect on the linear regression [283].
The objective was to assess with CE-MS/MS the ratio denoted as r, of standard serum solutions
containing NATI (a0: 0 – 30 µg·mL-1), alongside fixed concentrations of infliximab (i0) and SIL-
ADM. The graph of the IFX*LC01/ ADM*HC01 surrogate peptide ratios is depicted in Figure 10.6
and shows a progressive decline with higher concentrations of NATI. This phenomenon indicates
the diminishing biological activity of infliximab due to the neutralizing effect of NATI, which
consequently hinders its extraction during the purification process.
- 195 -
Figure 10.6. Ratio between SIL-IFX/SIL-ADM CE-MS/MS signals as function of the initial concentration of neutralizing-
antibodies-to-infliximab (NATI, a0) added to serums. Error bars represent the standard deviation among the triplicates.
The results presented in Figure 10.6 highlight crucial information on the infliximab/NATI
complexation. At equimolar molar concentration (i0 = a0 = 10 µg·mL-1), it appears that
approximately 80 % of the infliximab antibodies were fully neutralized by the NATI (both paratope
bound) and therefore not extracted by TNF-α. This could suggest that under native conditions, the
majority of NATI/infliximab interactions occur in a doubly liganded form (Figure 10.2).
It is important to note that, in order to derive the affinity dissociation constant Kd from the CE-
MS/MS analysis, we considered that the extraction of the active infliximab from the mixture using
TNF-α functionalized beads did not readjust the equilibrium of the NATI/SIL-IFX neutralization.
Equilibrium readjustment was found to be negligible in a previous study for another
antigen/antibody complex after extraction in ELISA plates [282]. This property was explained by
the nanomolar affinity of the interactions between infliximab and NATI or TNF- α. Consequently,
equation (10.8) was used to calculate the apparent Kd, by plotting a0/Kd as a function of the initial
concentration of NATI a0, as shown in Figure 10.7. Kd corresponds to the inverse of the slope and
was found to be 14.8 ± 1.2 nM. The error was calculated as the 95 % confidence interval of the
slope.
- 196 -
Figure 10.7. Plot of a0/Kd calculated using equation (10.8) as a function of the initial concentration of NATI a0. Linear relationship
ranging from 0 to 10 µg·mL-1. r² = 0.973. Y= 0.45*X-0.23. Error bars represent the standard deviation among the triplicates.
The information provided by the manufacturer of NATI indicated a Kd value of 1.8 nM for
the monovalent intrinsic affinity between NATI and infliximab, which represents a non-
negligeable deviation, although it also reflects a strong affinity. We believe that the difference
originates from the design of the workflows. The affinity corresponds to the strength of the
interaction of a single paratope of infliximab with a paratope of a NATI. The manufacturer
evaluated the monovalent intrinsic affinity after functionalization of infliximab on a solid plate.
Here, the strategy was performed in a native environment, which may have different structural
conformation, and thus imply different binding forces. Moreover, the Kd calculated in this paper
reflects the average binding strength of all paratopes with infliximab existing in mixed valences of
Fab region. Indeed, we could suggest that the intrinsic affinity of a local
infliximab(paratope)/NATI(paratope) interaction might differ slightly depending on whether the
compounds are singly liganded or doubly liganded [293].
Overall, this methodology provides valuable insight into the interaction between infliximab
and NATI while minimizing artifacts and preserving the native state of the components. The
strategy maintains the liquid diffusion of both antibodies, without any labeling or surface-
functionalization during the complexation. Another advantage of this approach is that it focuses
on the quantification of unbound drugs, and the complexes are not the primary target of the method.
In addition, the strategy incorporates an internal standard, to account for losses during sample
preparation, thereby improving the reproducibility of the method.
- 197 -
10.4. Conclusions
The study demonstrated a novel label-free and immobilization-free method for determining the
dissociation constant between a mAb and its neutralizing anti-antibody. The approach utilized
capillary electrophoresis-mass spectrometry (CE-MS) and an internal standard to eliminate bias
during manipulation and analysis, enabling precise characterization of the remaining active
infliximab by absolute quantification. MS quantification using a peptide-centric approach has
proven its validity and efficiency in several applications. The use of tandem MS/MS facilitated the
accurate identification of surrogate peptides. Plus, the quantification of unbound compounds
minimized errors associated with maintaining complex integrity. A robust mathematical model
compatible with CE-MS/MS data was developed to relate the concentration of remaining active
infliximab to the apparent dissociation constant. To our knowledge, CE-MS/MS has never been
used to determine the dissociation constant between therapeutic mAbs and their corresponding
anti-drug antibodies. We applied this strategy to a specific NATI of IgG1 type, as it represents the
majority of immunogenic responses of patients treated with infliximab, in order to provide a proof-
of-concept of the CE-MS/MS analytical strategy [294].
The developed approach therefore calculates the apparent Kd, between two paratopes in a
native environment which represents relevant information about the immunogenic response of a
drug. The mathematical model assumed a binomial distribution of monovalently versus divalently
occupied antibodies. It was further assumed equal recognition of singly liganded and unliganded
infliximab on TNF-α. Those assumptions, although currently widely used for Kd assessment, could
require further investigation to assure their validity in the considered system [295]. Plus, the
accuracy of the strategy should be assessed through multiple batches of infliximab and NATI.
Overall, we believe that the configuration of the proposed approach could lead to novel
information’s on biological interactions and illustrates the need of diverse analytical
methodologies for better understanding of biological processes. The broader implications of this
approach could lead to advances in characterizing therapeutic drugs.
- 198 -

10.5.1. Figures
Figure 10.S1. Extracted ion electropherograms (EIE) illustrating the two selected prototypic peptides of SIL-ADM and SIL-
IFX a. Blank serum spiked with the two SILs (10µg·mL-1, no NATI) revealing no interference on the EIE signal with monitoring
of SIL-IFX and SIL-ADM. b. Zero of normal serum extracted and analyzed, without any of the 3 compounds.
10.5.2. Additional discussion on mathematical model

Strategy for Kd determination after extraction and CE-MS/MS analysis of unbound SIL-infliximab
post-incubation with neutralizing anti-infliximab.
If 2a0 >> x, according to Bobrovnik et al. [283], the law of mass action becomes :
𝐾𝑑 2(2i0 −x)
= (S10.1)
𝑎0 x
Whith i0 = r0/0.1 and using the equation (10.6) established in the manuscript, one obtains:
2𝑟 2𝑟 𝑟
2( 0 − 0∗√1− )
𝐾𝑑 0.1 0.1 𝑟0
= 𝑟 𝑟
(S10.2)
𝑎0 2 0 √1−
0.1 𝑟 0
Finally, after algebraic manipulation, the equation (S10.2) becomes:
𝑟
√1−𝑟
𝑎0 0
= 𝑟
(S10.3 = 10.8)
𝐾𝑑 2(1-√1− )
𝑟0
Appendix 10.S2. Is the hypothesis 2a0 >> x valid?

The equation (S10.3) was obtained considering that the initial number of paratopes of NATI is in
excess of bound paratopes at equilibrium. This condition can be difficult to reach for small values
of a0. Bobrovnik et al. (2000) explained in a study that plotting Y as a function of a0 will limit the
errors associated with conditions where 2a0 >>x is difficult to observe [283]. This can be explained
by the fact that the linear regression slope will mainly be affected by the high values of a0, and not
- 199 -
the lowest. In this study, the Kd was determined plotting (S10.3) for a0 ranging from 1 to 30 µg·mL-
1
and was found to be 14.8 ± 1.2 nM. As the linearity is sufficient (r² >0.97) and the replicates are
close to the curve, the slope does not vary much even without small a0, as represented Figure
10.S2.
Figure 10.S2. Evolution of the slope, and thus the Kd, according to the data taken into account.
- 200 -
Chapitre 11 – CE-MS/MS pour la quantification d’infliximab de ses M et de ses anti-mAbs
C HAPITRE 11.
Q UANTIFICATION SIMULTANEE DE L ’ INFLIXIMAB ET
DE SES ANTICORPS IMMUNOGENES DANS LE SERUM
PAR CE-MS/MS
Préambule
Lors d’un suivi clinique de patients traités par mAb, il est important de suivre la concentration de
l’anticorps thérapeutique biodisponible, ainsi que la concentration des anticorps anti-médicaments
que l’organisme a pu développer. Ces analyses quantitatives s’effectuent généralement à l’aide de
techniques d’immunodosages, comme les tests ELISA. Cependant, la configuration de ces dosages
implique de quantifier les protéines séparément, via des analyses distinctes. Ces doubles
quantifications entraînent la multiplication du temps d’analyse, mais aussi le risque d’erreurs. Les
méthodes analytiques permettant l’obtention de plusieurs informations d’un échantillon à partir
d’une seule analyse sont donc extrêmement attirantes. L’objectif de ce chapitre a été de démontrer
la capacité de la méthodologie CE-MS/MS pour la quantification simultanée de l’infliximab et de
NATI à partir de matrices biologiques.
Les parties II et III de ce manuscrit ont décrit l’utilisation d’une stratégie d’analyse peptidique par
CE-MS/MS pour la quantification absolue de l’infliximab dans du sérum, par utilisation d’un
standard interne, le SIL-IFX. Cependant, le chapitre 10 précédent a démontré que la présence de
NATI actifs dans le sérum de départ, lorsqu'on y ajoute du SIL-IFX, entraîne immédiatement la
complexation de ces deux composés. Ainsi, après extraction spécifique par TNF-α, seuls les SIL-
IFX libres pourront être extraits. Cela a pu être observé dans des travaux réalisés par El Amrani et
al. (2019), qui ont noté une réduction du signal de leur standard interne lorsque les patients
présentaient une production d’anticorps anti-infliximab [296]. Cette baisse de signal peut donc être
utilisée pour détecter de manière fiable la présence de NATI dans le sérum, comme présenté dans
le chapitre 10. Cette détection permet alors de signaler immédiatement à l’utilisateur que la
quantification d'infliximab ne peut plus être déduite du signal du SIL-IFX, puisque ce dernier
dépend de la concentration de NATI.
L’objectif de ces travaux de ce dernier chapitre 11 fut donc de mettre à profit les pertes de
SIL-IFX incontrôlées en présence de NATI pour développer une stratégie analytique capable de
quantifier simultanément l’infliximab et le NATI dans du sérum.
Les travaux présentés dans le chapitre qui suit sont rédigés en anglais car ils font l’objet
d’une publication scientifique en cours de finalisation dans une démarche de diffusion scientifique.
Ils seront ainsi soumis à une revue scientifique à comité de lecture.
- 201 -
Simultaneous quantification of infliximab and corresponding anti-drug

antibodies in serum using capillary electrophoresis-tandem mass
spectrometry
Tessa Reinert, Pascal Houzé, Nathalie Mignet, Aynur Naghizade, Lola Alez-Martin, Armand
Leclerc, Yannis-Nicolas Francois, Rabah Gahoual
Abstract:
Infliximab, a TNF α inhibiting monoclonal antibody, has demonstrated efficacy in treating chronic
inflammatory immune disorders. However, some patients develop an autoimmune response to this therapy
and produce neutralizing anti infliximab antibodies (NATI), that target the active site of infliximab. This
leads to reduced pharmacological activity of the drug. During infliximab treatment, physiciens need to
periodically quantify the remaining levels of the drug in the patient's bloodstream to adjust subsequent
doses. Additionally, they must assess NATI levels to modify clinical treatment if an immunogenic response
has occurred. Immunoassays are commonly used for these quantifications, but they require separate
methods for analyzing the two compounds. In addition, these assays produce false positive and false
negative results that can bias clinical decisions.
This paper introduces a promising method using CE MS/MS method for the simultaneous
quantification of infliximab and its NATI in serum. The approach employs a competitive screening assay
in which isotopically stable labeled infliximab (SIL IFX) is introduced into the serum, attracted by any
remaining NATI. Thus, bound SIL-IFX will be unable to bind the TNF α ligand. The decrease in SIL-IFX
concentration was quantified using SIL-adalimumab (SIL-ADM) as an internal standard. This reduction
was then correlated with the concentration of NATI based on the binding characteristics of these
compounds. Simultaneously, the method allowed for the absolute quantification of infliximab. The article
presents the evaluation of the method and its application to 13 serums from patients with Crohn's disease
who were undergoing infliximab treatment. This innovative approach provides a novel means for
monitoring patients following antibody-based treatments, enhancing the follow-up care process.
11.1 Introduction
Infliximab is a chimeric monoclonal antibody that specifically binds to TNF-α, a key mediator of
the inflammation associated with Crohn’s disease [228]. However, a significant proportion of
patients (~30 %) receiving this biopharmaceutical product shows loss of therapeutic response
either immediately or after a few weeks of treatment [297]. Part of this therapeutic failure has been
correlated with an immunogenic response leading to the development of natural antibodies against
infliximab [165,277,298,299]. Indeed, the 25 % murine sequence of infliximab has been
- 202 -
implicated in promoting the drug’s immunogenicity, which varies among patients [300]. In a
review by Strand et al. (2017), it was observed that the development of anti-infliximab antibodies
(ATI) occurred in frequencies ranging from 3 % to 83 % among patients treated for Crohn's disease
[60]. In particular, ATI can target the variable part of infliximab, called neutralizing antibodies to
infliximab (NATI), and interfere with the drug’s ability to bind to TNF-α. Consequently, this
reduced drug efficacy may result in loss of therapeutic response, necessitating increased drug
dosages or the consideration of alternative treatments. Therefore, several gastroenterology
societies have reported the need to monitor drug-targeted antibodies during patient follow-up
[301,302].
Numerous analytical techniques have been developed to quantify anti-drug antibodies
(ADA). Typically, ADA assays rely on a relative signal readout after ADA complexation with the
drug using a surface-based ligand-binding assay (LBA), such as enzyme-linked immunosorbent
assay (ELISA) [170,303,304] or surface plasmon resonance (SPR) [305–307]. However, the
immobilization procedures required for these techniques can mask relevant epitopes. Recently,
homogeneous mobility shift assay (HMSA), and capillary mobility shift displacement assay were
introduced to allow complexation in solution, and assess weak drug-protein interactions
[59,308,309]. For the clinical follow-up of patients treated with biotherapeutics, immunogenicity
is usually assessed on a case-by-case basis, only when patients show unexpectedly low drug levels
or a decrease in clinical response. This requires additional manipulations of patient serums, which
needs a dedicated assay and may introduce bias. The lack of analytical methods that allow the
simultaneous quantification of therapeutic mAb and ADA might explain why the identification of
immunogenic reactions is not routinely performed, even though they are important predictors of
poor treatment response.
The present article is devoted to the development of a capillary electrophoresis-mass
spectrometry (CE-MS/MS) method for the simultaneous quantification of the therapeutic mAb
infliximab, and its corresponding NATI from serum samples. The quantification of NATI was
performed indirectly by measuring the loss of stable isotope labeled infliximab (SIL-IFX) captured
by free NATI after introduction to serum. Simultaneously, the fraction of active infliximab
extracted from the serum was quantified using CE-MS/MS analysis. The method was first applied
to serum samples spiked with known concentrations of IFX and NATI in order to investigate the
characteristics of the developed CE-MS/MS analytical strategy. Finally, the analytical strategy was
applied to 13 serum samples from patients with Crohn’s disease and treated with infliximab.
- 203 -
11.2 Materials and methods

▪ Chemicals. The chemicals used were of high purity grade and purchased from Merck
Sigma-Aldrich (Saint-Louis, MO, USA) if not stated otherwise. Isotopically labeled internal
standards of infliximab (SIL-IFX) and adalimumab (SIL-ADM) were labeled on arginine and
lysine (13C6; 15N4) and supplied by Sigma-Aldrich (Saint Louis, MO, USA). Infliximab (IFX,
Remicade®) is purchased from the manufacturer (Merck Sharp and Dohme). As a standard for the
NATI, a full-length human anti-idiotypic antibody against IFX, clone AbD17841_hIgG1) was
obtained as 0.5 mg·mL-1 in PBS solution from BioRad Laboratories (California, U.S.A). RapiGest
SF surfactant was purchased from Waters (Milford, MA). Streptavidin M-280 DynabeadsTM was
obtained from ThermoFisher Scientific Invitrogen (Carlsbad, CA) and TNF-α biotinylated from
R&D System, Biotechne. Sequencing-grade modified trypsin was purchased from Promega
Corporation (Madison, WI, USA). PBS) was purchased from Gibco ThermoFisher (Waltham, MA,
USA). Blank serums were obtained from the French Institute of Blood (Paris, France).
▪ Standard solutions. Standard solutions for calibration curves for infliximab quantification
were prepared from blank serum spiked with a constant concentration of SIL-ADM and SIL-IFX
(10µg·mL-1) and increasing concentrations of infliximab ranging from 0.5 to 25 µg·mL-1.
Standard solutions for calibration curves for NATI quantification were prepared from blank
serum spiked with a constant concentration of SIL-ADM and SIL-IFX (10 µg·mL-1 each) and
increasing concentrations of NATI (range 1-30 µg·mL-1). Samples were incubated for 1h at 20°C.
Quality control (QC) samples were prepared from blank serum spiked with IFX (0, 5 or
10µg·mL-1) and NATI (1-20 µg·mL-1). The samples were incubated for 1 h to allow the formation
of the IFX and NATI complexes. Then, SIL-ADM and SIL-IFX were added (10 µg·mL-1 each)
and the sample was again left at 20°C for 1h for the remaining NATI to complex with SIL-IFX.
▪ Patient serums. Serum samples were obtained from 13 patients provided by Saint-Louis
Hospital (Paris, France). Eligible patients were diagnosed with Crohn’s disease for at least 3
months and were receiving periodic IFX injections. 100 µL of serums per patient were collected,
followed by the addition of SIL-ADM and SIL-IFX (10 µg·mL-1each).
▪ Sample preparation. The preparation of serum samples was identical to that recently
published by our group [270]. Briefly, affinity purification of all anti-TNFα antibodies in the serum
(IFX, SIL-IFX, and SIL-ADM) was performed with Streptavidin M-280 DynabeadsTM
functionalized with biotinylated TNF-α. The ferromagnetic beads was added to the serum and
incubated at 20°C for 1h. The beads were then washed with PBS to remove the serum. Acidic
dissociation of the mAb from TNF-α was performed using 50 µL of MeOH/H2O/FA:48.5/48.5/3
% solution. The supernatants were pooled and dried for 2 h. The sample was reconstituted in 50
- 204 -
mM ammonium bicarbonate. This step followed a denaturation-reduction-alkylation-digestion

workflow commonly used for monoclonal antibody digestion of peptides. Peptide digests were
finally dried before being diluted in 5 µL ammonium acetate, 100 mM, pH 4.
▪ CE-MS/MS analysis. A CESI8000® Capillary Electrophoresis system (Sciex separations,

Darmstadt, Germany) was hyphenated to a 5600 TTOF mass spectrometer (Sciex Darmstadt,
Germany) thanks to a porous tip sheathless interface. CE-MS/MS analysis was performed
following a previously described method [270]. Briefly, 68 nL of sample were injected in the CE
capillary and the separation was carried out applying a +23 kV voltage on the bare fused silica
capillary (total length 100 cm; 30 μm i.d.) filled with 10 % acetic acid. MS detection was
performed in ion positive mode over the range 100 – 2000 m/z. Experiments MS/MS were
performed in Top20 information-dependent acquisition (IDA, Sciex), with a total duty cycle of 1.9
s. Data were analyzed using Skyline® software [209].
Quantification was based on monitoring three proteotypic peptides: infliximab (IFX), SIL-
infliximab (SIL-IFX), and SIL-adalimumab (SIL-ADM) (Table 11.1). The surrogate peptides were
proteotypic and had no known post-translational modification. They were first predicted using in
silico trypsin digestion and blasted with a human database to ensure their specificity.
Quantification relied on the area of the precursor signals after MS/MS confirmation (Figure 11.S1).
▪ Comparison study. QC and the 13 serum samples from patients treated with infliximab
were analyzed using the CE-MS/MS strategy for both quantification of infliximab and NATI.
Results were then compared using an enzyme-linked immunosorbent assay (ELISA). The
Promonitor® IFX kit was used to quantify infliximab. When the concentrations exceeded the
analytical performance range of this kit (14 µg·mL-1), the serums were diluted by 600. The
Promonitor® anti-IFX kit was used for NATI quantification after dilution of all serums by 2. The
correlation between the ELISA and CE-MS/MS quantification results was established using linear
regression analysis.
Table 11.1. Ions of surrogate’s peptides for IFX, SIL-IFX and SIL-ADM
Peptide sequence Name Analyte Used as Precursor Product ions
(m/z) (m/z)
y9- 957.53; y8- 844.45; y7-
DILLTQSPAILSVSPGER IFXLC01 IFX Quantifier 948.52 731.36; y6-644.33; y5-545.26
DILLTQSPAILSVSPGER* y9- 967.54; y8- 854.34; y7-
IFX*LC01 SIL-IFX Quantifier 953.53
(13C,15N) 741.37; y6-654.34; y5-555.27
EVQLVESGGGLVQPGR* y8- 909.45; y7- 746.39; y6-

ADM*HC01 SIL-ADM IS 817.94
(13C,15N) 645.34; y5-498.27; y4-441.25
- 205 -
11.3 Results and discussions

The workflow for the simultaneous quantification of active infliximab (b0) and neutralizing
antibodies to infliximab (NATI) from the serum (a0) is presented in Figure 11.1. El Armani et al.
(2019) recently described a strategy using SIL-ADM and SIL-IFX for the quantification of NATI
in serum [296]. That strategy was adapted to be compatible with CE-MS/MS.
After collection of serum containing active infliximab and NATI, two stable isotope-
labeled mAbs, SIL-IFX and SIL-ADM, both of which are anti-TNF-α antibodies, were added and
incubated. The majority of patient-derived NATIs are of the IgG1 type and are therefore bivalent.
In the presence of active NATI, a paratope of the Fab region of SIL-IFX will bind to a paratope of
NATI, preventing its extraction based on TNF-α affinity interaction.
This purification step extracts all active anti-TNF-α antibodies, that have at least one
available binding site paratope in the Fab region capable of interacting with TNF-α. Subsequent
tryptic digestion of the purified antibodies generates peptides that are separated by CE and
analyzed by mass spectrometry. The SIL-ADM antibody does not interact with any other IgG
present in the serum and serves as an internal standard to account for the loss of both SIL-IFX and
infliximab during sample preparation/analysis. The MS approach is based on DDA (Data
Dependent Acquisition), which allows monitoring of multiple peptides, including the surrogate
peptides specific to the three anti-TNF-α agents used for quantification (Table 11.1).
ratio r of SILs
ADM HC01
Concentration of
IFX active in liximab
LC01
IFX LC01
ratio r of SILs
Concentration of
active NATI
Figure 11.1. Principle of simultaneous quantification of infliximab and infliximab-neutralizing antibodies in human serum
by CE-MS/MS analysis.
11.3.1. Quantification of infliximab
Absolute quantification of active infliximab in serum was performed using standards of infliximab
spiked serums. These standards did not contain NATI, ensuring that the amount of infliximab
- 206 -
spiked into these samples (designated as "b0") represented the active amount. Our research group
has recently published a CE-MS/MS method for the absolute quantification of infliximab, using
SIL-IFX as an internal standard [270]. However, if patients had developed an immunogenic
response in the form of NATI, these antibodies would bind to the spiked SIL-IFX, and thus
interfere with the quantification of infliximab. To address this issue, the quantification required
the use of an antibody internal standard that is unaffected by the presence of NATI, and that can
be extracted by TNF-α functionalized beads. Thus, SIL-ADM was identified as a suitable choice.
After digestion of the mAbs and CE-MS/MS analysis, the two surrogate peptides, one from
infliximab (IFXLC01) and the other from SIL-ADM (ADM*HC01), exhibited significantly different
mobilities, leading to their consistent separation in CZE (Figure 11.S1). The peptide fragment
fingerprint was verified using MS/MS data, confirming the presence of characteristic fragment
ions (Figure 11.S2). CE-MS/MS analysis of standards samples showed a linear relationship (r² =
0.994) for active infliximab concentrations ranging from 1-25 µg·mL-1 as depicted in Figure 11.2.
Figure 11.2. Linearity of the IFXLC01 / ADM*HC01 peptide ratio with the concentration of infliximab (1-25 µg·mL-1). Concentration
of SIL-ADM fixed at 10 µg·mL-1. r² = 0.994, n = 3 Error bars represent the standard deviation of triplicates. r²=0.994.
11.3.2. NATI quantification development
The approach was adapted from a recent publication by El Amrani et al. (2019), which observed
a correlation between the quantification of NATI in serum and the extent of SIL-IFX loss [296].
Increasing the initial concentration of NATI in the serum resulted in an increase in the amount of
SIL-IFX paratopes bound to NATI. This binding led to a reduction of the SIL-IFX signal observed
by mass spectrometry.
In a recent work, our group demonstrated the possibility of establishing a relationship
between the measured peptide ratio IFX*LC01/ADM*HC01 (designated as “r” and the initial
- 207 -
concentration of NATI (denoted as “a0”) in serum. This correlation was derived using equation
(11.1), which was introduced and elaborated upon in Chapter 10. The formulation of this equation
was based on the law of mass action, considering that SIL-IFX, which has two paratopes, can be
extracted during the purification step while being singly liganded by NATI or being unliganded.
𝑟
𝑎0 √1−𝑟
0
= (11.1)
𝐾𝑑 2(1−√1− )
𝑟
𝑟0
With r0, the IFX*LC01/ ADM*HC01 ratio obtained after applying the workflow (Figure 11.1) to a
blank serum without NATI, and spiked only with the SILs, which was found to be equal to 1.
Kd corresponds to the dissociation affinity constant of a paratope of SIL-IFX and an IgG1
NATI compound, which was found to be equal to 14.8 ± 1.2 nM (see Chapter 10). This dissociation
constant was established in conditions strictly identical to those used in this work. The NATI/SIL-
IFX interaction was performed in serum, label-free and functionalization-free.
Therefore, by measuring the ratio r of the SIL-IFX and SIL-ADM surrogate peptide signals
by CE-MS/MS and inserting this value into equation (11.1), it is possible to directly quantify the
initial amount of NATI (a0). This was applied to 7 concentrations of NATI (1 to 30 µg·mL-1) added
to model serum, followed by the addition of the SILs (workflow of the Figure 11.1, without IFX).
Subsequent CE-MS/MS analysis led to the determination of the ratio “r” of each sample. The back-
calculation of these NATI-spiked serum standards using equation (11.1) resulted in an average
bias from the nominal concentration of less than 20 % (dotted lines) in the range of 1 to 30 µg·mL-1
(Figure 11.3). The method was also applied on 3 replicates of model serum without NATI, and
systematically measured a back-calculation of less than 0.3 µg·mL-1. The results highlight that the
detection of NATI in serum is possible in the concentration range commonly found in patients
treated with infliximab [296,310].
- 208 -
Figure 11.3. Bias from nominal concentration of NATI a0 calculated with equation (11.1) after CE-MS/MS measurement of r
for standards in serum.
The strategy presented here offers a distinct advantage by enabling the detection of NATI in serum
without the need to extract it from the biological matrix. This feature represents a significant
workflow benefit, especially considering the challenging nature of purifying such compounds.
Some strategies require maintaining the interaction of the NATI with its antigen throughout the
process, including washing steps and separation methods [310,311]. The approach proposed here
allows an absolute quantification of the remaining SIL-IFX that did not interact with the NATI,
using CE-MS/MS analysis.
11.3.3. Simultaneous quantification of IFX and NATI in model serum samples
To evaluate the ability of the CE-MS/MS method to simultaneously determine the concentrations
of active infliximab and NATI, quality controls (QC) with known initial concentrations of these
both compounds were prepared in model serums. The QC were then incubated for 1 h to allow
complex formation. The objective was to quantify the remaining concentrations of actives agents,
that had not interacted with each other. Subsequently, the two SILs were introduced into the QC,
and the workflow illustrated in Figure 11.1 was executed to quantify the residual amounts of active
infliximab (b0) and NATI (a0). The results of this process are presented in Figure 11.4.
For the quantification of active infliximab, the IFXLC01/ADM*HC01 ratio (y) was determined
from the CE-MS/MS data of the QCs. The concentration of active infliximab (b0) was determined
using the linear relationship established in Figure 11.2. The QC were prepared with two different
starting concentrations of infliximab: 5 µg·mL-1 (Figure 11.4.a) or 10 µg·mL-1 (Figure 11.4.b), and
initial concentration of NATI (0 – 20 µg·mL-1). A clear trend emerged from the measured (b0). As
- 209 -
the initial concentration of NATI increased, the level of (b0) decreased. This suggests that NATI
specifically targets the CDR region of infliximab, resulting in its inability to be extracted with the
TNF-α ferromagnetic beads.
Simultaneously, the IFX*LC01/ADM*HC01 ratio (r) was determined from the same CE-
MS/MS data. The concentration of the remaining unbound NATI (a0) was calculated using
equation (11.1). When the active infliximab (b0) is still present in the serum, the concentration of
NATI (a0) is observed to be close to zero. This outcome indicates that all of the initial NATI has
interacted with infliximab during the first incubation and is therefore unable to bind to SIL-IFX
during the second incubation. In contrast, when only negligible levels of (b0) are detected, the
measured (a0) showed a significant increase.
The results are consistent with cohort studies that have found similar correlations between
infliximab levels and autoimmune antibodies in patients. The presence of NATI has been shown
to be typically associated with low levels of active infliximab [312,313]. These results from QC
samples underscore the ability of the method to simultaneously quantify infliximab and NATI in
serum, using CE-MS/MS. This ability holds great potential for enhancing the monitoring and
understanding of these critical components.
Figure 11.4. Evolution of calculated (a0) and (b0) values after CE-MS/MS analyses of normal serum spiked with infliximab
(a. 5 µg·mL-1 or b. 10 µg·mL-1) and NATI (0 -20 µg·mL-1).
- 210 -
11.3.4. Patients’ serums analysis
Finally, the method was applied to serum samples from a group of 13 patients diagnosed with
Crohn's disease and undergoing infliximab treatment. After the collection of these serum, they
were spiked with SIL-IFX and SIL-ADM, both added at a concentration of 10 µg·mL-1. After
incubation of the serum for 1 hour, the sample preparation steps outlined in Figure 11.1 were
executed, and subsequently, the prepared samples were subjected to analysis using CE-MS/MS.
The signal of the three surrogate peptides for infliximab, SIL-IFX and SIL-ADM (Table 11.1)
were monitored.
First, the y-ratio was determined for the 13 patients, to quantify the active infliximab
concentration (b0). The same 13 serum samples were concomitantly analyzed in a commercially
available IFX-ELISA assay, which is a widely used technique for quantifying the concentration of
infliximab. The comparison of CE-MS/MS and ELISA analyses, shown in Figure 11.5, exhibited
a good correlation (R² = 0.923) between the two techniques. As previously observed by our group
or other studies, the ELISA assay seems to underestimate the concentration of active infliximab,
probably because this technique requires two distinct interactions of IFX, one with the plate, and
the other with the detection reagent [175,270].
The same CE-MS/MS data collected for each analysis of the 13 serums of patients led to
the determination of the r-ratio. The r values were then inserted into equation (11.1) for (a0)
determination, still using Kd equal to 14.8 nM. The same 13 samples were also analyzed using
anti-IFX ELISA for NATI quantification. Figure 11.5.b shows the comparison of the measured
concentrations of NATI of these serums by the CE-MS/MS strategy and the ELISA assay. The
results showed that the serum of two patients (red dots), analyzed in duplicate, was positive for
NATI in both assay techniques, with NATI levels in CE-MS/MS of 2.63 ± 0.8 and 8.6 ± 1.5 µg·mL-
1
. In the remaining 11 serum samples, no active NATI was detected by either assay technique.
It should be noted that the anti-IFX ELISA assay provides semi-quantitation of NATI in
arbitrary units (UA·mL-1). In our specific study, the NATI used as a calibrator was of the IgG1
isotype with a molecular mass of approximately 150 kDa, as previously documented in related
research [310]. Since most NATI interactions with infliximab are mainly through IgG1 and IgG4
forms in immune system, we adopted the value of 150 kDa to convert the NATI concentration into
international units (IU) [314,315]. Plus, this underlines an interesting aspect of the approach, as it
allows the detection of all neutralizing antibodies-to-infliximab IgG by CE-MS/MS without
knowing their amino acid sequence. This indirect approach is particularly interesting as anti-drug
antibodies can exist in polyclonal forms specific to each patient, and therefore do not exist as
universal antibodies.
- 211 -
Another interesting aspect shown in Figure 11.5 is the level of infliximab in the two patients
with non-negligible levels of NATI (red dots). As shown in Figure 11.5.a, infliximab was found
at negligible levels (< 0.4 µg-mL-1) in both serums. In contrast, no NATI was detected in any of
the other 11 serums from patients with detectable levels of active infliximab. This indicates a
strong correlation between the two quantitative data, which has already been reported in the
literature [298]. Therefore, the comparison of the quantification of infliximab (b0) and NATI (a0)
obtained either simultaneously by CE-MS/MS or by two different ELISA assays led to an adequate
correlation and confirmed the validity of the CE-MS/MS results.
The concentrations measured by this method correspond to the biologically active ones.
The approach quantifies the amount of infliximab able to bind to TNF-α, and the amount of NATI
able to dissimulate the CDR region of infliximab by binding to it. Antibodies-to-infliximab
directed against other regions of infliximab, such as its Fc portion, will not prevent the extraction
of SIL-IFX and will therefore not be detected. In addition, if the serum contains already formed
infliximab/NATI complexes, the approach will not quantify them.
Figure 11.5.a. Concentration of active IFX a0 in 13 serums of Crohn’s disease patients analyzed by ELISA assay or CE-MS/MS
method. Linear regression line plotted. b. Concentration of active NATI b0 in serum of 13 Crohn’s disease patients analyzed by
ELISA assay or CE-MS/MS method. Error bars represent duplicate values.
- 212 -
11.4. Conclusions
This article demonstrates the simultaneous quantification of biologically active therapeutic

monoclonal antibodies and their neutralizing antibodies to infliximab (NATI) IgG using CE-
MS/MS analysis. The absolute values of infliximab was shown to be possible in the range of 1-25
µg·mL-1. The method was also shown to be suitable for the detection of NATI over a concentration
range of 1-30 µg·mL-1. These two concentration ranges cover the concentrations commonly found
in the serum of patients treated with infliximab. For both quantifications, the use of an isotope
labeled internal standard added at the beginning of the sample process enabled to account for the
sample preparation losses. The ability for simultaneous quantification was demonstrated with the
analysis of 13 serum from patients with Crohn's disease and treated with infliximab, illustrating
two patients with high levels of NATI and indistinguishable concentrations of infliximab.
In this article, the quantification of NATI was based on a statistical model previously
presented in a recent work (Chapter 10). This model considers the bivalency of the mAbs and led
to the determination of the dissociation constant (Kd) of the infliximab/NATI interaction under
conditions strictly identical to those reproduced in this article. Although the assumptions resulting
from this model could benefit from further experimental research, we believe that it is the most
appropriate for the SIL-IFX/NATI interaction performed in this study. Model serum containing
different batches of NATI and isotypes could be analyzed through this workflow to establish the
ability of the approach to detect and quantify them and to ensure its suitability for routine use.
An interesting advantage of this approach is its versatility. It could be used to simultaneously

quantify other drugs and anti-drug antibodies (nADA) in serum for other mAb-based treatments.
The only conditions would be to provide the adequate antigen for affinity purification and to
determine the dissociation constant associated with drug/nADA binding. In addition, another mAb
with identical antigen as target should be used to account for losses in sample preparation/analysis.
The strategy was demonstrated here for CE-MS analysis but could undoubtedly be applied to LC-
MS as well. Therefore, this method offers several advantages. It could streamline the analysis
process by reducing the time required for sample preparation compared to quantification methods
that require separate assays. It could also facilitate a deeper understanding of the interplay and
relationship between the mAb and its immune response. The simultaneous quantification method
has the potential to enhance patient monitoring and improve immunogenicity assessment.
- 213 -
Figure 11.S1. Extracted ion electropherograms (EIE) illustrating the three surrogate prototypic peptides of infliximab (IFXLC01,
20µg·mL-1), SIL-IFX (IFX*LC01, 10µg·mL-1) and SIL-ADM (ADM*HC01, 10µg·mL-1) from a CE-MS/MS analysis of model serum spiked.
: MS/MS of ion . 2
8. 1 . 78 . 1 7 1. 8 . 8 7. 1 8. 8 11 . 1 1 1 . 1 . 7 1 1.7 7
17 .11 8
7000 EGP S V S L I A P S Q T
6000
5000
4000
3000
2000
1000
200 400 600 800 1000 1200 1400
: MS/MS of ion 3. 3
8. 71 . 7 . 7 1. 7 8 . 8 7. 1 8. 71 11 . 18 1 . 11 1 .7 1 1.7 77
18 .1 7
EGP S V S L I A P S Q T
1000
500
200 400 600 800 1000 1200 1400
: MS/MS of ion 1 .
7 .
. 1 7. . 8 7 . 1 7 . 8 . 7 7. 8 1 . 1 11 . 1 1 78.7
Q V L G G G S E V L
Figure 11.S2. MS/MS spectra collected after CID fragmentation of infliximab, SIL-IFX and SIL-ADM surrogate peptides in a
same DDA analysis of model serum spiked with the compounds.
- 214 -
11.6. Discussions additionnelles
Ce chapitre a abordé le développement et l’application de la méthode CE-MS/MS pour quantifier

simultanément l'infliximab et le NATI d’une matrice biologique. De plus, comme présenté dans
les parties II et III de ce manuscrit de thèse, les données CE-MS/MS de l’analyse du digest
peptidique permettent également la détermination des proportions de PTM de l’infliximab induites
dans l’organisme du patient. Pour résumer, les informations simultanées obtenues en appliquant la
stratégie CE-MS/MS, selon le protocole illustré dans la Figure 11.6 et détaillé dans la section
"Matériel et Méthodes" de ce chapitre 11, sont les suivantes :
▪ La quantification de NATI sur une gamme de concentration de 1 à 30 µg·mL-1. La

détermination du rapport (r) IFX*LC01/ ADM*HC01 permet de remonter à la concentration (a0) de
NATI. Cette quantification est d’autant plus intéressante qu’elle ne nécessite pas de connaître la
séquence du NATI, ce qui est intéressant au vu de la polyclonalité de ces anticorps immunitaires.
À noter que cette quantification a nécessité au préalable la détermination de la constante de
dissociation apparente entre le paratope d’un NATI et un de l’infliximab. Ce Kd a été déterminé
dans le chapitre 10 pour des conditions natives des anticorps, sans marquage ou fixation sur surface
solide. Il s’agit d’un NATI de type IgG1 qui a été utilisé, puisqu’il s’agit de l’isotype majoritaire
dans le cas de traitements par infliximab. L’approche et le modèle mathématique établis dans le
chapitre 10 reposent sur des hypothèses probabilistes, considérant par exemple que toutes les
interactions infliximab/NATI sont indépendantes. Cette approche préliminaire a mené à la
détermination du Kd de l’interaction infliximab/NATI dans des conditions strictement identiques
à celles appliquées dans le chapitre 11. Cette constante était donc la plus adaptée pour décrire
l’interaction considérée dans le chapitre 11. Ainsi, la quantification de NATI est basée sur
l’incorporation de cette valeur de Kd dans la loi d’action de masse. Dans les perspectives de ces
travaux, il serait judicieux d’appliquer cette méthode quantitative à d’autres lots de NATI, et
potentiellement à des mélanges de différents isotypes (IgG, IgM…) afin d’assurer la pertinence de
l’approche d’un point de vue clinique. Les premiers résultats de l’analyse de patients traités par de
l’infliximab sont néanmoins prometteurs et encourageants.
▪ La quantification d’infliximab sur une gamme de concentration de 0,22 à 25 µg·mL-1.
Cela est réalisé en intégrant les signaux MS des peptides IFXLC01 (infliximab) et IFX*LC01 (SIL-
IFX). La validation de cette quantification est décrite dans le chapitre 8 de ce manuscrit. Si la
méthode détecte simultanément une concentration non négligeable de NATI (> 1 µg·mL-1), alors
la quantification peut être effectuée en utilisant le signal de SIL-ADM, introduit systématiquement
en début de méthode, et en établissant le rapport (y), pour normaliser la concentration d’infliximab.
- 215 -
L'étude présentée dans le chapitre 11 a démontré que la substitution du SIL-IFX par le SIL-ADM
en tant qu'étalon interne permet toujours la quantification de l'infliximab dans le sérum.
▪ La caractérisation de certaines PTM de l’infliximab apparues in vivo lorsque sa
concentration dans le sérum dépasse 3 µg·mL-1. L'intégration du signal d'un peptide présentant une
PTM et du peptide non modifié homologue permet d'établir leur proportion. Comme décrit dans
le chapitre 7, il est possible d'appliquer la stratégie de normalisation à ces proportions pour
déterminer les PTM apparues seulement lors de l’administration de l’infliximab au patient. Cette
normalisation, qui nécessite également le suivi des PTM du SIL-IFX, n'est pas affectée par l'ajout
du SIL-ADM.
Sérum de patient out des SI xtraction des Digestion

1 g m 1. agents anti N
nalyse MS/MS
infliximab
SI infliximab
Temps (min)
Quantification d infliximab Quantification de AT Quantification du de modification

normalisé
Si pas de NATI detectes :
y r
Si NATI detectes :
y Calcul de selon l equation Calcul de PTM normalisee selon l equation

etablie (11.1) : etablie ( .3) :
IFX
lood
Calcul de selon la droite

d etalonnage etablie
Figure 11.6. Représentation schématique du protocole final menant à la multi-caractérisation d’un sérum d’un patient traité
avec de l’infliximab. L’étoile rouge représente une PTM sur un acide aminé de l’infliximab, dont la quantification est souhaitée.
Par conséquent, au moyen d'une seule analyse en CE-MS/MS d'un échantillon de sérum, il est
possible de réaliser les trois quantifications mentionnées précédemment. Il faut également réaliser
les gammes étalons dans la matrice modèle, nécessaires aux quantifications d’infliximab et de
SIL-IFX. Ces gammes d’étalonnages internes doivent présenter des concentrations fixes de SIL-
ADM et croissantes d’infliximab et de SIL-IFX. La normalisation des PTM nécessite également
des échantillons de « références ». Les données CE-MS/MS obtenues suite à l’analyse de la
- 216 -
gamme étalon peuvent être utilisées pour établir les valeurs 𝐿𝐼𝐹𝑋 𝑆𝐼𝐿
𝑟𝑒𝑓 et 𝐿𝑟𝑒𝑓 . Comme exposé dans le
chapitre 11, l'analyse CE-MS/MS des 13 échantillons de sérum de patients a permis la

quantification de l'infliximab et du NATI. À partir de ces mêmes données CE-MS/MS, il a
également été possible de déterminer les PTM survenues sur certains sites pendant l'administration
de l'infliximab. Nous avons récapitulé dans la Table 11.2 les niveaux de deaN et isoD de
l’infliximab issu de ces patients.
La stratégie analytique pourrait donc être utilisée afin de corréler l’apparition de
certaines PTM de l’infliximab dans la circulation sanguine de patients, à la concentration
d’infliximab biodisponible b0, au développement de NATI a0, à la clairance du traitement
thérapeutique dans l’organisme ou encore à la réponse clinique du patient. Plusieurs études ont
déjà démontré que certaines PTM ont un impact direct ou indirect sur l'immunogénicité d'un
traitement à base de mAbs [61,316]. Certaines structures glycaniques ont été identifiées comme
immunogènes, à l'instar du galactose-α1,3-galactose. Une corrélation a été établie entre les patients
présentant des réactions sévères au traitement et la présence d'anticorps dirigés contre cette
structure [317]. Bien que l'impact des autres PTM sur l'immunogénicité soit moins établi que celui
des glycosylations [318], il est néanmoins suggéré qu'un changement local de charge ou
d'hydrophobie induit par certaines PTM, favorise la formation d'agrégats susceptibles de
déclencher des réactions immunitaires [319,320]. Une étude a également corrélé certaines
déamidations, oxydations, et isomérisations avec l’apparition d’anticorps anti-médicament [61,317].
Ces assertions restent encore peu établies et sont probablement spécifiques à certains mAbs
et à certaines PTM. L'analyse des 13 sérums de patients a mené à l’identification de deux sérums
présentant une concentration élevée de NATI, mais plus aucun infliximab actif. Par conséquent, il
n’a pas été possible de déterminer la structure du traitement thérapeutique pour ces échantillons.
On peut envisager que l’infliximab ait subi des modifications dans sa région CDR, altérant ainsi
son interaction avec le TNF-α, et conduisant au développement de NATI ciblant cette partie
spécifique. Cette hypothèse n’est pour le moment pas vérifiée, mais l’application de la stratégie
analytique pourrait contribuer à une meilleure compréhension des processus de réponse
immunitaire et du devenir des anticorps thérapeutiques. Il serait intéressant d'obtenir des
échantillons de sérum de patients avant le déclenchement de la réponse immunitaire afin de
caractériser les PTM de l'infliximab à ce stade précoce.
Sur les PTM hotspots suivies dans le cadre de cette étude, seulement deux se produisent in
vivo, et ce de manière corrélée avec le temps de résidence du traitement. Pour l’instant, rien
n’indique que ces PTM aient un impact sur l’efficacité du traitement (liaison antigène, CDC,
ADCC, recyclage...) ou sur le développement de l’immunogénicité. En conséquence, la méthode
aurait tout intérêt à être appliquée sur une analyse de cohorte plus étendue, afin de réaliser des
affirmations statistiques.
- 217 -
Table 11.2. Concentration de NATI, d’infliximab, et proportions de certaines deaN et isoD de l’infliximab apparues in vivo. Informations obtenues simultanément après une analyse CE-
MS/MS, pour 13 sérums de patients atteints de la maladie de Crohn et traités avec de l’infliximab.
Concentration
Concentration
d’ infliximab
l’ infliximab
résidence de
Niveau de PTM (déamidation ou isomérisation) apparues lors de
(µg·mL-1)
(µg·mL-1)
Temps de
considéré
de NATI
Patient
(jours)
l’administration
N57 N387 N137 N158 N41 N210 N101 N279 N289 N318 D404 D283
(HC07) (HC38) (LC10) (LC13) (LC04) (LC18) (HC13) (HC24) (HC24) (HC27) (HC39) (HC24)
N°1 12.1 0.9 16
N°2 6.2 0.8
N°3 <1 28.5 58 31 2 -3 1 1 8 -3 1 -1 2 -2 2
N°4 <1 10.1 55 31 8 1 0 -1 9 -2 0 0 1 1 6
N°5 <1 12.7 56 40 14 -1 1 2 7 1 -1 1 -1 3 -1
N°6 <1 6.4 55 60 12 0 1 3 0 1 1 1 2 0 1
N°7 <1 34.0 21 18 -2 0 0 -2 -2 0 0 -1 -1 1 1
N°8 <1 7.4 56 25 6 0 1 7 -3 1 0 -1 2 -1 3
N°9 <1 42.0 14 5 2 -1 0 -14 5 1 0 0 2 2 -2
N°10 <1 18.1 28 10 9 1 2 10 0 -2 0 -1 1 0 -3
N°11 <1 31.0 14 7 -5 1 2 -2 6 -1 0 0 0 3 -2
N°12 <1 8.4 56 22 -2 0 1 0 6 0 1 2 0 0 1
N°13 <1 16.7 54 39 7 1 2 1 2 3 1 0 1 2 0
218
Conclusion générale et perspectives
CONCLUSION GÉNÉRALE
ET PERSPECTIVES
- 219 -
L’objectif principal de ces travaux fut de mettre en place une méthode analytique utilisant le
couplage CE-ESI-MS/MS pour l’obtention de multiples informations de sérums issus de patients
traités par de l’infliximab, un mAb thérapeutique.
La première partie de ce manuscrit fut consacrée dans un premier temps à une brève
présentation des anticorps monoclonaux. En particulier, l’infliximab, sa structure et ses
mécanismes d’action ont été décrits. L’impact de certaines PTM sur l’activité biologique de
plusieurs protéines a été discuté, mettant en lumière l’intérêt de leur caractérisation. Puis, une
introduction bibliographique du couplage électrophorèse capillaire-spectrométrie de masse a été
présentée. L’utilisation de ce couplage pour caractériser structurellement les mAbs à travers
diverses applications et stratégies a permis de souligner l’intérêt de la CE comme méthode
séparative. En particulier, la séparation des PTM impliquant un faible incrément de masse permet
leur identification. Enfin, l’intérêt thérapeutique d’un suivi quantitatif des mAbs administrés a été
décrit, ainsi que les méthodes actuelles s’y prêtant. Une introduction à l’immunogénicité et à son
suivi clinique est également décrite dans cette partie introductive.
Cette recherche bibliographique a permis de mettre en évidence trois types d’informations
suggérées comme importantes lors d’un suivi clinique de patient traité avec un mAb thérapeutique.
Les deux premières informations sont les concentrations résiduelles biodisponibles du mAb en
question, ainsi que d’anticorps anti-mAb, après administration. Ces informations quantitatives
sont régulièrement obtenues en clinique, par des immunodosages, et permettent de définir la dose
à administrer pour la fois suivante, ainsi que de décider d’un changement de thérapie. Étant donné
que ces quantités fluctuent entre les patients de manière pour le moment encore trop incomprise,
leur contrôle ne permet que l’ajustement du traitement, et non pas la prédiction ou compréhension
de la réponse clinique. Ainsi, les recherches bibliographiques ont permis d’émettre la suggestion
que la structure primaire de l’anticorps thérapeutique, et plus particulièrement les PTM se
produisant post-administration, peut aider à mieux appréhender ces incertitudes. De plus, des
études ont mis en avant un manque de précision, des effets de matrices et d’interférences sur les
immunodosages couramment utilisés, menant à des erreurs de diagnostic. La multiplication des
protocoles et manipulations nécessaires lors de différentes méthodes analytiques peut également
entraîner des erreurs supplémentaires. Ainsi, cette première partie du manuscrit a permis de
prendre connaissance des défis actuels du suivi de mAbs thérapeutiques, et de proposer une
solution analytique s’affranchissant de certaines problématiques. Les travaux présentés dans ce
manuscrit sont en grande partie concentrés sur le développement de méthode permettant la
caractérisation des PTM conjointement à la quantification de l’infliximab issu de sérum. Puis, le
dernier chapitre présente la montée en complexité avec la quantification simultanée d’anticorps
anti-infliximab.
- 220 -
Le couplage CE-ESI-MS/MS étant bien établi au laboratoire, en particulier pour la

caractérisation structurale des mAbs suivant une stratégie bottom-up, il n’a pas été nécessaire de
procéder aux développements techniques de ce couplage. En revanche, l’application de cette
caractérisation était pour le moment restreinte aux mAbs issus de leur formulation. Ainsi, une
attention particulière à la purification d’infliximab issu de matrice sérique a été nécessaire, tout en
considérant les aspects inhérents au couplage CE-MS/MS menant à la caractérisation des PTM,
conjointement à la quantification de l’infliximab. Il a fallu conserver la spécificité de l’extraction,
limiter les sels résiduels et optimiser les conditions de séparation électrophorétique afin de garantir
une résolution suffisante des PTM tout en maintenant une limite de quantification compétitive
avec ce qui est atteint par les immunodosages. Afin de quantifier de manière absolue l’infliximab
de la matrice sérique, le même anticorps marqué a été choisi comme étalon interne, et fut ajouté
avant la purification. Puis, l’objectif de la méthodologie analytique étant d’être capable de définir
les PTM apparues dans l’organisme du patient, une stratégie de normalisation, s’affranchissant
des modifications apparaissant lors de la préparation d’échantillons, a été établie. Cette stratégie
ne requiert pas de manipulations supplémentaires de l’échantillon en question, et repose sur un
modèle mathématique qui a été établi durant ce projet.
Après avoir mis en place la méthodologie quantitative de la concentration d’infliximab, et
de certaines PTM post-administration, elle a été validée sur des sérums modèles dopés avec de
l’infliximab. Puis, il a été possible de l’appliquer sur des sérums issus de patients atteints de la
maladie de Crohn et traités avec de l’infliximab. Les résultats ont permis d’identifier des
modifications structurales in vivo de l’infliximab, et de les corréler au temps de résidence dans
l’organisme du patient. En outre, ces PTM ont pu être identifiées comme dépendantes de la
localisation du résidu concerné.
Alors, afin de définir dans un premier temps si ces dégradations structurelles étaient
propres à l’anticorps, ou au produit commercial correspondant, une étude de dégradation prédictive
a été réalisée sur le produit original ou des biosimilaires. Dans un premier temps, il a fallu
s’assurer que la dégradation in vitro mimait correctement l’environnement in vivo, et donc
prédisait convenablement les PTM post-administration. Les résultats ont montré que les mêmes
sites d’acides aminés de l’infliximab dégradés dans les sérums de patients l’étaient pour les
différents produits de l’infliximab, et ce linéairement avec le temps. D’autres études préliminaires
ont été réalisées afin d’investiguer les facteurs influençant les PTM post-administration. Toutes
ces expériences ont été réalisées sur la même stratégie analytique CE-MS/MS que celle développée
partie II, et ont montré la capacité de la méthode à prédire des modifications structurales d’un mAb
thérapeutique post-administration.
Enfin, il a été envisagé de modifier la stratégie pour, conjointement aux deux précédentes
informations, quantifier des anticorps immunogènes neutralisant la partie variable de l’infliximab
- 221 -
(NATI). La seule modification apportée fut l’ajout d’un autre anticorps marqué, aussi dirigé contre
le TNF-α, le SIL-adalimumab. Dans un premier temps, ce nouveau standard interne a illustré la
possibilité de changer d’étalon pour la quantification d’infliximab dans un sérum de patient, s’il
s’y trouve des NATI actifs. Simultanément, la stratégie permet de détecter la présence de NATI et
sa quantification indirecte. Les résultats préliminaires présentés dans cette dernière partie ont
montré le potentiel de la méthode à quantifier le NATI dans la matrice sérique, conjointement
aux deux autres informations.
Plusieurs perspectives pourraient donc être pertinentes pour la suite du projet. Dans un premier
temps, il serait intéressant de valider la méthode présentée dans le dernier chapitre, tant sur la
quantification d’infliximab, mais aussi de NATI. En particulier, la quantification de NATI repose
sur des modèles qui ont cherché à restreindre les biais et hypothèses de la méthodologie, et qui
nécessiteraient d’être appliqués à d’avantages de standards afin de garantir la fiabilité des résultats,
pour le moment prometteurs. L’analyse de sérums de 13 patients traités par de l’infliximab a
permis des conclusions encourageantes et bénéficierait d’être appliquée à un plus grand nombre
d’échantillons.
Aussi, il est envisageable de ne plus se restreindre à la caractérisation des PTM hotspots,
mais d’établir une plus large caractérisation non ciblée de modifications post-administration.
D’autres PTM pourraient être cherchées et quantifiées. Il semblerait également pertinent
d’appliquer la méthode sur une cohorte de patients plus large que celle réalisée lors de ce projet.
L’analyse d’une cohorte conséquente permettrait potentiellement de conclure sur les effets des
PTM post-administration sur l’évolution des concentrations de NATI et d’infliximab. Ce suivi
pourrait également indiquer s’il existe une corrélation entre l’apparition de PTM et la réponse
clinique du patient.
Il semble enfin pertinent de souligner la versatilité de la méthodologie analytique
développée ici. En effet, en ne modifiant aucune procédure de la préparation d’échantillon, la
méthode est adaptée à l’extraction et à l’analyse d’autres anticorps anti-TNF-α. Des essais
préliminaires d’un stage de master M2 ont montré la possibilité d’extraire de l’adalimumab, un
autre anticorps anti-TNF-α utilisé contre la maladie de Crohn, et ce en utilisant le même protocole.
En particulier, cela semble intéressant dans le cas de bithérapies, ou lors d’un changement de
traitement thérapeutique vers l’adalimumab lorsqu’un patient développe une immunogénicité face
à l’infliximab. Il peut être intéressant de suivre la concentration simultanée de ces deux mAbs
thérapeutiques dans ce cas. Ainsi, la méthode CE-MS/MS permettrait en théorie d’atteindre cet
objectif.
- 222 -
Par ailleurs, en changeant le TNF-α fonctionnalisé sur les billes ferromagnétiques par
d’autres antigènes, il semble possible d’extraire et de purifier du sérum d’autres mAbs
thérapeutiques. Il pourrait être envisagé de greffer sur les billes de purification différents antigènes
menant alors à l’extraction simultanée de plusieurs mAbs thérapeutiques. Les premiers résultats
d’un autre stage de M2 sur ces aspects semblent indiquer cette possibilité.
En conclusion, la stratégie CE-MS/MS offre trois caractéristiques clés pour le suivi clinique des
patients sous traitement d'anticorps monoclonaux, en une seule analyse d’un échantillon sérique
(sous couvert d’avoir établi également une gamme étalon). Actuellement, le suivi clinique de ces
individus s’effectue par deux types d’immunodosages (un pour la quantification du mAb et un
pour l’immunogénicité). D’un point de vue économique et de mise en place, considérant seulement
ces informations quantitatives, il apparaît pour le moment compliqué d’instaurer la procédure en
routine à l’hôpital, bien que certains hôpitaux aient fait l’acquisition de spectromètres de masse.
En particulier, la séparation par électrophorèse capillaire, bien que permettant un bon
recouvrement de séquence avec la séparation simultanée de glycans, d’isoD, de deaN et d’autres
peptides, reste une stratégie séparative moins robuste que la chromatographie liquide quand elle
est couplée à la MS. Cependant, il ne faudrait pas sous-estimer l'intérêt d'obtenir simultanément
ces informations quantitatives et structurales pour garantir la fiabilité des conclusions biologiques.
Par conséquent, dans un premier temps, il serait judicieux d'appliquer cette approche à des études
de cohortes de patients. Cette démarche permettrait de déterminer si le suivi des PTM de
l'infliximab est pertinent ou non lors d’une prise en charge clinique.
- 223 -
Références bibliographiques
RÉFÉRENCES BIBLIOGRAPHIQUES
[1] Fanning, L.J., Connor, A.M. and Wu, G.E. 1996, Development of the Immunoglobulin Repertoire, Clinical
Immunology and Immunopathology, 1 (79), 1–14.
[2] Köhler, G. and Milstein, C. 1975, Continuous cultures of fused cells secreting antibody of predefined specificity,
Nature, 5517 (256), 495–497.
[3] Mitoma, H., Horiuchi, T., Tsukamoto, H. and Ueda, N. 2018, Molecular mechanisms of action of anti-TNF-α agents
– Comparison among therapeutic TNF-α antagonists, Cytokine, (101), 56–63.
[4] Buss, N.A., Henderson, S.J., McFarlane, M., Shenton, J.M. and de Haan, L. 2012, Monoclonal antibody
therapeutics: history and future, Current Opinion in Pharmacology, 5 (12), 615–622.
[5] Weiner, G.J. 2015, Building better monoclonal antibody-based therapeutics, Nature Reviews Cancer, 6 (15), 361–370.
[6] Horiuchi, T., Mitoma, H., Harashima, S. -i., Tsukamoto, H. and Shimoda, T. 2010, Transmembrane TNF- :
structure, function and interaction with anti-TNF agents, Rheumatology, 7 (49), 1215–1228.
[7] Doorduijn, D.J., Heesterbeek, D.A.C., Ruyken, M., de Haas, C.J.C., Stapels, D.A.C., Aerts, P.C., Rooijakkers,
S.H.M. and Bardoel, B.W. 2021, Polymerization of C9 enhances bacterial cell envelope damage and killing by
membrane attack complex pores. PLoS Pathog, 18 (8), 1010758
[8] Grevys, A. et al. 2018, A human endothelial cell-based recycling assay for screening of FcRn targeted molecules,
Nature Communications, 1 (9), 621.
[9] Suzuki, T., Ishii-Watabe, A., Tada, M., Kobayashi, T., Kanayasu-Toyoda, T., Kawanishi, T. and Yamaguchi, T.
2010, Importance of Neonatal FcR in Regulating the Serum Half-Life of Therapeutic Proteins Containing the Fc
Domain of Human IgG1: A Comparative Study of the Affinity of Monoclonal Antibodies and Fc-Fusion Proteins
to Human Neonatal FcR, The Journal of Immunology, 4 (184), 1968–1976.
[10] Roopenian, D.C. and Akilesh, S. 2007, FcRn: the neonatal Fc receptor comes of age, Nature Reviews Immunology,
9 (7), 715–725.
[11] Toh, W.H., Louber, J., Mahmoud, I.S., Chia, J., Bass, G.T., Dower, S.K., Verhagen, A.M. and Gleeson, P.A.
2019, FcRn mediates fast recycling of endocytosed albumin and IgG from early macropinosomes in primary
macrophages, Journal of Cell Science, jcs.235416.
[12] Beyer, B., Schuster, M., Jungbauer, A. and Lingg, N. 2018, Microheterogeneity of Recombinant Antibodies:
Analytics and Functional Impact, Biotechnology Journal, 1 (13), 1700476.
[13] Lyubarskaya, Y., Houde, D., Woodard, J., Murphy, D. and Mhatre, R. 2006, Analysis of recombinant monoclonal
antibody isoforms by electrospray ionization mass spectrometry as a strategy for streamlining characterization of
recombinant monoclonal antibody charge heterogeneity, Analytical Biochemistry, 1 (348), 24–39.
[14] Zheng, J.Y. and Janis, L.J. 2006, Influence of pH, buffer species, and storage temperature on physicochemical
stability of a humanized monoclonal antibody LA298, International Journal of Pharmaceutics, 1–2 (308), 46–51.
[15] Tran, J.C. et al. 2016, Automated Affinity Capture and On-Tip Digestion to Accurately Quantitate in Vivo
Deamidation of Therapeutic Antibodies, Analytical Chemistry, 23 (88), 11521–11526.
[16] Huang, L., Lu, J., Wroblewski, V.J., Beals, J.M. and Riggin, R.M. 2005, In Vivo Deamidation Characterization
of Monoclonal Antibody by LC/MS/MS, Analytical Chemistry, 5 (77), 1432–1439.
[17] Schmid, I. et al. 2018, Assessment of susceptible chemical modification sites of trastuzumab and endogenous
human immunoglobulins at physiological conditions, Communications Biology, 1 (1), 28.
[18] Vlasak, J. et al. 2009, Identification and characterization of asparagine deamidation in the light chain CDR1 of a
humanized IgG1 antibody, Analytical Biochemistry, 2 (392), 145–154.
[19] Hintersteiner, B., Lingg, N., Janzek, E., Mutschlechner, O., Loibner, H. and Jungbauer, A. 2016,
Microheterogeneity of therapeutic monoclonal antibodies is governed by changes in the surface charge of the
protein, Biotechnology Journal, 12 (11), 1617–1627.
- 224 -
[20] Wakankar, A.A., Liu, J. u. n., VanderVelde, D., Wang, Y.J., Shire, S.J. and Borchardt, R.T. 2007, The effect of
cosolutes on the isomerization of aspartic acid residues and conformational stability in a monoclonal antibody,
Journal of Pharmaceutical Sciences, 7 (96), 1708–1718.
[21] Gahoual, R., Beck, A., François, Y.-N. and Leize-Wagner, E. 2016, Independent highly sensitive characterization
of asparagine deamidation and aspartic acid isomerization by sheathless CZE-ESI-MS/MS: Characterization of
Asn and Asp PTMs by CZE-ESI-MS, Journal of Mass Spectrometry, 2 (51), 150–158.
[22] Eakin, C.M., Miller, A., Kerr, J., Kung, J. and Wallace, A. 2014, Assessing analytical methods to monitor isoAsp
formation in monoclonal antibodies, Frontiers in Pharmacology, (5).
[23] Wakankar, A.A., Borchardt, R.T., Eigenbrot, C., Shia, S., Wang, Y.J., Shire, S.J. and Liu, J.L. 2007, Aspartate
Isomerization in the Complementarity-Determining Regions of Two Closely Related Monoclonal Antibodies,
Biochemistry, 6 (46), 1534–1544.
[24] Hinterholzer, A., Stanojlovic, V., Regl, C., Huber, C.G., Cabrele, C. and Schubert, M. 2021, Detecting aspartate
isomerization and backbone cleavage after aspartate in intact proteins by NMR spectroscopy, Journal of
Biomolecular NMR, 1 (75), 71–82.
[25] Kim, Y.H., Berry, A.H., Spencer, D.S. and Stites, W.E. 2001, Comparing the effect on protein stability of
methionine oxidation versus mutagenesis: steps toward engineering oxidative resistance in proteins, Protein
Engineering, Design and Selection, 5 (14), 343–347.
[26] Bertolotti-Ciarlet, A. et al. 2009, Impact of methionine oxidation on the binding of human IgG1 to FcRn and Fcγ
receptors, Molecular Immunology, 8–9 (46), 1878–1882.
[27] Wang, W. et al. 2011, Impact of methionine oxidation in human IgG1 Fc on serum half-life of monoclonal
antibodies, Molecular Immunology, 6–7 (48), 860–866.
[28] Mo, J., Yan, Q., So, C.K., Soden, T., Lewis, M.J. and Hu, P. 2016, Understanding the Impact of Methionine
Oxidation on the Biological Functions of IgG1 Antibodies Using Hydrogen/Deuterium Exchange Mass
Spectrometry, Analytical Chemistry, 19 (88), 9495–9502.
[29] Stracke, J. et al. 2014, A novel approach to investigate the effect of methionine oxidation on pharmacokinetic
properties of therapeutic antibodies, mAbs, 5 (6), 1229–1242.
[30] Liu, L. 2015, Antibody Glycosylation and Its Impact on the Pharmacokinetics and Pharmacodynamics of
Monoclonal Antibodies and Fc-Fusion Proteins, Journal of Pharmaceutical Sciences, 6 (104), 1866–1884.
[31] Aebi, M. 2013, N-linked protein glycosylation in the ER, Biochimica et Biophysica Acta (BBA) - Molecular Cell
Research, 11 (1833), 2430–2437.
[32] Bieberich, E. 2014, Synthesis, Processing, and Function of N-glycans in N-glycoproteins, in R.K. Yu and C.-L.
Schengrund (eds) Glycobiology of the Nervous System. New York, NY: Springer New York (Advances in
Neurobiology), 47–70.
[33] Fisher, P., Thomas-Oates, J., Wood, A.J. and Ungar, D. 2019, The N-Glycosylation Processing Potential of the
Mammalian Golgi Apparatus, Frontiers in Cell and Developmental Biology, (7), 157.
[34] Hanson, Q.M. and Barb, A.W. 2015, A Perspective on the Structure and Receptor Binding Properties of
Immunoglobulin G Fc, Biochemistry, 19 (54), 2931–2942.
[35] Lund, J., Toshiyuki, T., Noriko, T., Sarmay, G., Yoji, A. and Jefferis, R. 1990, A protein structural change in
aglycosylated IgG3 correlates with loss of huFcγR1 and hufcγR111 binding and/or activation, Molecular
Immunology, 11 (27), 1145–1153.
[36] Walker, M.R., Lund, J., Thompson, K.M. and Jefferis, R. 1989, Aglycosylation of human IgG1 and IgG3
monoclonal antibodies can eliminate recognition by human cells expressing FcγRI and/or FcγRII receptors,
Biochemical Journal, 2 (259), 347–353.
[37] Ferrara, C. et al. 2011, Unique carbohydrate-carbohydrate interactions are required for high affinity binding
between Fc RIII and antibodies lacking core fucose, Proceedings of the National Academy of Sciences, 31 (108),
12669–12674.
[38] Aufses, A.H. 2001, The history of Crohn’s disease, Crohns Disease, 1 (81).
- 225 -
[39] Torres, J., Mehandru, S., Colombel, J.-F. and Peyrin-Biroulet, L. 2017, Crohn’s disease, The Lancet, 10080 (389),
1741–1755.
[40] Feldmann, M. and Steinman, L. 2005, Design of effective immunotherapy for human autoimmunity, Nature, 7042
(435), 612–619.
[41] Tracey, D., Klareskog, L., Sasso, E.H., Salfeld, J.G. and Tak, P.P. 2008, Tumor necrosis factor antagonist
mechanisms of action: A comprehensive review, Pharmacology & Therapeutics, 2 (117), 244–279.
[42] Kindler, V., Sappino, A.-P., Grau, G.E., Piguet, P.-F. and Vassalli, P. 1989, The inducing role of tumor necrosis
factor in the development of bactericidal granulomas during BCG infection, Cell, 5 (56), 731–740.
[43] Carlos, T.M. and Harlan, J.M. 1994, Leukocyte-endothelial adhesion molecules, Blood, 7 (84), 2068–2101.
[44] Kuijpers, T.W., Hakkert, B.C., Hart, M.H. and Roos, D. 1992, Neutrophil migration across monolayers of
cytokine-prestimulated endothelial cells: a role for platelet-activating factor and IL-8., The Journal of Cell
Biology, 3 (117), 565–572.
[45] Afa Crohn-RCH-France 2020, Quelle est la fréquence de la maladie de Crohn ? Available at: https://www.afa.asso.fr/maladie-
inflammatoire-chronique-de-linstestin/comprendre-la-maladie/maladie-de-crohn/frequence-maladie-
crohn/#:~:text=En%20France%2C%20la%20fr%C3%A9quence%20de,affecte%20%C3%A9galement%20les%202%20sexes.
[46] Brennan, F. 1989, Inhibitory effect of tnf-alpha; antibodies on synovial cell interleukin-1 production in rheumatoid
arthritis, The Lancet, 8657 (334), 244–247.
[47] Elliott, M.J. et al. 1993, Treatment of rheumatoid arthritis with chimeric monoclonal antibodies to tumor necrosis
factor α, Arthritis & Rheumatism, 12 (36), 1681–1690.
[48] Kaymakcalan, Z., Sakorafas, P., Bose, S., Scesney, S., Xiong, L., Hanzatian, D.K., Salfeld, J. and Sasso, E.H.
2009, Comparisons of affinities, avidities, and complement activation of adalimumab, infliximab, and etanercept
in binding to soluble and membrane tumor necrosis factor, Clinical Immunology, 2 (131), 308–316.
[49] Caspersen, S. et al. 2008, Infliximab for Inflammatory Bowel Disease in Denmark 1999–2005: Clinical Outcome and
Follow-Up Evaluation of Malignancy and Mortality, Clinical Gastroenterology and Hepatology, 11 (6), 1212–1217.
[50] Barthel, H.R., Gille, T., Halbsguth, A. and Kramer, M. 2005, Successful treatment with adalimumab in infliximab-
resistant crohn’s disease, Journal of Gastroenterology and Hepatology, 9 (20), 1464–1465.
[51] van Vollenhoven, R. 2003, Treatment with infliximab (Remicade) when etanercept (Enbrel) has failed or vice
versa: data from the STURE registry showing that switching tumour necrosis factor blockers can make sense,
Annals of the Rheumatic Diseases, 12 (62), 1195–1198.
[52] Knight, D.M. et al. 1993, Construction and initial characterization of a mouse-human chimeric anti-TNF antibody,
Molecular Immunology, 16 (30), 1443–1453.
[53] Eur Med Agency EMA 2009, Remicade EPAR - Product information. Available at:
https://www.ema.europa.eu/en/medicines/human/EPAR/remicade (Accessed: 21 July 2023).
[54] Legrand, P. 2022, Développement analytique combiné à l’approche prédictive S pour l’étude de la stabilité
de produits pharmaceutiques chimiques et biologiques. Thèse de Chimie. Université Paris-Cité.
[55] Scallon, B., Cai, A., Solowski, N., Rosenberg, A., Song, X.-Y., Shealy, D. and Wagner, C. 2002, Binding and
Functional Comparisons of Two Types of Tumor Necrosis Factor Antagonists, Journal of Pharmacology and
Experimental Therapeutics, 2 (301), 418–426.
[56] Eissner, G., Kolch, W. and Scheurich, P. 2004, Ligands working as receptors: reverse signaling by members of the TNF
superfamily enhance the plasticity of the immune system, Cytokine & Growth Factor Reviews, 5 (15), 353–366.
[57] Berns, M. and Hommes, D.W. 2016, Anti-TNF-α therapies for the treatment of Crohn’s disease: the past, present
and future, Expert Opinion on Investigational Drugs, 2 (25), 129–143.
[58] Harashima, S. et al. 2001, Outside-to-Inside Signal Through the Membrane TNF-α Induces E-Selectin (CD62E)
Expression on Activated Human CD4 + T Cells, The Journal of Immunology, 1 (166), 130–136.
[59] Bendtzen, K. 2015, Immunogenicity of Anti-TNF-α Biotherapies: II. Clinical Relevance of Methods Used for
Anti-Drug Antibody Detection, Frontiers in Immunology, (6).
[60] Strand, V. et al. 2017, Immunogenicity of Biologics in Chronic Inflammatory Diseases: A Systematic Review,
BioDrugs, 4 (31), 299–316.
- 226 -
[61] Kuriakose, A., Chirmule, N. and Nair, P. 2016, Immunogenicity of Biotherapeutics: Causes and Association with
Posttranslational Modifications, Journal of Immunology Research, (2016), 1–18.
[62] Soga, T. and Heiger, D.N. 2000, Amino Acid Analysis by Capillary Electrophoresis Electrospray Ionization Mass
Spectrometry, Analytical Chemistry, 6 (72), 1236–1241.
[63] Whitmore, C.D. and Gennaro, L.A. 2012, Capillary electrophoresis-mass spectrometry methods for tryptic peptide
mapping of therapeutic antibodies: CE and CEC, Electrophoresis, 11 (33), 1550–1556.
[64] Le-Minh, V., Tran, N.T., Makky, A., Rosilio, V., Taverna, M. and Smadja, C. 2019, Capillary zone
electrophoresis-native mass spectrometry for the quality control of intact therapeutic monoclonal antibodies,
Journal of Chromatography A, (1601), 375–384.
[65] Pacáková, V. and Štulı́k, K. 1997, Capillary electrophoresis of inorganic anions and its comparison with ion
chromatography, Journal of Chromatography A, 1–2 (789), 169–180.
[66] Timerbaev, A.R. 2004, Capillary electrophoresis of inorganic ions: An update, Electrophoresis, 23–24 (25), 4008–4031.
[67] Lu, T., Klein, L.J., Ha, S. and Rustandi, R.R. 2020, High-Resolution capillary electrophoresis separation of large
RNA under non-aqueous conditions, Journal of Chromatography A, (1618), 460875.
[68] Beckers, J.J. 1973, Isotachophoresis : some fundamental aspects, Thèse, Technische Hogeschool Eindhoven.
[69] Larsson, M. and Lutz, E.S. 2000, Transient isotachophoresis for sensitivity enhancement in capillary
electrophoresis-mass spectrometry for peptide analysis, Electrophoresis, 14 (21), 2859–2865.
[70] Stock, L.G., Wildner, S., Regl, C., Gadermaier, G., Huber, C.G. and Stutz, H. 2018, Monitoring of Deamidation and
Lanthionine Formation in Recombinant Mugwort Allergen by Capillary Zone Electrophoresis (CZE)-UV and Transient
Capillary Isotachophoresis-CZE-Electrospray Ionization-TOF-MS, Analytical Chemistry, 20 (90), 11933–11940.
[71] Thompson, T.J., Foret, Frantisek., Vouros, Paul. and Karger, B.L. 1993, Capillary electrophoresis/electrospray
ionization mass spectrometry: improvement of protein detection limits using on-column transient isotachophoretic
sample preconcentration, Analytical Chemistry, 7 (65), 900–906.
[72] Abdul Keyon, A.S., Guijt, R.M., Bolch, C.J.S. and Breadmore, M.C. 2014, Transient isotachophoresis-capillary
zone electrophoresis with contactless conductivity and ultraviolet detection for the analysis of paralytic shellfish
toxins in mussel samples, Journal of Chromatography A, (1364), 295–302.
[73] Hjertén, S. 1967, Free zone electrophoresis, Chromatographic Reviews, 2 (9), 122–219.
[74] Domon, B. 2006, Mass Spectrometry and Protein Analysis, Science, 5771 (312), 212–217.
[75] Perreault, H. and Lattová, E. 2011, Mass Spectrometry, in Comprehensive Biotechnology. Elsevier, 669–677.
[76] Bonvin, G., Schappler, J. and Rudaz, S. 2012, Capillary electrophoresis–electrospray ionization-mass spectrometry
interfaces: Fundamental concepts and technical developments, Journal of Chromatography A, (1267), 17–31.
[77] Staub, A., Giraud, S., Saugy, M., Rudaz, S., Veuthey, J.-L. and Schappler, J. 2010, CE-ESI-TOF/MS for human
growth hormone analysis, Electrophoresis, 2 (31), 388–395.
[78] Vuorensola, K., Kokkonen, J., Sirén, H. and Ketola, R.A. 2001, Optimization of capillary electrophoretic-
electrospray ionization-mass spectrometric analysis of catecholamines, Electrophoresis, 20 (22), 4347–4354.
[79] Lee, E.D., Mück, W., Henion, J.D. and Covey, T.R. 1989, Liquid junction coupling for capillary zone
electrophoresis/ion spray mass spectrometry, Biological Mass Spectrometry, 9 (18), 844–850.
[80] Maxwell, E.J. and Chen, D.D.Y. 2008, Twenty years of interface development for capillary electrophoresis–
electrospray ionization–mass spectrometry, Analytica Chimica Acta, 1 (627), 25–33.
[81] Ramautar, R., Heemskerk, A.A.M., Hensbergen, P.J., Deelder, A.M., Busnel, J.-M. and Mayboroda, O.A. 2012, CE–MS
for proteomics: Advances in interface development and application, Journal of Proteomics, 13 (75), 3814–3828.
[82] Bonvin, G., Veuthey, J.-L., Rudaz, S. and Schappler, J. 2012, Evaluation of a sheathless nanospray interface based
on a porous tip sprayer for CE-ESI-MS coupling, Electrophoresis, 4 (33), 552–562.
[83] Höcker, O., Montealegre, C. and Neusüß, C. 2018, Characterization of a nanoflow sheath liquid interface and
comparison to a sheath liquid and a sheathless porous-tip interface for CE-ESI-MS in positive and negative
ionization, Analytical and Bioanalytical Chemistry, 21 (410), 5265–5275.
- 227 -
[84] Gahoual, R., Leize‐Wagner, E., Houzé, P. and François, Y. 2019, Revealing the potential of capillary electrophoresis/mass
spectrometry: the tipping point, Rapid Communications in Mass Spectrometry, S1 (33), 11–19.
[85] Tie, C., Zhang, D.-W., Chen, H.-X., Song, S.-L. and Zhang, X.-X. 2012, Study of the electrical connection
mechanism of sheathless interface for capillary electrophoresis-electrospray ionization-mass spectrometry:
Electro-connection of shealthless CE/MS interface, Journal of Mass Spectrometry, 11 (47), 1429–1434.
[86] Wilm, M. and Mann, M. 1996, Analytical Properties of the Nanoelectrospray Ion Source, Analytical Chemistry, 1 (68), 1–8.
[87] King, R., Bonfiglio, R., Fernandez-Metzler, C., Miller-Stein, C. and Olah, T. 2000, Mechanistic investigation of ionization
suppression in electrospray ionization, Journal of the American Society for Mass Spectrometry, 11 (11), 942–950.
[88] Karas, M., Bahr, U. and Dülcks, T. 2000, Nano-electrospray ionization mass spectrometry: addressing analytical
problems beyond routine, resenius’ Journal of nalytical hemistry, 6–7 (366), 669–676.
[89] Smith, R.W. 2013, Mass Spectrometry, in Encyclopedia of Forensic Sciences. Elsevier, 603–608.
[90] Fenn, J.B., Mann, M., Meng, C.K., Wong, S.F. and Whitehouse, C.M. 1989, Electrospray Ionization for Mass
Spectrometry of Large Biomolecules, Science, 4926 (246), 64–71.
[91] Mellon, F.A. 2003, Mass Spectrometry | Principles and Instrumentation, in Encyclopedia of Food Sciences and
Nutrition. Elsevier, 3739–3749.
[92] Thomas, S.N. 2019, Mass spectrometry, in Contemporary Practice in Clinical Chemistry. Elsevier, 171–185.
[93] Paizs, B. and Suhai, S. 2005, Fragmentation pathways of protonated peptides, Mass Spectrometry Reviews, 4 (24), 508–548.
[94] Boesl, U. 2017, Time-of-flight mass spectrometry: Introduction to the basics: Time-Of-Flight Mass Spectrometry,
Mass Spectrometry Reviews, 1 (36), 86–109.
[95] Wagner, E. 2004, Nouvelles approches de la spectrométrie de masse en tandem pour la caractérisation de
biomolécules : pplications à la protéomique. Thèse de Chimie. Université de Strasbourg
[96] Gomes, F.P. and Yates, J.R. 2019, Recent trends of capillary electrophoresis‐mass spectrometry in proteomics
research, Mass Spectrometry Reviews, 6 (38), 445–460.
[97] Kaplon, H. and Reichert, J.M. 2021, Antibodies to watch in 2021, mAbs, 1 (13), 1860476.
[98] Weinreich, D.M. et al. 2021, REGN-COV2, a Neutralizing Antibody Cocktail, in Outpatients with Covid-19, New
England Journal of Medicine, 3 (384), 238–251.
[99] Beck, A., Wurch, T., Bailly, C. and Corvaia, N. 2010, Strategies and challenges for the next generation of
therapeutic antibodies, Nature Reviews Immunology, 5 (10), 345–352.
[100] Xu, Y. et al. 2019, Structure, heterogeneity and developability assessment of therapeutic antibodies, mAbs, 2 (11), 239–264.
[101] van Erp, E.A., Luytjes, W., Ferwerda, G. and van Kasteren, P.B. 2019, Fc-Mediated Antibody Effector Functions
During Respiratory Syncytial Virus Infection and Disease, Frontiers in Immunology, (10), 548.
[102] Janin-Bussat, M.-C., Tonini, L., Huillet, C., Colas, O., Klinguer-Hamour, C., Corvaïa, N. and Beck, A. 2013,
Cetuximab Fab and Fc N-Glycan Fast Characterization Using IdeS Digestion and Liquid Chromatography
Coupled to Electrospray Ionization Mass Spectrometry, in A. Beck (ed.) Glycosylation Engineering of
Biopharmaceuticals. Totowa, NJ: Humana Press (Methods in Molecular Biology), 93–113.
[103] Stavenhagen, K., Gahoual, R., Dominguez Vega, E., Palmese, A., Ederveen, A.L.H., Cutillo, F., Palinsky, W., Bierau, H.
and Wuhrer, M. 2019, Site-specific N- and O-glycosylation analysis of atacicept, mAbs, 6 (11), 1053–1063.
[104] Liu, H., Gaza-Bulseco, G., Faldu, D., Chumsae, C. and Sun, J. 2008, Heterogeneity of Monoclonal Antibodies,
Journal of Pharmaceutical Sciences, 7 (97), 2426–2447.
[105] Fekete, S., Guillarme, D., Sandra, P. and Sandra, K. 2016, Chromatographic, Electrophoretic, and Mass Spectrometric
Methods for the Analytical Characterization of Protein Biopharmaceuticals, Analytical Chemistry, 1 (88), 480–507.
[106] Beck, A. et al. 2019, Cutting-edge multi-level analytical and structural characterization of antibody-drug
conjugates: present and future, Expert Review of Proteomics, 4 (16), 337–362.
[107] Zhang, H., Cui, W. and Gross, M.L. 2014, Mass spectrometry for the biophysical characterization of therapeutic
monoclonal antibodies, FEBS Letters, 2 (588), 308–317.
- 228 -
[108] Gahoual, R., Busnel, J.-M., Wolff, P., François, Y.N. and Leize-Wagner, E. 2014, Novel sheathless CE-MS
interface as an original and powerful infusion platform for nanoESI study: from intact proteins to high molecular
mass noncovalent complexes, Analytical and Bioanalytical Chemistry, 4 (406), 1029–1038.
[109] Lechner, A., Giorgetti, J., Gahoual, R., Beck, A., Leize-Wagner, E. and François, Y.-N. 2019, Insights from
capillary electrophoresis approaches for characterization of monoclonal antibodies and antibody drug conjugates
in the period 2016–2018, Journal of Chromatography B, (1122–1123), 1–17.
[110] Gahoual, R., Beck, A., Leize-Wagner, E. and François, Y.-N. 2016, Cutting-edge capillary electrophoresis
characterization of monoclonal antibodies and related products, Journal of Chromatography B, (1032), 61–78.
[111] Dadouch, M., Ladner, Y. and Perrin, C. 2021, Analysis of Monoclonal Antibodies by Capillary Electrophoresis:
Sample Preparation, Separation, and Detection, Separations, 1 (8), 4.
[112] Aebersold, R. and Mann, M. 2003, Mass spectrometry-based proteomics, Nature, 6928 (422), 198–207.
[113] Scriba, G.K.E. and Psurek, A. 2009, Separation of Peptides by Capillary Electrophoresis, in Schmitt-Kopplin P
(ed.) Capillary Electrophoresis. Methods In Molecular Biology TM. Humana Press, 24.
[114] Thiede, B., Höhenwarter, W., Krah, A., Mattow, J., Schmid, M., Schmidt, F. and Jungblut, P.R. 2005, Peptide
mass fingerprinting, Methods, 3 (35), 237–247.
[115] Walsh, C.T., Garneau-Tsodikova, S. and Gatto, G.J. 2005, Protein Posttranslational Modifications : The
Chemistry of Proteome Diversifications, Angewandte Chemie International Edition, 45 (44), 7342–7372.
[116] Witze, E.S., Old, W.M., Resing, K.A. and Ahn, N.G. 2007, Mapping protein post-translational modifications
with mass spectrometry, Nature Methods, 10 (4), 798–806.
[117] Olsen, J.V. and Mann, M. 2013, Status of Large-scale Analysis of Post-translational Modifications by Mass
Spectrometry, Molecular & Cellular Proteomics, 12 (12), 3444–3452.
[118] Zhao, J., Peng, W., Dong, X. and Mechref, Y. 2021, Analysis of NIST Monoclonal Antibody Reference Material
Glycosylation Using the LC–MS/MS-Based Glycoproteomic Approach, Journal of Proteome Research, 1 (20), 818–830.
[119] Bobaly, B., D’Atri, V., Goyon, A., Colas, O., Beck, A., Fekete, S. and Guillarme, D. 2017, Protocols for the
analytical characterization of therapeutic monoclonal antibodies. II – Enzymatic and chemical sample preparation,
Journal of Chromatography B, (1060), 325–335.
[120] León, I.R., Schwämmle, V., Jensen, O.N. and Sprenger, R.R. 2013, Quantitative Assessment of In-solution
Digestion Efficiency Identifies Optimal Protocols for Unbiased Protein Analysis, Molecular & Cellular
Proteomics, 10 (12), 2992–3005.
[121] Yu, Y.-Q., Gilar, M., Lee, P.J., Bouvier, E.S.P. and Gebler, J.C. 2003, Enzyme-Friendly, Mass Spectrometry-
Compatible Surfactant for In-Solution Enzymatic Digestion of Proteins, Analytical Chemistry, 21 (75), 6023–6028.
[122] Formolo, T. et al. 2015, Determination of the NISTmAb Primary Structure, in J.E. Schiel, D.L. Davis, and O.V.
Borisov (eds) ACS Symposium Series. Washington, DC: American Chemical Society, 1–62.
[123] Giansanti, P., Tsiatsiani, L., Low, T.Y. and Heck, A.J.R. 2016, Six alternative proteases for mass spectrometry–
based proteomics beyond trypsin, Nature Protocols, 5 (11), 993–1006.
[124] Switzar, L., Giera, M. and Niessen, W.M.A. 2013, Protein Digestion: An Overview of the Available Techniques
and Recent Developments, Journal of Proteome Research, 3 (12), 1067–1077.
[125] Krokhin, O.V., Antonovici, M., Ens, W., Wilkins, J.A. and Standing, K.G. 2006, Deamidation of -Asn-Gly-
Sequences during Sample Preparation for Proteomics: Consequences for MALDI and HPLC-MALDI Analysis,
Analytical Chemistry, 18 (78), 6645–6650.
[126] Kori, Y., Patel, R., Neill, A. and Liu, H. 2016, A conventional procedure to reduce Asn deamidation artifacts
during trypsin peptide mapping, Journal of Chromatography B, (1009–1010), 107–113.
[127] Li, X., Cournoyer, J.J., Lin, C. and O’Connor, P.B. 2008, Use of 18O Labels to Monitor Deamidation during
Protein and Peptide Sample Processing, Journal of the American Society for Mass Spectrometry, 6 (19), 855–864.
[128] Gaza-Bulseco, G., Li, B., Bulseco, A. and Liu, H. 2008, Method to Differentiate Asn Deamidation That Occurred
Prior to and during Sample Preparation of a Monoclonal Antibody, Analytical Chemistry, 24 (80), 9491–9498.
- 229 -
[129] Cao, M. 2019, An Automated and Qualified Platform Method for Site-Specific Succinimide and Deamidation
Quantitation Using Low-pH Peptide Mapping, Journal of Pharmaceutical Sciences, 10.
[130] Jiang, P., Li, F. and Ding, J. 2020, Development of an efficient LC-MS peptide mapping method using
accelerated sample preparation for monoclonal antibodies, Journal of Chromatography B, (1137), 121895.
[131] Yin, Z., Zhao, W., Tian, M., Zhang, Q., Guo, L. and Yang, L. 2014, A capillary electrophoresis-based
immobilized enzyme reactor using graphene oxide as a support via layer by layer electrostatic assembly, The
Analyst, 8 (139), 1973–1979.
[132] Zhang, L., Luo, S. and Zhang, B. 2016, Glycan analysis of therapeutic glycoproteins, mAbs, 2 (8), 205–215.
[133] Zaia, J. 2013, Capillary Electrophoresis–Mass Spectrometry of Carbohydrates, in N. Volpi and F. Maccari (eds)
Capillary Electrophoresis of Biomolecules. Totowa, NJ: Humana Press (Methods in Molecular Biology), 13–25.
[134] Bunz, S.-C., Rapp, E. and Neusüss, C. 2013, Capillary Electrophoresis/Mass Spectrometry of APTS-Labeled
Glycans for the Identification of Unknown Glycan Species in Capillary Electrophoresis/Laser-Induced
Fluorescence Systems, Analytical Chemistry, 21 (85), 10218–10224.
[135] Simpson, S.L., Quirino, J.P. and Terabe, S. 2008, On-line sample preconcentration in capillary electrophoresis,
Journal of Chromatography A, 1–2 (1184), 504–541.
[136] Kitagawa, F. and Otsuka, K. 2014, Recent applications of on-line sample preconcentration techniques in capillary
electrophoresis, Journal of Chromatography A, (1335), 43–60.
[137] Zhu, G., Sun, L. and Dovichi, N.J. 2016, Dynamic pH junction preconcentration in capillary electrophoresis-
electrospray ionization-mass spectrometry for proteomics analysis, The Analyst, 18 (141), 5216–5220.
[138] Biacchi, M., Bhajun, R., Saïd, N., Beck, A., François, Y.N. and Leize-Wagner, E. 2014, Analysis of monoclonal
antibody by a novel CE-UV/MALDI-MS interface, Electrophoresis, 20 (35), 2986–2995.
[139] Gennaro, L.A., Salas-Solano, O. and Ma, S. 2006, Capillary electrophoresis–mass spectrometry as a
characterization tool for therapeutic proteins, Analytical Biochemistry, 2 (355), 249–258.
[140] Gahoual, R., Burr, A., Busnel, J.-M., Kuhn, L., Hammann, P., Beck, A., François, Y.-N. and Leize-Wagner, E.
2013, Rapid and multi-level characterization of trastuzumab using sheathless capillary electrophoresis-tandem
mass spectrometry, mAbs, 3 (5), 479–490.
[141] Dada, O.O., Zhao, Y., Jaya, N. and Salas-Solano, O. 2017, High-Resolution Capillary Zone Electrophoresis with Mass
Spectrometry Peptide Mapping of Therapeutic Proteins: Peptide Recovery and Post-translational Modification Analysis
in Monoclonal Antibodies and Antibody–Drug Conjugates, Analytical Chemistry, 21 (89), 11236–11242.
[142] Eur Med Agency EMA 2014, Guideline on Similar Biological Medicinal Products, CHMP43704. Available at:
http://www.ema.europa.eu/docs/en_GB/document_library/Scientific guideline/2014/10/WC500176768.pdf (Accessed: 5 May 2023).
[143] Gahoual, R., Biacchi, M., Chicher, J., Kuhn, L., Hammann, P., Beck, A., Leize-Wagner, E. and François, Y.N.
2014, Monoclonal antibodies biosimilarity assessment using transient isotachophoresis capillary zone
electrophoresis-tandem mass spectrometry, mAbs, 6 (6), 1464–1473.
[144] Corti, A. and Curnis, F. 2011, Isoaspartate-dependent molecular switches for integrin–ligand recognition,
Journal of Cell Science, 4 (124), 515–522.
[145] Robinson, N.E. and Robinson, A.B. 2001, Molecular clocks, Proceedings of the National Academy of Sciences,
3 (98), 944–949.
[146] Halley, J. et al. 2020, An Industry Perspective on Forced Degradation Studies of Biopharmaceuticals: Survey
Outcome and Recommendations, Journal of Pharmaceutical Sciences, 1 (109), 6–21.
[147] Lu, X., Machiesky, L.A., De Mel, N., Du, Q., Xu, W., Washabaugh, M., Jiang, X.-R. and Wang, J. 2020,
Characterization of IgG1 Fc Deamidation at Asparagine 325 and Its Impact on Antibody-dependent Cell-mediated
Cytotoxicity and FcγRIIIa Binding, Scientific Reports, 1 (10), 383.
[148] Gahoual, R., Heidenreich, A.-K., Somsen, G.W., Bulau, P., Reusch, D., Wuhrer, M. and Haberger, M. 2017,
Detailed Characterization of Monoclonal Antibody Receptor Interaction Using Affinity Liquid Chromatography
Hyphenated to Native Mass Spectrometry, Analytical Chemistry, 10 (89), 5404–5412.
- 230 -
[149] Lew, C., Gallegos-Perez, J.-L., Fonslow, B., Lies, M. and Guttman, A. 2015, Rapid Level-3 Characterization of
Therapeutic Antibodies by Capillary Electrophoresis Electrospray Ionization Mass Spectrometry, Journal of
Chromatographic Science, 3 (53), 443–449.
[150] Mo, J., Tymiak, A.A. and Chen, G. 2012, Structural mass spectrometry in biologics discovery: advances and
future trends, Drug Discovery Today, 23–24 (17), 1323–1330.
[151] Faserl, K., Sarg, B. and Lindner, H.H. 2020, Application of CE-MS for the analysis of histones and histone
modifications, Methods, (184), 125–134.
[152] Heemskerk, A.A.M., Busnel, J.-M., Schoenmaker, B., Derks, R.J.E., Klychnikov, O., Hensbergen, P.J., Deelder,
A.M. and Mayboroda, O.A. 2012, Ultra-Low Flow Electrospray Ionization-Mass Spectrometry for Improved
Ionization Efficiency in Phosphoproteomics, Analytical Chemistry, 10 (84), 4552–4559.
[153] Wada, R., Matsui, M. and Kawasaki, N. 2019, Influence of N-glycosylation on effector functions and thermal
stability of glycoengineered IgG1 monoclonal antibody with homogeneous glycoforms, mAbs, 2 (11), 350–372.
[154] Gahoual, R., Busnel, J.-M., Beck, A., François, Y.-N. and Leize-Wagner, E. 2014, Full Antibody Primary
Structure and Microvariant Characterization in a Single Injection Using Transient Isotachophoresis and Sheathless
Capillary Electrophoresis–Tandem Mass Spectrometry, Analytical Chemistry, 18 (86), 9074–9081.
[155] Kammeijer, G.S.M., Jansen, B.C., Kohler, I., Heemskerk, A.A.M., Mayboroda, O.A., Hensbergen, P.J.,
Schappler, J. and Wuhrer, M. 2017, Sialic acid linkage differentiation of glycopeptides using capillary
electrophoresis – electrospray ionization – mass spectrometry, Scientific Reports, 1 (7), 3733.
[156] Giorgetti, J. et al. 2018, Monoclonal antibody N-glycosylation profiling using capillary electrophoresis – Mass
spectrometry: Assessment and method validation, Talanta, (178), 530–537.
[157] Giorgetti, J., Beck, A., Leize-Wagner, E. and Francois, Y. 2020, Combination of intact, middle-up and bottom-
up levels to characterize 7 therapeutic monoclonal antibodies by capillary electrophoresis – Mass spectrometry,
Journal of Pharmaceutical and Biomedical Analysis, (182), 113107.
[158] Bejan-Angoulvant, T. and Alexandre, J. 2019, Mécanismes d’action et toxicités potentielles des anticorps
monoclonaux, médecine/sciences, 12 (35), 1114–1120.
[159] Hemperly, A. and Vande Casteele, N. 2018, Clinical Pharmacokinetics and Pharmacodynamics of Infliximab in
the Treatment of Inflammatory Bowel Disease, Clinical Pharmacokinetics, 8 (57), 929–942.
[160] Eur Med Agency EMA 2011, Guideline on bioanalytical method validation. Available at: http://www.ema.
europa.eu/docs/en_GB/document_library/Scientific_guideline/2011/08/ WC500109686.pdf, 2011. (Accessed: 16 October 2021).
[161] Food Drug Adm FDA 2018, Bioanalytical Method Validation Guidance for Industry. Available at:
https://www.fda.gov/regulatory-information/search-fda-guidance-documents/bioanalytical-method-validation-guidance-industry (Accessed: 5 May 2023).
[162] Kaza, M., Karaźniewicz-Łada, M., Kosicka, K., Siemiątkowska, A. and Rudzki, P.J. 2019, Bioanalytical method
validation: new FDA guidance vs. EMA guideline. Better or worse?, Journal of Pharmaceutical and Biomedical
Analysis, (165), 381–385.
[163] Josephy, P.D., Eling, T. and Mason, R.P. 1982, The horseradish peroxidase-catalyzed oxidation of 3,5,3’,5’-
tetramethylbenzidine. Free radical and charge-transfer complex intermediates., Journal of Biological Chemistry,
7 (257), 3669–3675.
[164] Wolbink, G.J. 2005, Relationship between serum trough infliximab levels, pretreatment C reactive protein levels,
and clinical response to infliximab treatment in patients with rheumatoid arthritis, Annals of the Rheumatic
Diseases, 5 (64), 704–707.
[165] Sono, K., Yamada, A., Yoshimatsu, Y., Takada, N. and Suzuki, Y. 2012, Factors associated with the loss of
response to infliximab in patients with Crohn’s disease, Cytokine, 2 (59), 410–416.
[166] Cahuzac, H. and Devel, L. 2020, Analytical Methods for the Detection and Quantification of ADCs in Biological
Matrices, Pharmaceuticals, 12 (13), 462.
[167] Dopatka, H.D. and Giesendorf, B. 1992, Single point quantification of antibody by ELISA without need of a
reference curve, Journal of Clinical Laboratory Analysis, 6 (6), 417–422.
[168] Domínguez, M., Moreno, I. and Toraño, A. 2019, Quantitation of monoclonal antibody by capture ELISA based
on initial enzyme activity rate, Journal of Immunological Methods, (474), 112645.
- 231 -
[169] Żak, M.M. et al. 2021, Development and characterization of a quantitative ELISA to detect anti-SARS-CoV-2
spike antibodies, Heliyon, 12 (7), e08444.
[170] Wadhwa, M., Knezevic, I., Kang, H.-N. and Thorpe, R. 2015, Immunogenicity assessment of biotherapeutic
products: An overview of assays and their utility, Biologicals, 5 (43), 298–306.
[171] Gunn, G.R., Sealey, D.C.F., Jamali, F., Meibohm, B., Ghosh, S. and Shankar, G. 2016, From the bench to clinical
practice: understanding the challenges and uncertainties in immunogenicity testing for biopharmaceuticals,
Clinical and Experimental Immunology, 2 (184), 137–146.
[172] Hennig, C., Rink, L., Fagin, U., Jabs, W.J. and Kirchner, H. 2000, The influence of naturally occurring
heterophilic anti-immunoglobulin antibodies on direct measurement of serum proteins using sandwich ELISAs,
Journal of Immunological Methods, 1–2 (235), 71–80.
[173] Urban, P.L. 2016, Quantitative mass spectrometry: an overview, Philosophical Transactions of the Royal Society
A: Mathematical, Physical and Engineering Sciences, 2079 (374), 20150382.
[174] Jiang, L., He, L. and Fountoulakis, M. 2004, Comparison of protein precipitation methods for sample preparation
prior to proteomic analysis, Journal of Chromatography A, 2 (1023), 317–320.
[175] El Amrani, M., van den Broek, M.P.H., Göbel, C. and van Maarseveen, E.M. 2016, Quantification of active
infliximab in human serum with liquid chromatography–tandem mass spectrometry using a tumor necrosis factor
alpha -based pre-analytical sample purification and a stable isotopic labeled infliximab bio-similar as internal
standard: A target-based, sensitive and cost-effective method, Journal of Chromatography A, (1454), 42–48.
[176] Damen, C.W.N., Derissen, E.J.B., Schellens, J.H.M., Rosing, H. and Beijnen, J.H. 2009, The bioanalysis of the monoclonal
antibody trastuzumab by high-performance liquid chromatography with fluorescence detection after immuno-affinity
purification from human serum, Journal of Pharmaceutical and Biomedical Analysis, 5 (50), 861–866.
[177] Li, K.W., Gonzalez-Lozano, M.A., Koopmans, F. and Smit, A.B. 2020, Recent Developments in Data
Independent Acquisition (DIA) Mass Spectrometry: Application of Quantitative Analysis of the Brain Proteome,
Frontiers in Molecular Neuroscience, (13), 564446.
[178] Barbier Saint Hilaire, P., Rousseau, K., Seyer, A., Dechaumet, S., Damont, A., Junot, C. and Fenaille, F. 2020,
Comparative Evaluation of Data Dependent and Data Independent Acquisition Workflows Implemented on an
Orbitrap Fusion for Untargeted Metabolomics, Metabolites, 4 (10), 158.
[179] Kettenbach, A.N., Rush, J. and Gerber, S.A. 2011, Absolute quantification of protein and post-translational
modification abundance with stable isotope–labeled synthetic peptides, Nature Protocols, 2 (6), 175–186.
[180] McCabe, A., Dolled-Filhart, M., Camp, R.L. and Rimm, D.L. 2005, Automated Quantitative Analysis (AQUA)
of In Situ Protein Expression, Antibody Concentration, and Prognosis, JNCI: Journal of the National Cancer
Institute, 24 (97), 1808–1815.
[181] Johnson, J. et al. 2021, Construction of à la carte QconCAT protein standards for multiplexed quantification of
user-specified target proteins, BMC Biology, 1 (19), 195.
[182] Brun, V., Dupuis, A., Adrait, A., Marcellin, M., Thomas, D., Court, M., Vandenesch, F. and Garin, J. 2007,
Isotope-labeled Protein Standards, Molecular & Cellular Proteomics, 12 (6), 2139–2149.
[183] Barr, J.R. et al. 1996, Isotope dilution--mass spectrometric quantification of specific proteins: model application
with apolipoprotein A-I, Clinical Chemistry, 10 (42), 1676–1682.
[184] Wang, X., Liang, Y., Liu, L., Shi, J. and Zhu, H.-J. 2016, Targeted absolute quantitative proteomics with SILAC
internal standards and unlabeled full-length protein calibrators (TAQSI) : Novel targeted absolute quantitative
proteomics (TAQSI), Rapid Communications in Mass Spectrometry, 5 (30), 553–561.
[185] Auclair, J. and Rathore, A.S. 2021, The Multi-Attribute Method (MAM) for the Characterization of
Biopharmaceuticals, LCGC North America, 28–32.
[186] Butré, C.I., D’Atri, V., Diemer, H., Colas, O., Wagner, E., Beck, A., Cianferani, S., Guillarme, D. and Delobel,
A. 2023, Interlaboratory Evaluation of a User-Friendly Benchtop Mass Spectrometer for Multiple-Attribute
Monitoring Studies of a Monoclonal Antibody, Molecules, 6 (28), 2855.
- 232 -
[187] Wei, C., Su, D., Wang, J., Jian, W. and Zhang, D. 2018, LC–MS Challenges in Characterizing and Quantifying
Monoclonal Antibodies (mAb) and Antibody-Drug Conjugates (ADC) in Biological Samples, Current
Pharmacology Reports, 1 (4), 45–63.
[188] Chiu, H.-H., Tsai, Y.-J., Lo, C., Lin, C.-H., Tsai, I.-L. and Kuo, C.-H. 2022, Development of an efficient mAb
quantification assay by LC-MS/MS using rapid on-bead digestion, Analytica Chimica Acta, (1193), 339319.
[189] Guo, X., Fillmore, T.L., Gao, Y. and Tang, K. 2016, Capillary Electrophoresis–Nanoelectrospray Ionization–
Selected Reaction Monitoring Mass Spectrometry via a True Sheathless Metal-Coated Emitter Interface for
Robust and High-Sensitivity Sample Quantification, Analytical Chemistry, 8 (88), 4418–4425.
[190] Faserl, K., Kremser, L., Müller, M., Teis, D. and Lindner, H.H. 2015, Quantitative Proteomics Using Ultralow
Flow Capillary Electrophoresis–Mass Spectrometry, Analytical Chemistry, 9 (87), 4633–4640.
[191] Ni, W., Dai, S., Karger, B.L. and Zhou, Z.S. 2010, Analysis of Isoaspartic Acid by Selective Proteolysis with
Asp-N and Electron Transfer Dissociation Mass Spectrometry, Analytical Chemistry, 17 (82), 7485–7491.
[192] Vatsa, S. 2022, In silico prediction of post-translational modifications in therapeutic antibodies, mAbs, 1 (14), 2023938.
[193] Pisupati, K. et al. 2017, Biosimilarity under stress: A forced degradation study of Remicade® and Remsima TM,
mAbs, 7 (9), 1197–1209.
[194] Reichert, J.M. 2012, Marketed therapeutic antibodies compendium, mAbs, 3 (4), 413–415.
[195] Kaplon, H., Crescioli, S., Chenoweth, A., Visweswaraiah, J. and Reichert, J.M. 2023, Antibodies to watch in
2023, mAbs, 1 (15), 2153410.
[196] Peng, X. et al. 2015, Development and Validation of LC–MS/MS Method for the Quantitation of Infliximab in
Human Serum, Chromatographia, 7–8 (78), 521–531.
[197] El Amrani, M., Donners, A.A.M., Hack, C.E., Huitema, A.D.R. and van Maarseveen, E.M. 2019, Six-step
workflow for the quantification of therapeutic monoclonal antibodies in biological matrices with liquid
chromatography mass spectrometry – A tutorial, Analytica Chimica Acta, (1080), 22–34.
[198] Faserl, K., Sarg, B., Gruber, P. and Lindner, H.H. 2018, Investigating capillary electrophoresis-mass spectrometry for the
analysis of common post-translational modifications, Electrophoresis, 9–10 (39), 1208–1215.
[199] Pieper, R. et al. 2003, The human serum proteome: Display of nearly 3700 chromatographically separated protein
spots on two-dimensional electrophoresis gels and identification of 325 distinct proteins, Proteomics, 7 (3), 1345–1364.
[200] Hagman, C., Ricke, D., Ewert, S., Bek, S., Falchetto, R. and Bitsch, F. 2008, Absolute Quantification of
Monoclonal Antibodies in Biofluids by Liquid Chromatography−Tandem Mass Spectrometry, Analytical
Chemistry, 4 (80), 1290–1296.
[201] Huse, K., Böhme, H.-J. and Scholz, G.H. 2002, Purification of antibodies by affinity chromatography, Journal
of Biochemical and Biophysical Methods, 3 (51), 217–231.
[202] Kleinnijenhuis, A.J., Ingola, M., Toersche, J.H., van Holthoon, F.L. and van Dongen, W.D. 2016, Quantitative
bottom up analysis of infliximab in serum using protein A purification and integrated μLC-electrospray chip
IonKey MS/MS technology, Bioanalysis, 9 (8), 891–904.
[203] Gou, M.-J., Nys, G., Cobraiville, G., Demelenne, A., Servais, A.-C. and Fillet, M. 2020, Hyphenation of capillary
zone electrophoresis with mass spectrometry for proteomic analysis: Optimization and comparison of two
coupling interfaces, Journal of Chromatography A, (1618), 460873.
[204] Naghdi, E., Moran, G.E., Reinau, M.E., De Malsche, W. and Neusüß, C. 2023, Concepts and recent advances in microchip
electrophoresis coupled to mass spectrometry: Technologies and applications, Electrophoresis, 1–2 (44), 246–267.
[205] Hirayama, A., Abe, H., Yamaguchi, N., Tabata, S., Tomita, M. and Soga, T. 2018, Development of a sheathless
CE-ESI-MS interface, Electrophoresis, 11 (39), 1382–1389.
[206] Reinert, T., Beck, A., Houzé, P., Gahoual, R. and Francois, Y.-N. 2022, CE-MS methods for the characterization
of monoclonal antibodies, in apillary lectrophoresis‐Mass Spectrometry for roteomics and Metabolomics.
Wiley-Ramautar, R. & Chen, D. D. Y., 281–312.
[207] Present, D.H., Mayer, L. and Braakman, T. 1999, Infliximab for the Treatment of Fistulas in Patients with
Crohn’s Disease, The New England Journal of Medicine, 8.
- 233 -
[208] Batot, C. 2004, valuation de l’efficacité structurale d’un anticorps monoclonal anti-tnfalpha l’infliximab dans
la polyarthrite rhumatoide. Thèse en médecine. Université de Nancy.
[209] Pino, L.K., Searle, B.C., Bollinger, J.G., Nunn, B., MacLean, B. and MacCoss, M.J. 2020, The Skyline ecosystem:
Informatics for quantitative mass spectrometry proteomics, Mass Spectrometry Reviews, 3 (39), 229–244.
[210] Gonzalez-Quintela, A., Alende, R., Gude, F., Campos, J., Rey, J., Meijide, L.M., Fernandez-Merino, C. and
Vidal, C. 2008, Serum levels of immunoglobulins (IgG, IgA, IgM) in a general adult population and their
relationship with alcohol consumption, smoking and common metabolic abnormalities: Serum immunoglobulin
levels in adults, Clinical & Experimental Immunology, 1 (151), 42–50.
[211] Liang, S. et al. 2013, Structural Basis for Treating Tumor Necrosis Factor α (TNFα)-associated Diseases with
the Therapeutic Antibody Infliximab, Journal of Biological Chemistry, 19 (288), 13799–13807.
[212] Patton, A., Mullenix, M.C., Swanson, S.J. and Koren, E. 2005, An acid dissociation bridging ELISA for detection
of antibodies directed against therapeutic proteins in the presence of antigen, Journal of Immunological Methods,
1–2 (304), 189–195.
[213] Burich, M.A., AuBuchon, J.P. and Anderson, H.J. 1986, Evaluation of rapid antibody dissociation techniques,
Immunohematology, 4 (2), 76–80.
[214] Shukla, D., Zamolo, L., Cavallotti, C. and Trout, B.L. 2011, Understanding the Role of Arginine as an Eluent in Affinity
Chromatography via Molecular Computations, The Journal of Physical Chemistry B, 11 (115), 2645–2654.
[215] Roberts, C.J. 2014, Therapeutic protein aggregation: mechanisms, design, and control, Trends in Biotechnology,
7 (32), 372–380.
[216] Joshi, V., Shivach, T., Kumar, V., Yadav, N. and Rathore, A. 2014, Avoiding antibody aggregation during
processing: Establishing hold times, Biotechnology Journal, 9 (9), 1195–1205.
[217] Kailemia, M.J., Ruhaak, L.R., Lebrilla, C.B. and Amster, I.J. 2014, Oligosaccharide Analysis by Mass
Spectrometry: A Review of Recent Developments, Analytical Chemistry, 1 (86), 196–212.
[218] Patel, K. and Borchardt, R.T. 1990, Chemical pathways of peptide degradation. III. Effect of primary sequence on the
pathways of deamidation of asparaginyl residues in hexapeptides, Pharmaceutical Research, 8 (07), 787–793.
[219] Kato, K., Nakayoshi, T., Kurimoto, E. and Oda, A. 2020, Mechanisms of Deamidation of Asparagine Residues and
Effects of Main-Chain Conformation on Activation Energy, International Journal of Molecular Sciences, 19 (21), 7035.
[220] Kim, Y., Yeo, I., Kim, H., Son, M. and Kim, Y. 2020, Preparation of Tissue Samples for Large-scale Quantitative
Mass Spectrometric Analysis, Biotechnology and Bioprocess Engineering, 4 (25), 551–561.
[221] Ren, D., Pipes, G.D., Liu, D., Shih, L.-Y., Nichols, A.C., Treuheit, M.J., Brems, D.N. and Bondarenko, P.V.
2009, An improved trypsin digestion method minimizes digestion-induced modifications on proteins, Analytical
Biochemistry, 1 (392), 12–21.
[222] Kawasue, S., Sakaguchi, Y., Koga, R., Yoshida, H. and Nohta, H. 2020, Assessment method for deamidation in
proteins using carboxylic acid derivatization-liquid chromatography-tandem mass spectrometry, Journal of
Pharmaceutical and Biomedical Analysis, (181), 113095.
[223] Lu, L. et al. 2022, In vitro/in vivo degradation analysis of trastuzumab by combining specific capture on HER2
mimotope peptide modified material and LC-QTOF-MS, Analytica Chimica Acta, (1225), 340199.
[224] Colombel, J.F. et al. 2010, Infliximab, Azathioprine, or Combination Therapy for Crohn’s Disease, New England
Journal of Medicine, 15 (362), 1383–1395.
[225] Neurath, M.F. 2014, Cytokines in inflammatory bowel disease, Nature Reviews Immunology, 5 (14), 329–342.
[226] Balkwill, F. 2009, Tumour necrosis factor and cancer, c a n ce r, 11.
[227] Van Deventer, S.J. 1997, Tumour necrosis factor and Crohn’s disease., Gut, 4 (40), 443–448.
[228] Adegbola, S.O., Sahnan, K., Warusavitarne, J., Hart, A. and Tozer, P. 2018, Anti-TNF Therapy in Crohn’s
Disease, International Journal of Molecular Sciences, 8 (19), 2244.
[229] Sandborn, W.J. et al. 2001, Etanercept for active Crohn’s disease: A randomized, double-blind, placebo-
controlled trial, Gastroenterology, 5 (121), 1088–1094.
- 234 -
[230] D’Haens, G. et al. 2018, Increasing Infliximab Dose Based on Symptoms, Biomarkers, and Serum Drug
Concentrations Does Not Increase Clinical, Endoscopic, and Corticosteroid-Free Remission in Patients With
Active Luminal Crohn’s Disease, Gastroenterology, 5 (154), 1343-1351.e1.
[231] Hanauer, S.B. et al. 2002, Maintenance infliximab for Crohn’s disease: the ACCENT I randomised trial, The
Lancet, (359), 9.
[232] Mitoma, H. et al. 2008, Mechanisms for cytotoxic effects of anti–tumor necrosis factor agents on transmembrane
tumor necrosis factor α–expressing cells: Comparison among infliximab, etanercept, and adalimumab, Arthritis
& Rheumatism, 5 (58), 1248–1257.
[233] Oude Munnink, T., Henstra, M., Segerink, L., Movig, K. and Brummelhuis-Visser, P. 2016, Therapeutic drug
monitoring of monoclonal antibodies in inflammatory and malignant disease: Translating TNF-α experience to
oncology, Clinical Pharmacology & Therapeutics, 4 (99), 419–431.
[234] Filip, B., Maja, N., Severine, V., Gert, V.A., Geert, D.H., An, C. and Paul, R. 2003, Influence of Immunogenicity
on the Long-Term Efficacy of Infliximab in Crohn’s Disease, The New England Journal of Medicine, 8.
[235] Gupta, S., Jiskoot, W., Schöneich, C. and Rathore, A.S. 2022, Oxidation and Deamidation of Monoclonal
Antibody Products: Potential Impact on Stability, Biological Activity, and Efficacy, Journal of Pharmaceutical
Sciences, 4 (111), 903–918.
[236] Lux, A., Yu, X., Scanlan, C.N. and Nimmerjahn, F. 2013, Impact of Immune Complex Size and Glycosylation
on IgG Binding to Human FcγRs, The Journal of Immunology, 8 (190), 4315–4323.
[237] Shinkawa, T. et al. 2003, The Absence of Fucose but Not the Presence of Galactose or Bisecting N-
Acetylglucosamine of Human IgG1 Complex-type Oligosaccharides Shows the Critical Role of Enhancing
Antibody-dependent Cellular Cytotoxicity, Journal of Biological Chemistry, 5 (278), 3466–3473.
[238] Dashivets, T., Stracke, J., Dengl, S., Knaupp, A., Pollmann, J., Buchner, J. and Schlothauer, T. 2016, Oxidation
in the complementarity-determining regions differentially influences the properties of therapeutic antibodies,
mAbs, 8 (8), 1525–1535.
[239] Steenholdt, C., Bendtzen, K., Brynskov, J., Thomsen, O.Ø. and Ainsworth, M.A. 2014, Clinical Implications of
Measuring Drug and Anti-Drug Antibodies by Different Assays When Optimizing Infliximab Treatment Failure
in Crohn’s Disease: Post Hoc Analysis of a Randomized Controlled Trial, American Journal of Gastroenterology,
7 (109), 1055–1064.
[240] Dodig, S. 2009, Interferences in quantitative immunochemical methods, Biochemia Medica, 50–62.
[241] Saracevic, A., Dukic, L. and Simundic, A.-M. 2019, Haemolysis and lipemia interfere with resistin and
myeloperoxidase BioVendor ELISA assays, Biochemia medica, 2 (29), 315–321.
[242] Rosenkvist, J. and Dybkjaer, E. 1990, False negative results in anti-HIV ELISA due to insufficient antigen
coating of microtitre plates, Medical Laboratory Sciences, 4 (47), 353–355.
[243] Bensimon, A., Heck, A.J.R. and Aebersold, R. 2012, Mass Spectrometry–Based Proteomics and Network
Biology, Annual Review of Biochemistry, 1 (81), 379–405.
[244] Schubert, O.T., Röst, H.L., Collins, B.C., Rosenberger, G. and Aebersold, R. 2017, Quantitative proteomics:
challenges and opportunities in basic and applied research, Nature Protocols, 7 (12), 1289–1294.
[245] Legrand, P., Dembele, O., Alamil, H., Lamoureux, C., Mignet, N., Houzé, P. and Gahoual, R. 2022, Structural
identification and absolute quantification of monoclonal antibodies in suspected counterfeits using capillary
electrophoresis and liquid chromatography-tandem mass spectrometry, Analytical and Bioanalytical Chemistry,
8 (414), 2699–2712.
[246] Haselberg, R., Ratnayake, C.K., de Jong, G.J. and Somsen, G.W. 2010, Performance of a sheathless porous tip
sprayer for capillary electrophoresis–electrospray ionization-mass spectrometry of intact proteins, Journal of
Chromatography A, 48 (1217), 7605–7611.
[247] Gosset-Erard, C., Giorgetti, J., Biacchi, M., Aubriet, F., Leize-Wagner, E., Chaimbault, P. and François, Y.-N.
2022, Protocol for Etching Bare-Fused Silica Capillaries for Sheathless Capillary Electrophoresis–Mass
Spectrometry Coupling, in C. Neusüß and K. Jooß (eds) Capillary Electrophoresis-Mass Spectrometry. New
York, NY: Springer US (Methods in Molecular Biology), 49–59.
- 235 -
[248] Mitchell, R.A., Shuster, C., Shahidi, N., Galorport, C., DeMarco, M.L., Rosenfeld, G., Enns, R.A. and Bressler,
B. 2016, The Utility of Infliximab Therapeutic Drug Monitoring among Patients with Inflammatory Bowel
Disease and Concerns for Loss of Response: A Retrospective Analysis of a Real-World Experience, Canadian
Journal of Gastroenterology and Hepatology, (2016), 1–7.
[249] Tian, G., Wu, Y., Jin, X., Zeng, Z., Gu, X., Li, T., Chen, X., Li, G. and Liu, J. 2022, The incidence rate and
influence factors of hemolysis, lipemia, icterus in fasting serum biochemistry specimens, Plos One. Edited by C.
Johnson, 1 (17), e0262748.
[250] Pisupati, K. et al. 2017, A Multidimensional Analytical Comparison of Remicade and the Biosimilar Remsima,
[251] Walsh, G. and Jefferis, R. 2006, Post-translational modifications in the context of therapeutic proteins, Nature
Biotechnology, 10 (24), 1241–1252.
[252] Freeman, K. et al. 2016, Clinical effectiveness and cost-effectiveness of use of therapeutic monitoring of tumour
necrosis factor alpha (TNF-α) inhibitors [LISA-TRACKER® enzyme-linked immunosorbent assay (ELISA) kits,
TNF-α-Blocker ELISA kits and Promonitor® ELISA kits] versus standard care in patients with Crohn’s disease:
systematic reviews and economic modelling, Health Technology Assessment, 83 (20), 1–288.
[253] Willrich, M.A.V., Murray, D.L., Barnidge, D.R., Ladwig, P.M. and Snyder, M.R. 2015, Quantitation of
infliximab using clonotypic peptides and selective reaction monitoring by LC–MS/MS, International
Immunopharmacology, 1 (28), 513–520.
[254] Lee, C., Jeong, M., Lee, J.J., Seo, S., Cho, S.C., Zhang, W. and Jaquez, O. 2017, Glycosylation profile and
biological activity of Remicade® compared with Flixabi® and Remsima®, mAbs, 6 (9), 968–977.
[255] Millán-Martín, S. 2018, Comparability study for the determination of post-translational modifications of
infliximab innovator and biosimilars by automated high-throughput peptide mapping analysis, Thermoscientific,
Application note 21850
[256] Dick, L.W., Mahon, D., Qiu, D. and Cheng, K.-C. 2009, Peptide mapping of therapeutic monoclonal antibodies:
Improvements for increased speed and fewer artifacts, Journal of Chromatography B, 3 (877), 230–236.
[257] Zimmerman, D.W. 2004, A note on preliminary tests of equality of variances, British Journal of Mathematical
and Statistical Psychology, 1 (57), 173–181.
[258] Goetze, A.M., Liu, Y.D., Zhang, Z., Shah, B., Lee, E., Bondarenko, P.V. and Flynn, G.C. 2011, High-mannose glycans
on the Fc region of therapeutic IgG antibodies increase serum clearance in humans, Glycobiology, 7 (21), 949–959.
[259] Collin, M. and Davison, S. 2019, Brevetabilité d’un anticorps: Évolution des règles et des pratiques et
perspectives, médecine/sciences, 12 (35), 1175–1181.
[260] Mulcahy, A.W., Predmore, Z. and Mattke, S. 2014, The Cost Savings Potential of Biosimilar Drugs in the United
States, Perspective Rand Corporation. Available at : http://api.semanticscholar.org/CorpusID:2217939
[261] Food Drug Adm FDA 1999, Test Procedures and Acceptance Criteria for Biotechnological Biological Products.
Available at: https://www.fda.gov/regulatory-information/search-fda-guidance-documents/q6b-specifications-test-procedures-and-acceptance-criteria-
biotechnologicalbiological-products (Accessed: 11 July 2023).
[262] Douez, E., D’Atri, V., Guillarme, D., Antier, D., Guerriaud, M., Beck, A., Watier, H. and Foucault-Fruchard, L. 2023, Why
is there no biosimilar of Erbitux®?, Journal of Pharmaceutical and Biomedical Analysis, (234), 115544.
[263] Jung, S.K. et al. 2014, Physicochemical characterization of Remsima®, mAbs, 5 (6), 1163–1177.
[264] Luo, Q., Joubert, M.K., Stevenson, R., Ketchem, R.R., Narhi, L.O. and Wypych, J. 2011, Chemical modifications
in therapeutic protein aggregates generated under different stress conditions, The Journal of Biological Chemistry,
28 (286), 25134–25144.
[265] Hawe, A., Wiggenhorn, M., van de Weert, M., Garbe, J.H.O., Mahler, H.-C. and Jiskoot, W. 2012, Forced
degradation of therapeutic proteins, Journal of Pharmaceutical Sciences, 3 (101), 895–913.
[266] Yang, N., Tang, Q., Hu, P. and Lewis, M.J. 2018, Use of In Vitro Systems To Model In Vivo Degradation of
Therapeutic Monoclonal Antibodies, Analytical Chemistry, 13 (90), 7896–7902.
[267] Chung, S. et al. 2012, Quantitative evaluation of fucose reducing effects in a humanized antibody on Fcγ receptor
binding and antibody-dependent cell-mediated cytotoxicity activities, mAbs, 3 (4), 326–340.
- 236 -
[268] World Health Org WHO 2022, Guidelines on evaluation of biosimilars. Available at:
https://www.who.int/publications/m/item/guidelines-on-evaluation-of-biosimilars (Accessed: 11 July 2023).
[269] Legrand, P., Dufaÿ, S., Mignet, N., Houzé, P. and Gahoual, R. 2023, Modeling study of long-term stability of the
monoclonal antibody infliximab and biosimilars using liquid-chromatography–tandem mass spectrometry and size-
exclusion chromatography–multi-angle light scattering, Analytical and Bioanalytical Chemistry, 1 (415), 179–192.
[270] Reinert, T., Gahoual, R., Mignet, N., Kulus, A., Allez, M., Houzé, P. and François, Y.-N. 2023, Simultaneous
quantification and structural characterization of monoclonal antibodies after administration using capillary zone
electrophoresis-tandem mass spectrometry, Journal of Pharmaceutical and Biomedical Analysis, (233), 115446.
[271] Chen, M. and Cook, K.D. 2007, Oxidation Artifacts in the Electrospray Mass Spectrometry of Aβ Peptide,
[272] Kirikoshi, R., Manabe, N. and Takahashi, O. 2017, Succinimide Formation from an NGR-Containing Cyclic
Peptide: Computational Evidence for Catalytic Roles of Phosphate Buffer and the Arginine Side Chain,
International Journal of Molecular Sciences, 2 (18), 429.
[273] Kirikoshi, R., Manabe, N. and Takahashi, O. 2018, Phosphate-Catalyzed Succinimide Formation from Asp
Residues: A Computational Study of the Mechanism, International Journal of Molecular Sciences, 2 (19), 637.
[274] Lerch, T.F. et al. 2017, Infliximab crystal structures reveal insights into self-association, mAbs, 5 (9), 874–883.
[275] Abo El Maaty, M.I., Abo-Elkhier, M.M. and Abd Elwahaab, M.A. 2010, 3D graphical representation of protein sequences
and their statistical characterization, Physica A: Statistical Mechanics and its Applications, 21 (389), 4668–4676.
[276] Baker, M.P. and Jones, T.D. 2007, Identification and removal of immunogenicity in therapeutic proteins, Current
Opinion in Drug Discovery & Development, 2 (10), 219–227.
[277] Prado, M.S., Bendtzen, K. and Andrade, L.E.C. 2017, Biological anti-TNF drugs: immunogenicity underlying
treatment failure and adverse events, Expert Opinion on Drug Metabolism & Toxicology, 9 (13), 985–995.
[278] Murdaca, G., Negrini, S., Greco, M., Schiavi, C., Giusti, F., Borro, M. and Puppo, F. 2019, Immunogenicity of
infliximab and adalimumab, Expert Opinion on Drug Safety, 5 (18), 343–345.
[279] Eur Med Agency EMA 2017, Guideline on Immunogenicity assessment of therapeutic proteins. Available at:
https://www.ema.europa.eu/documents/scientific-guideline/guideline-immunogenicity-assessment-therapeutic-proteins-revision-1_en.pdf.
[280] Joyce, A., Shea, C., You, Z., Gorovits, B. and Lepsy, C. 2022, Determination of Anti-drug Antibody Affinity in Clinical
Study Samples Provides a Tool for Evaluation of Immune Response Maturation, The AAPS Journal, 6 (24), 114.
[281] Svitel, J., Boukari, H., Van Ryk, D., Willson, R.C. and Schuck, P. 2007, Probing the functional heterogeneity of
surface binding sites by analysis of experimental binding traces and the effect of mass transport limitation,
Biophysical Journal, 5 (92), 1742–1758.
[282] Friguet, B., Chaffotte, A.F., Djavadi-Ohaniance, L. and Goldberg, M.E. 1985, Measurements of the true affinity
constant in solution of antigen-antibody complexes by enzyme-linked immunosorbent assay, Journal of
Immunological Methods, 2 (77), 305–319.
[283] Bobrovnik, S.A. 2003, Determination of antibody affinity by ELISA. Theory, Journal of Biochemical and
Biophysical Methods, 3 (57), 213–236.
[284] Bobrovnik, S.A. 2000, ELISA-based method for determining the affinity of bivalent antibodies of two
specificities in a mixture, Ukrainskii Biokhimicheskii Zhurnal, 3 (72), 133–141.
[285] Dai, S., Schantz, A., Clements-Egan, A., Cannon, M. and Shankar, G. 2014, Development of a Method That
Eliminates False-Positive Results due to Nerve Growth Factor Interference in the Assessment of Fulranumab
Immunogenicity, The AAPS Journal, 3 (16), 464–477.
[286] Hart, M.H., de Vrieze, H., Wouters, D., Wolbink, G.-J., Killestein, J., de Groot, E.R., Aarden, L.A. and Rispens,
T. 2011, Differential effect of drug interference in immunogenicity assays, Journal of Immunological Methods,
1–2 (372), 196–203.
[287] Rispens, T., Hart, M.H., Ooijevaar-de Heer, P., van Leeuwen, A., Vennegoor, A., Killestein, J., Wolbink, G.-J.
and van der Kleij, D. 2013, Drug interference in immunogenicity assays depends on valency, Journal of
Pharmaceutical and Biomedical Analysis, (85), 179–185.
- 237 -
[288] Zhong, Z.D., Dinnogen, S., Hokom, M., Ray, C., Weinreich, D., Swanson, S.J. and Chirmule, N. 2010,
Identification and inhibition of drug target interference in immunogenicity assays, Journal of Immunological
Methods, 1–2 (355), 21–28.
[289] Refeyn 2022, Characterization of protein interaction equilibria, Application note
[290] Wu, D. and Piszczek, G. 2021, Rapid Determination of Antibody-Antigen Affinity by Mass Photometry, Journal
of Visualized Experiments, 168, 61784.
[291] Soltermann, F., Foley, E.D.B., Pagnoni, V., Galpin, M., Benesch, J.L.P., Kukura, P. and Struwe, W.B. 2020,
Quantifying Protein–Protein Interactions by Molecular Counting with Mass Photometry, Angewandte Chemie
International Edition, 27 (59), 10774–10779.
[292] Wu, D. and Piszczek, G. 2020, Measuring the affinity of protein-protein interactions on a single-molecule level
by mass photometry, Analytical Biochemistry, (592), 113575.
[293] Klasse, P.J. 2016, How to assess the binding strength of antibodies elicited by vaccination against HIV and other
viruses, Expert Review of Vaccines, 3 (15), 295–311.
[294] Gorovits, B. 2020, Current Considerations for Immunoglobulin Isotype Characterization of Antibody Response
against Biotherapeutics, The AAPS Journal, 6 (22), 144.
[295] Underwood, P.A. 1993, Problems and pitfalls with measurement of antibody affinity using solid phase binding
in the ELISA, Journal of Immunological Methods, 1 (164), 119–130.
[296] El Amrani, M., Göbel, C., Egas, A.C., Nierkens, S., Hack, C.E., Huitema, A.D.R. and van Maarseveen, E.M.
2019, Quantification of neutralizing anti-drug antibodies and their neutralizing capacity using competitive
displacement and tandem mass spectrometry: Infliximab as proof of principle, Journal of Translational
Autoimmunity, (1), 100004.
[297] Lipsky, P.E. et al. 2000, Infliximab and Methotrexate in the Treatment of Rheumatoid Arthritis, New England
Journal of Medicine, 22 (343), 1594–1602.
[298] Vande Casteele, N. et al. 2015, The relationship between infliximab concentrations, antibodies to infliximab and
disease activity in Crohn’s disease, Gut, 10 (64), 1539–1545.
[299] de Vries, M.K., Wolbink, G.J., Stapel, S.O., de Vrieze, H., van Denderen, J.C., Dijkmans, B.A.C., Aarden, L.A.
and van der Horst-Bruinsma, I.E. 2007, Decreased clinical response to infliximab in ankylosing spondylitis is
correlated with anti-infliximab formation, Annals of the Rheumatic Diseases, 9 (66), 1252–1254.
[300] Cassinotti, A. and Travis, S. 2009, Incidence and clinical significance of immunogenicity to infliximab in
Crohnʼs disease: A critical systematic review, Inflammatory Bowel Diseases, 8 (15), 1264–1275.
[301] Papamichael, K. et al. 2019, Appropriate Therapeutic Drug Monitoring of Biologic Agents for Patients With
Inflammatory Bowel Diseases, Clinical Gastroenterology and Hepatology, 9 (17), 1655-1668.e3.
[302] Feuerstein, J.D. et al. 2017, American Gastroenterological Association Institute Guideline on Therapeutic Drug
Monitoring in Inflammatory Bowel Disease, Gastroenterology, 3 (153), 827–834.
[303] Ternant, D., Mulleman, D., Degenne, D., Willot, S., Guillaumin, J.-M., Watier, H., Goupille, P. and Paintaud,
G. 2006, An Enzyme-Linked Immunosorbent Assay for Therapeutic Drug Monitoring of Infliximab, Therapeutic
Drug Monitoring, 2 (28), 169–174.
[304] Kopylov, U. et al. 2012, Clinical utility of antihuman lambda chain-based enzyme-linked immunosorbent assay
(ELISA) versus double antigen ELISA for the detection of anti-infliximab antibodies:, Inflammatory Bowel
Diseases, 9 (18), 1628–1633.
[305] Beeg, M. et al. 2019, A Surface Plasmon Resonance-based assay to measure serum concentrations of therapeutic
antibodies and anti-drug antibodies, Scientific Reports, 1 (9), 2064.
[306] Beeg, M., Burti, C., Allocati, E., Ciafardini, C., Banzi, R., Nobili, A., Caprioli, F., Garattini, S. and Gobbi, M.
2021, Surface plasmon resonance unveils important pitfalls of enzyme-linked immunoassay for the detection of
anti-infliximab antibodies in patients’ sera, Scientific Reports, 1 (11), 14976.
[307] Shibata, H., Nishimura, K., Miyama, C., Tada, M., Suzuki, T., Saito, Y. and Ishii-Watabe, A. 2018, Comparison
of different immunoassay methods to detect human anti-drug antibody using the WHO erythropoietin antibody
reference panel for analytes, Journal of Immunological Methods, (452), 73–77.
- 238 -
[308] Wang, S.-L., Ohrmund, L., Hauenstein, S., Salbato, J., Reddy, R., Monk, P., Lockton, S., Ling, N. and Singh, S.
2012, Development and validation of a homogeneous mobility shift assay for the measurement of infliximab and
antibodies-to-infliximab levels in patient serum, Journal of Immunological Methods, 1–2 (382), 177–188.
[309] Farcaş, E., Hanson, J., Pochet, L. and Fillet, M. 2018, Capillary electrophoretic mobility shift displacement assay
for the assessment of weak drug-protein interactions, Analytica Chimica Acta, (1034), 214–222.
[310] Hernández-Breijo, B. et al. 2016, Standardization of the homogeneous mobility shift assay protocol for
evaluation of anti-infliximab antibodies. Application of the method to Crohn’s disease patients treated with
infliximab, Biochemical Pharmacology, (122), 33–41.
[311] Jani, M., Isaacs, J.D., Morgan, A.W., Wilson, A.G., Plant, D., Hyrich, K.L., Chinoy, H. and Barton, A. 2016,
Detection of anti-drug antibodies using a bridging ELISA compared with radioimmunoassay in adalimumab-
treated rheumatoid arthritis patients with random drug levels, Rheumatology, 11 (55), 2050–2055.
[312] Steenholdt, C., Bendtzen, K., Brynskov, J., Thomsen, O.Ø. and Ainsworth, M.A. 2011, Cut-off levels and
diagnostic accuracy of infliximab trough levels and anti-infliximab antibodies in Crohn’s disease, Scandinavian
Journal of Gastroenterology, 3 (46), 310–318.
[313] Pękala, A., Filip, R. and Aebisher, D. 2021, Anti-Drug Antibodies in Patients with Inflammatory Bowel Diseases
Treated with Biosimilar Infliximab: A Prospective Cohort Study, Journal of Clinical Medicine, 12 (10), 2653.
[314] Kosmač, M., Avčin, T., Toplak, N., Simonini, G., Cimaz, R. and Šerbec, V.Č. 2011, Exploring the Binding Sites
of Anti-Infliximab Antibodies in Pediatric Patients With Rheumatic Diseases Treated With Infliximab, Pediatric
Research, 3 (69), 243–248.
[315] Svenson, M., Geborek, P., Saxne, T. and Bendtzen, K. 2007, Monitoring patients treated with anti-TNF-
biopharmaceuticals: assessing serum infliximab and anti-infliximab antibodies, Rheumatology, 12 (46), 1828–1834.
[316] Harding, F.A., Stickler, M.M., Razo, J. and DuBridge, R. 2010, The immunogenicity of humanized and fully
human antibodies: Residual immunogenicity resides in the CDR regions, mAbs, 3 (2), 256–265.
[317] Van Beers, M.M.C. and Bardor, M. 2012, Minimizing immunogenicity of biopharmaceuticals by controlling
critical quality attributes of proteins, Biotechnology Journal, 12 (7), 1473–1484.
[318] Harris, R.J. 2005, Heterogeneity of recombinant antibodies: linking structure to function, Developments in
Biologicals, (122), 117–127.
[319] Rosenberg, A.S. 2006, Effects of protein aggregates: An immunologic perspective, The AAPS Journal, 3 (8),
E501–E507.
[320] Sauerborn, M., Brinks, V., Jiskoot, W. and Schellekens, H. 2010, Immunological mechanism underlying the immune
response to recombinant human protein therapeutics, Trends in Pharmacological Sciences, 2 (31), 53–59.
- 239 -
Liste des communications scientifiques
LISTE DES COMMUNICATIONS SCIENTIFIQUES

PUBLICATIONS AVEC COMITÉ DE LECTURE
1. Reinert, T., Houzé P., Mignet, N., Francois, Y., Gahoual, R., Post-translational modifications
comparative identification and kinetic study of infliximab innovator and biosimilars in serum
using capillary electrophoresis tandem mass spectrometry, Journal of Pharmaceutical and
Biomedical Analysis, 2023, 234, 115541, doi: 10.1016/j.jpba.2023.115541
2. Reinert, T., Gahoual, R., Mignet, N., Kulus, A., Allez, M., Houzé P., Francois, Y.
Simultaneous quantification and structural characterization of monoclonal antibodies after
administration using capillary zone electrophoresis tandem mass spectrometry, Journal of
Pharmaceutical and Biomedical Analysis, 2023, 233, 115446, doi:
10.1016/j.jpba.2023.115446
CHAPITRE DE LIVRE
1. Reinert, T., Beck, A., Houzé, P., Gahoual, R. & Francois, Y. CE–MS Methods for the
Characterization of Monoclonal Antibodies. in apillary lectrophoresis‐Mass
Spectrometry for Proteomics and Metabolomics (eds. Ramautar, R. & Chen, D. D. Y.)
(Wiley, 2022), 281–312 doi:10.1002/9783527833092.ch11.
COMMUNICATIONS ORALES
1. Auteurs : Tessa Reinert, Pascal Houzé, Rabah Gahoual, Yannis Francois

Titre : Structural modifications of a monoclonal antibody after administration to patients
using CE-MS/MS
Congrès : Journée de l’UMR 7140, Université de Strasbourg, Strasbourg, 28 avril 2023

Titre : Quantification simultanée d’infliximab et d’anticorps anti-infliximab dans du sérum
par CE-MS/MS
Congrès : Congrès Francophone des sciences séparatives SEP23, Paris, 30 mars 2023
- 240 -

Titre : Quantification and structural characterization of infliximab by CE-ESI-MS/MS in
biological samples
Congrès : Journée scientifique groupe thématique électrophorèse capillaire de l’Afsep et
SCIEX, Paris, 18 octobre 2022

Titre : Etude cinétique des modifications structurales d'infliximab après administration aux
patients par CE-MS/MS
Congrès : Analytics, Nantes, 8 septembre 2022

Titre : Development of a CZE-ESI-MS/MS method for the study of Infliximab in a biological
environment
Congrès : International Symposium on Microscale Separations and Bioanalysis (MSB), Liège,
5 juillet 2022

Titre : Quantification et caractérisation structurale de l’infliximab dans des échantillons
biologiques par électrophorèse capillaire couplée à la spectrométrie de masse
Congrès : Congrès Francophone des sciences séparatives SEP21, Paris, 7 octobre 2021

Titre : CZE-ESI-MS/MS method for the study of Infliximab in biological environment
Congrès : Journée de l’UMR 7140, Université de Strasbourg, distanciel, 10 juin 2020
COMMUNICATIONS PAR AFFICHE
1. Auteurs : Tessa Reinert, Pascal Houzé, Aynur Naghizade, Sarah Cianferani, Oscar
Hernandez-Alba, Yannis-Nicolas Francois, Rabah Gahoual
Titre : Quantification of anti-infliximab antibodies in human serum using capillary
electrophoresis-tandem mass spectrometry
Congrès : American Society for Mass Spectrometry (ASMS), Houston, 6 juin 2023
- 241 -

Titre : tude cinétique des modifications structurales d’infliximab après administration aux
patients par CE-MS/MS
Congrès : Congrès Francophone des sciences séparatives SEP23, Paris, 30 mars 2023
3. Auteurs : Tessa Reinert, Pascal Houzé, Alexandre Kulus, Rabah Gahoual, Yannis Francois
Titre : Absolute quantification and structural characterization of infliximab in serum using
capillary electrophoresis-mass spectrometry
Congrès : American Society for Mass Spectrometry (ASMS), Minneapolis, 6 juin 2022
ENSEIGNEMENTS DÉLIVRÉS
Année universitaire 2020 – 2021 (64 HETD)
- Travaux dirigés module « méthodes de chimie organique et inorganique » (niveau Licence 2)

- Travaux dirigés module « méthodes de la chimie physique et analytique » (niveau Licence 2)
- Travaux dirigés module « chimie analytique » (niveau Licence 3)
Année universitaire 2021 – 2022 (64 HETD)
- Travaux dirigés module « chromatographie et spectrométrie de masse » (niveau Licence 3)

- Travaux dirigés module « méthodes de la chimie physique et analytique » (niveau Licence 2)
Année universitaire 2022 – 2023(64 HETD)
- Travaux dirigés module « chromatographie et spectrométrie de masse » (niveau Licence 3)

AUTRES RESPONSABILITÉS
Co-encadrement de deux stagiaires de M2 de février à juin 2022

Co-encadrement d’une stagiaire de M2 de février à juin 2023
- 242 -
Annexes
ANNEXES
Annexe 1 : Liste des peptides de l’infliximab après digestion tryptique
Chaîne lourde (heavy chain HC) Chaîne légère (light chain LC)
HC01 = EVK LC01 = DILLTQSPAILSVSPGER
HC02 = LEESGGGLVQPGGSMK LC02 = VSFSCR
HC03 = LSCVASGFIFSNHWMNWVR LC03 = ASQFVGSSIHWYQQR
HC04 = QSPEK LC04 = TNGSPR
HC05 = GLEWVAEIR LC05 = LLIK
HC06 = SK LC06 = YASESMSGIPSR
HC07 = SINSATHYAESVK LC07 = FSGSGSGTDFTLSINTVESEDIA
HC08 = GR DYYCQQSHSWPFTFGSGTNLEVK
HC09 = FTISR LC08 = R
HC10 = DDSK LC09 = TVAAPSVFIFPPSDEQLK
HC11 = SAVYLQMTDLR LC10 = SGTASVVCLLNNFYPRK
HC12 = TEDTGVYYCSR LC11 = EAK
HC13 = LC12 = VQWK
NYYGSTYDYWGQGTTLTVSSASTK LC13 = VDNALQSGNSQESVTEQDSK
HC14 = GPSVFPLAPSSK LC14 = DSTYSLSSTLTLSK
HC15 = STSGGTAALGCLVK LC15 = ADYEK
HC16 = DYFPEPVTVSWNSGALTSGVHT LC16 = HK
FPAVLQSSGLYSLSSVVTVPSSSLGTQTYI LC17 = VYACEVTHQGLSSPVTK
CNVNHKPSNTK (1mis) LC18 = SFNRGEC
HC17 = VDK LC19 = GECK
HC18 = K
HC19 = VEPK
HC20 = SCDK
HC21 =
THTCPPCPAPELLGGPSVFLFPPKPK(1mis)
HC22 = DTLMISR
HC23 = TPEVTCVVVDVSHEDPEVK
HC24 = FNWYVDGVEVHNAK
HC25 = TKPR
HC26 = EEQYNSTYR
HC27 = VVSVLTVLHQDWLNGK
HC28 = EYK
HC29 = CK
HC30 = VSNK
HC31 = ALPAPIEK
HC32 = TISK
HC33 = AK
HC34 = GQPR
HC35 = EPQVYTLPPSR
HC36 = DELTK
HC37 = NQVSLTCLVK
HC38 = GFYPSDIAVEWESNGQPENNYK
HC39 = TTPPVLDSDGSFFLYSK
HC40 = LTVDK
HC41 = SR
HC42 =
WQQGNVFSCSVMHEALHNHYTQK
HC43 = LSLSPG
243
Annexes
Annexe 2 : Liste des peptides et ions m/z correspondants suivis pour le

développement de la caractérisation structurale d’infliximab, tous sont
chargés deux fois.
Configuration Ion précurseur du Ion précurseur du
Peptide de l’acide peptide (m/z peptide (m/z SIL)
aminé infliximab)
N57 703,849 707,856
HC07
deaN57 704,341 708,348
N387 1272,569 1276,576
HC38
deaN387 1273,061 1277,068
N137 899,451 904,455
LC10
deaN137 899,947 904,947
N158 1068,488 1072,495
LC13
deaN158 1068,980 1072,987
D283 839,405 843,405
HC24
isoD283 839,405 843,405
D404 937,464 941,472
HC39
isoD404 937,464 941,472
M18 773,382 777,389
HC02
oxiM18 781,380 785,387
M85 648,834 653,839
HC11
oxiM85 656,832 661,836
M255 418,221 423,225
HC22 Représentation Légende
oxiM255 426,218 431,222
N300 + G0F 1317,527 1322,531 Galactose
N-
N300 + G1F 1398,553 1403,557 Acetylglucosamine
Mannose
HC26 N300 + G2F 1479,580 1484,584
N300 + G0FN 1215,987 1220,991 Fucose

N300 + G0N 1142,958 1147,962
N300 + M5 1203,475 1208,475
244
Annexes
Annexe 3 : spectres MS/MS des principaux peptides (avec et sans PTM)

étudiés au long du manuscrit. Spectres obtenus après analyse CE-MS/MS
d’infliximab à 19 µg·mL-1 issu de sérum. Rouge : ions observés
correspondant à un fragment CID du peptide
245
Annexes
246
Annexes
Annexe 4 : Poster présenté à l’ASMS 2022
247
Annexes
Annexe 5 : Poster présenté à SEP2023
248
Annexes
Annexe 6 : Poster présenté à l’ASMS 2023
249
Annexes
250
Annexes
251
Tessa REINERT
Électrophorèse capillaire-spectrométrie de masse appliquée à
l’étude quantitative et structurale d’anticorps monoclonaux après
administration
Résumé
Les anticorps monoclonaux (mAbs) sont des glycoprotéines utilisées dans divers domaines médicaux.
Cependant, leurs nombreuses micro-hétérogénéités peuvent altérer l’efficacité thérapeutique. L’étude du
devenir post-administration des mAbs, d’un point de vue structurel et quantitatif, est cruciale pour mieux
comprendre les diverses réponses cliniques des patients. Pour réduire le temps et les erreurs associées à
l’utilisation d’un panel de méthodes analytiques orthogonales, il faut développer des stratégies capables
d’obtenir de multiples informations simultanément. La spectrométrie de masse s’est imposée comme une
méthode essentielle pour la quantification et la caractérisation structurale de biomolécules. Les travaux de
ce manuscrit présentent le développement et l’application d’une méthode basée sur le couplage CE-ESI-
MS/MS pour quantifier l’infliximab, un mAb thérapeutique, à partir d’une matrice biologique. De manière
simultanée, la méthode permet de caractériser la proportion de modifications post-traductionnelles apparues
sur le mAb in vivo. En outre, cette analyse fournit des informations sur l’immunogénicité apparue.
Mots-clés : Spectrométrie de masse, Electrophorèse capillaire, Anticorps monoclonaux, Quantification,

Modifications post-traductionnelles, Immunogénicité, Interactions non-covalentes
Summary
Monoclonal antibodies (mAbs) are glycoproteins used in a variety of medical fields. However, their
numerous microheterogeneities can alter therapeutic efficacy. Studying the post-administration outcome of
mAbs, from a structural and quantitative point of view, is crucial to better understand the diverse clinical
responses of patients. In order to reduce the time and errors associated with using an array of orthogonal
analytical methods, it is necessary to develop strategies to obtain multiple informations simultaneously.
Mass spectrometry has emerged as an essential method for the quantification and structural characterization
of biomolecules. This manuscript presents the development and application of a method based on CE-ESI-
MS/MS analysis to quantify a therapeutic mAb, infliximab, from a biological matrix. At the same time, the
method enables the characterization of post-translational modifications that have occurred in vivo on the
mAb. It also provides information on the immunogenicity developed by patients.
Keywords: Mass spectrometry, Capillary electrophoresis, Monoclonal antibodies, Quantification, Post-

translational modifications, Immunogenicity, Non-covalent interactions

REINERT Tessa 2023 ED222

Transféré par

Droits d'auteur :

Formats disponibles

REINERT Tessa 2023 ED222

Transféré par

Informations du document

Titre original

Copyright

Formats disponibles

Partager ce document

Partager ou intégrer le document

Options de partage

Avez-vous trouvé ce document utile ?

Ce contenu est-il inapproprié ?

Droits d'auteur :

Formats disponibles

REINERT Tessa 2023 ED222

Transféré par

Droits d'auteur :

Formats disponibles

Capillary electrophoresis-mass spectrometry applied to

the quantitative and structural study of monoclonal

To cite this version:

HAL Id: tel-04601237

HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est

ÉCOLE DOCTORALE DES SCIENCES CHIMIQUES

Pour obtenir le grade de : Docteur de l’université de Strasbourg

Électrophorèse capillaire-spectrométrie de masse

AUTRES MEMBRES DU JURY :

À présent, je vais remercier mes proches, à qui je dois beaucoup.

Introduction GÉNÉrale ......................................................................................................................................... - 19 -

Partie I : Introduction et revue bibliographique ........................................................ - 24 -

Chapitre 1. Anticorps monoclonaux thérapeutiques............................................................................ - 25 -

Chapitre 2. Couplage CE-MS/MS pour l’analyse d’anticorps monoclonaux ................................ - 37 -

Chapitre 3. Méthodes pour le suivi quantitatif de mAbs ..................................................................... - 63 -

Chapitre 4. Sélection des peptides à suivre.............................................................................................. - 81 -

Chapitre 5. Développement de la méthode de purification ................................................................ - 87 -

Chapitre 6. Analyse CESI-MS/MS des peptides ................................................................................. - 107 -

Partie III : Application de la stratégie CE-MS/MS pour la quantification et

Chapitre 8. Quantification et caractérisation structurale simultanée d’infliximab in vivo - 129 -

Partie IV : Identification et quantification d’anticorps immunogènes

Chapitre 11. Quantification simultanée de l’infliximab et de ses anticorps immunogènes dans le

Conclusion générale et perspectives ......................................................................................... - 219 -

LISTE DES FIGURES ET DES TABLES

Figure 8.S1. Séquence d’acides aminés de l’infliximab.

𝑟 − 𝑟𝑎𝑡𝑖𝑜 Rapport des Aires MS des peptides IFX*LC01/ADM*LC01 (SIL-IFX/SIL-ADM)

𝑦 − 𝑟𝑎𝑡𝑖𝑜 Rapport des Aires MS des peptides IFXLC01/ADM*LC01 (IFX/SIL-ADM)

Ce manuscrit est divisé en 4 parties :

• La deuxième partie expose les travaux de développement et d'optimisation de la stratégie

• Enfin, la Partie IV est dédiée à l’extension de la méthode analytique pour quantifier,

1.1. Structure des mAbs

Il existe quatre grandes familles d’anticorps monoclonaux thérapeutiques à ce jour : les

Murin Chimérique Humanisé Humain

1.1.2. Fonctions effectrices

1.1.2.b. Cytotoxicités des mAbs

1.1.2.c. Mécanisme de recyclage de l’anticorps

1.1.3. Modifications post-traductionnelles

▪ Déamidation des asparagines

▪ Isomérisation des acides aspartiques

1.2. Infliximab, un mAb thérapeutique

1.2.1.a. Historique de la maladie

1.2.1.b. Mécanisme inflammatoire : rôle du TNF-α

1.2.1.c. Prise en charge thérapeutique

1.2.2. Traitement par infliximab

1.2.2.a. Commercialisation de l’infliximab

1.2.2.b. Mécanisme d’action

Chemo ines Cyto ines

Figure 1.3. Mécanismes d’action de l’infliximab dans le système humain.

Dans un premier temps, ce chapitre vise à présenter les principes fondamentaux de la CE et de la

2.1. Électrophorèse capillaire

2.1.1.a. Électrophorèse capillaire de zone (CZE)

E : Intensité du champ électrique (V·cm-1)

𝜇𝑎𝑝𝑝 = 𝜇𝑒𝑜 + 𝜇𝑒𝑝 . (2.3)

2.1.1.b. Isotachophorèse (ITP)

tat initial tat stationnaire

Figure 2.2. Représentation schématique d’une séparation d’analytes en isotachophorèse (ITP).

2.1.1.c. Isotachophorèse en mode transitoire (t-ITP)

2.1.2. Efficacité de séparation

2.2. Spectrométrie de masse

𝑟 − 𝑟𝑎𝑡𝑖𝑜 Rapport des Aires MS des peptides IFXLC01/ADMLC01 (SIL-IFX/SIL-ADM)